F414966

General Info

Members Datasets Scaffolds Average Seq Length
341 206 307 233

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2884791551|2884793920
Length 236
Sequence AQQTRLLVAVDCIIFGFDGQEIKLLLIQRGFEPCKGKWSLVGGFVQEEESAEDAATRVLKNLTGLDGIYMEQLHTFSSPDRDSVERTISVAYTALIDIKRYKQLHEDFHAVWFPINHHPELIFDHNAMVNQAKERLRYKAALHPLLLELLPPKFTLPQLQQLYESVYNTSFDKGNFSRKILSTGLLVRLADKDKLSSRKGAFYYKVDKKKYSVNLHAFLNFVPEALMKKSAAAGNR

Samples

Sample ID Description Type Environment
1 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
2 2738541283 Pedobacter sp. OK701 Isolate Unclassified
3 2738541302 Pedobacter sp. CF074 Isolate Unclassified
4 2738543023 Pedobacter sp. OK628 Isolate Unclassified
5 2739367651 Pedobacter sp. OK291 Isolate Unclassified
6 2739367656 Pedobacter sp. CF523 Isolate Unclassified
7 2739367663 Pedobacter sp. YR510 Isolate Unclassified
8 2818991437 Pedobacter terrae 518 Isolate Unclassified
9 2818991444 Filimonas endophytica 3197 Isolate Unclassified
10 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
11 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
12 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
13 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
14 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
15 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
16 2883068021 Chitinophaga rhizosphaerae T16R-86 Isolate Rhizosphere
17 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
18 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2904467357 Chitinophaga sancti 3198 Isolate Unclassified
21 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
22 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
23 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
24 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
27 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
28 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
29 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
30 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
31 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
32 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
33 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
34 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
35 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
36 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
37 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
38 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
39 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
40 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
41 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
42 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
43 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
44 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
45 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
46 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
47 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
60 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
61 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
62 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
113 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
114 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
121 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
122 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
170 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
171 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
184 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
185 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
190 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
191 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
195 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
196 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
197 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
203 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
204 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.74
Metatranscriptomes 0.29
Isolates 9.97

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.21
Nodule 0
Rhizoplane 0.88
Rhizosphere 82.7
Stem 0
Stem Tuber 0
Unclassified 8.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1007551 3300002739 Bacteria 1531
2 JGI25152J39213_1000797 3300002773 Bacteria 15825
3 JGI25150J39212_1000005 3300002774 Bacteria 311800
4 JGI25159J45721_1014186 3300002987 Bacteria 1809
5 JGI25151J46595_10000004 3300003187 Bacteria 494006
6 JGI25153J46596_10000004 3300003215 Bacteria 494006
7 rootL2_10220197 3300003322 Bacteria 2305
8 rootH1_10022072 3300003323 Bacteria 13446
9 JGI25160J50197_1005770 3300003354 Bacteria 5106
10 Ga0055536_1000153 3300003781 Bacteria 59409
11 Ga0055530_10002032 3300003791 Bacteria 13668
12 Ga0058862_12360975 3300004803 Bacteria 971
13 Ga0065714_10002200 3300005288 Bacteria 145275
14 Ga0065714_10004920 3300005288 Bacteria 8261
15 Ga0065714_10065826 3300005288 Bacteria 8370
16 Ga0065714_10067281 3300005288 Bacteria 5701
17 Ga0065714_10069489 3300005288 Bacteria 4208
18 Ga0070658_10000091 3300005327 Bacteria 81263
19 Ga0070676_10014223 3300005328 Bacteria 4372
20 Ga0070683_100149897 3300005329 Bacteria 2211
21 Ga0070690_100152475 3300005330 Bacteria 1578
22 Ga0070670_100079953 3300005331 Bacteria 2810
23 Ga0070666_10000043 3300005335 Bacteria 111402
24 Ga0070666_10023572 3300005335 Bacteria 4007
25 Ga0070680_100537792 3300005336 Unclassified 1001
26 Ga0068868_100012496 3300005338 Bacteria 6209
27 Ga0068868_100172611 3300005338 Bacteria 1790
28 Ga0070660_100000268 3300005339 Bacteria 34613
29 Ga0070661_100007517 3300005344 Bacteria 7516
30 Ga0070668_100384913 3300005347 Bacteria 1194
31 Ga0070669_100060017 3300005353 Bacteria 2793
32 Ga0070669_100321584 3300005353 Bacteria 1249
33 Ga0070675_100219632 3300005354 Bacteria 1655
34 Ga0070671_100273498 3300005355 Bacteria 1436
35 Ga0070674_100089454 3300005356 Bacteria 2218
36 Ga0070674_100140024 3300005356 Bacteria 1815
37 Ga0070673_100188177 3300005364 Bacteria 1771
38 Ga0070673_100618133 3300005364 Bacteria 989
39 Ga0070688_100344460 3300005365 Unclassified 1089
40 Ga0070688_100424010 3300005365 Bacteria 989
41 Ga0070667_100027384 3300005367 Bacteria 4741
42 Ga0070667_100043145 3300005367 Bacteria 3784
43 Ga0070678_100026834 3300005456 Bacteria 3901
44 Ga0070662_100043833 3300005457 Bacteria 3202
45 Ga0070662_100130649 3300005457 Bacteria 1936
46 Ga0070681_10036765 3300005458 Bacteria 4917
47 Ga0070681_10639101 3300005458 Unclassified 979
48 Ga0068867_100010336 3300005459 Bacteria 6585
49 Ga0068867_100032180 3300005459 Bacteria 3791
50 Ga0070679_100012664 3300005530 Bacteria 8067
51 Ga0070684_100098642 3300005535 Bacteria 2606
52 Ga0068853_100223757 3300005539 Unclassified 1719
53 Ga0068853_100781173 3300005539 Bacteria 914
54 Ga0070672_100044396 3300005543 Bacteria 3432
55 Ga0070672_100064723 3300005543 Bacteria 2889
56 Ga0068855_100000070 3300005563 Bacteria 123584
57 Ga0068855_100225885 3300005563 Bacteria 2098
58 Ga0068855_100245749 3300005563 Bacteria 1997
59 Ga0068855_100255526 3300005563 Bacteria 1953
60 Ga0068857_100154752 3300005577 Bacteria 2079
61 Ga0068854_100031979 3300005578 Bacteria 3658
62 Ga0068854_100784691 3300005578 Bacteria 829
63 Ga0068856_100539656 3300005614 Unclassified 1187
64 Ga0068852_100016169 3300005616 Bacteria 5810
65 Ga0068852_100066406 3300005616 Bacteria 3150
66 Ga0068859_100000012 3300005617 Bacteria 300376
67 Ga0068859_100017867 3300005617 Bacteria 7129
68 Ga0068859_100260079 3300005617 Unclassified 1827
69 Ga0068864_100001692 3300005618 Bacteria 18147
70 Ga0068864_100108184 3300005618 Bacteria 2474
71 Ga0068866_10131545 3300005718 Bacteria 1424
72 Ga0068861_100212883 3300005719 Bacteria 1629
73 Ga0068861_100276880 3300005719 Bacteria 1443
74 Ga0068851_10093749 3300005834 Bacteria 1585
75 Ga0068851_10204510 3300005834 Bacteria 1103
76 Ga0068870_10015695 3300005840 Bacteria 3601
77 Ga0068863_100200091 3300005841 Bacteria 1921
78 Ga0068858_100026261 3300005842 Bacteria 5413
79 Ga0068858_100039957 3300005842 Bacteria 4350
80 Ga0068860_100003621 3300005843 Bacteria 15887
81 Ga0068860_100254002 3300005843 Unclassified 1712
82 Ga0068862_100055959 3300005844 Bacteria 3379
83 Ga0068862_100326471 3300005844 Bacteria 1418
84 Ga0081539_10000935 3300005985 Bacteria 54736
85 Ga0097621_100002771 3300006237 Bacteria 11995
86 Ga0097621_100188121 3300006237 Bacteria 1787
87 Ga0097621_100227056 3300006237 Bacteria 1629
88 Ga0068871_100005308 3300006358 Bacteria 9024
89 Ga0068871_100326211 3300006358 Bacteria 1353
90 Ga0068865_100003179 3300006881 Bacteria 9842
91 Ga0068865_100210839 3300006881 Bacteria 1514
92 Ga0097620_100000012 3300006931 Bacteria 300376
93 Ga0097620_100017868 3300006931 Bacteria 7129
94 Ga0097620_100260090 3300006931 Unclassified 1827
95 Ga0105240_10000200 3300009093 Bacteria 121941
96 Ga0105240_11176087 3300009093 Bacteria 813
97 Ga0105245_10120110 3300009098 Bacteria 2454
98 Ga0105245_10394144 3300009098 Bacteria 1382
99 Ga0105247_10000259 3300009101 Bacteria 48820
100 Ga0105247_10002821 3300009101 Bacteria 11598
101 Ga0105243_10490527 3300009148 Bacteria 1162
102 Ga0105243_10635369 3300009148 Bacteria 1033
103 Ga0105241_10000783 3300009174 Bacteria 24146
104 Ga0105241_10001680 3300009174 Bacteria 16832
105 Ga0105242_10036573 3300009176 Bacteria 3940
106 Ga0105242_10208083 3300009176 Bacteria 1741
107 Ga0105242_10774463 3300009176 Bacteria 947
108 Ga0105237_10000239 3300009545 Bacteria 78319
109 Ga0105237_10004113 3300009545 Bacteria 16964
110 Ga0105237_10029929 3300009545 Bacteria 5531
111 Ga0105237_10615650 3300009545 Unclassified 1093
112 Ga0105238_10041113 3300009551 Bacteria 4683
113 Ga0105249_10001020 3300009553 Bacteria 24765
114 Ga0105249_10002010 3300009553 Bacteria 17654
115 Ga0105249_10501311 3300009553 Bacteria 1259
116 Ga0105239_10000006 3300010375 Bacteria 442319
117 Ga0105239_10001375 3300010375 Bacteria 32635
118 Ga0105239_10236889 3300010375 Bacteria 2048
119 Ga0105246_10024263 3300011119 Bacteria 3937
120 Ga0105246_10027811 3300011119 Bacteria 3710
121 Ga0105246_10266930 3300011119 Bacteria 1366
122 Ga0157373_10007016 3300013100 Bacteria 8394
123 Ga0157373_10031358 3300013100 Unclassified 3827
124 Ga0157373_10085659 3300013100 Bacteria 2221
125 Ga0157373_10482084 3300013100 Unclassified 895
126 Ga0157371_10000129 3300013102 Bacteria 115362
127 Ga0157371_10005158 3300013102 Bacteria 11130
128 Ga0157371_10006529 3300013102 Bacteria 9599
129 Ga0157371_10033415 3300013102 Bacteria 3696
130 Ga0157371_10138800 3300013102 Unclassified 1731
131 Ga0157370_10001754 3300013104 Bacteria 26733
132 Ga0157370_10002662 3300013104 Bacteria 21430
133 Ga0157370_10004768 3300013104 Bacteria 15435
134 Ga0157370_10007770 3300013104 Bacteria 11623
135 Ga0157370_10097544 3300013104 Bacteria 2757
136 Ga0157370_10113209 3300013104 Bacteria 2536
137 Ga0157370_10125417 3300013104 Bacteria 2397
138 Ga0157370_10141493 3300013104 Bacteria 2242
139 Ga0157370_10208571 3300013104 Bacteria 1811
140 Ga0157370_10525611 3300013104 Bacteria 1086
141 Ga0157370_10630459 3300013104 Bacteria 980
142 Ga0157369_10000071 3300013105 Bacteria 140377
143 Ga0157369_10009456 3300013105 Bacteria 11144
144 Ga0157369_10346903 3300013105 Bacteria 1542
145 Ga0157369_10599184 3300013105 Bacteria 1137
146 Ga0157374_10285643 3300013296 Bacteria 1629
147 Ga0157374_10349821 3300013296 Bacteria 1468
148 Ga0157378_10037322 3300013297 Bacteria 4303
149 Ga0157378_10159831 3300013297 Bacteria 2107
150 Ga0157378_10206574 3300013297 Bacteria 1860
151 Ga0157378_10384786 3300013297 Bacteria 1378
152 Ga0163162_10000522 3300013306 Bacteria 35640
153 Ga0163162_10002878 3300013306 Bacteria 16383
154 Ga0163162_10327451 3300013306 Bacteria 1665
155 Ga0157372_10130064 3300013307 Bacteria 2896
156 Ga0157372_10172055 3300013307 Bacteria 2506
157 Ga0157375_10050996 3300013308 Bacteria 4061
158 Ga0157375_10257775 3300013308 Bacteria 1905
159 Ga0157375_10380362 3300013308 Bacteria 1578
160 Ga0163163_10080192 3300014325 Bacteria 3264
161 Ga0182008_10000227 3300014497 Bacteria 44000
162 Ga0182008_10000319 3300014497 Bacteria 37848
163 Ga0182008_10007453 3300014497 Bacteria 6039
164 Ga0182008_10158045 3300014497 Bacteria 1139
165 Ga0157377_10007905 3300014745 Bacteria 5160
166 Ga0157377_10100254 3300014745 Unclassified 1724
167 Ga0157379_10084606 3300014968 Bacteria 2842
168 Ga0157379_10711174 3300014968 Unclassified 943
169 Ga0157376_10060470 3300014969 Bacteria 3182
170 Ga0182006_1000218 3300015261 Bacteria 55915
171 Ga0182006_1000230 3300015261 Bacteria 53105
172 Ga0182006_1003449 3300015261 Bacteria 8078
173 Ga0182007_10000006 3300015262 Bacteria 427355
174 Ga0183373_1001 3300015682 Bacteria 1410374
175 Ga0163161_10000538 3300017792 Bacteria 30943
176 Ga0163161_10000560 3300017792 Bacteria 29984
177 Ga0163161_10000698 3300017792 Bacteria 26759
178 Ga0163161_10011213 3300017792 Bacteria 6209
179 Ga0163161_10063834 3300017792 Bacteria 2685
180 Ga0163161_10147378 3300017792 Unclassified 1786
181 Ga0209436_103942 3300025208 Bacteria 3781
182 Ga0209258_100081 3300025242 Bacteria 254564
183 Ga0207425_1000008 3300025245 Bacteria 618024
184 Ga0209148_1000276 3300025254 Bacteria 80610
185 Ga0209129_1000040 3300025258 Bacteria 313043
186 Ga0209130_1002679 3300025284 Bacteria 8488
187 Ga0209676_1000090 3300025292 Bacteria 256336
188 Ga0209025_1000020 3300025294 Bacteria 618024
189 Ga0209758_1000022 3300025297 Bacteria 618024
190 Ga0209050_1000091 3300025298 Bacteria 253049
191 Ga0207426_1000154 3300025302 Bacteria 179701
192 Ga0207656_10067649 3300025321 Bacteria 1582
193 Ga0207682_10025545 3300025893 Bacteria 2343
194 Ga0207710_10000244 3300025900 Bacteria 46212
195 Ga0207710_10024833 3300025900 Bacteria 2583
196 Ga0207680_10001039 3300025903 Bacteria 13101
197 Ga0207645_10001934 3300025907 Bacteria 16720
198 Ga0207643_10023541 3300025908 Bacteria 3396
199 Ga0207705_10000132 3300025909 Bacteria 81270
200 Ga0207654_10010581 3300025911 Bacteria 4697
201 Ga0207654_10027042 3300025911 Unclassified 3115
202 Ga0207654_10052568 3300025911 Bacteria 2348
203 Ga0207654_10061631 3300025911 Bacteria 2195
204 Ga0207654_10254893 3300025911 Bacteria 1177
205 Ga0207654_10307325 3300025911 Bacteria 1080
206 Ga0207707_10283927 3300025912 Bacteria 1433
207 Ga0207707_10677061 3300025912 Bacteria 868
208 Ga0207695_10000055 3300025913 Bacteria 382776
209 Ga0207695_10046150 3300025913 Bacteria 4620
210 Ga0207695_10194167 3300025913 Bacteria 1947
211 Ga0207671_10001276 3300025914 Bacteria 29637
212 Ga0207671_10002831 3300025914 Bacteria 18039
213 Ga0207671_10003182 3300025914 Bacteria 16564
214 Ga0207671_10017420 3300025914 Bacteria 5538
215 Ga0207660_10341670 3300025917 Bacteria 1198
216 Ga0207657_10002015 3300025919 Bacteria 21959
217 Ga0207657_10049952 3300025919 Bacteria 3641
218 Ga0207652_10006969 3300025921 Bacteria 9104
219 Ga0207659_10061796 3300025926 Bacteria 2701
220 Ga0207659_10116151 3300025926 Bacteria 2042
221 Ga0207644_10015289 3300025931 Bacteria 5148
222 Ga0207644_10376904 3300025931 Bacteria 1156
223 Ga0207706_10023785 3300025933 Bacteria 5496
224 Ga0207706_10090243 3300025933 Bacteria 2694
225 Ga0207686_10010515 3300025934 Bacteria 5042
226 Ga0207686_10166929 3300025934 Bacteria 1548
227 Ga0207669_10074448 3300025937 Unclassified 2147
228 Ga0207691_10088448 3300025940 Bacteria 2778
229 Ga0207689_10003214 3300025942 Bacteria 14966
230 Ga0207689_10017970 3300025942 Bacteria 5970
231 Ga0207689_10033130 3300025942 Unclassified 4293
232 Ga0207661_10084462 3300025944 Bacteria 2630
233 Ga0207661_11036711 3300025944 Bacteria 755
234 Ga0207667_10000009 3300025949 Bacteria 603135
235 Ga0207667_10087532 3300025949 Bacteria 3222
236 Ga0207667_10105536 3300025949 Bacteria 2907
237 Ga0207667_10109051 3300025949 Bacteria 2855
238 Ga0207667_10446842 3300025949 Bacteria 1314
239 Ga0207651_10030334 3300025960 Bacteria 3442
240 Ga0207712_10002043 3300025961 Bacteria 13242
241 Ga0207712_10009910 3300025961 Bacteria 6039
242 Ga0207668_10155808 3300025972 Bacteria 1774
243 Ga0207668_10168718 3300025972 Bacteria 1714
244 Ga0207640_10197673 3300025981 Bacteria 1521
245 Ga0207658_10047674 3300025986 Bacteria 3137
246 Ga0207658_10052466 3300025986 Bacteria 3010
247 Ga0207677_10115962 3300026023 Bacteria 2004
248 Ga0207703_10012291 3300026035 Bacteria 6677
249 Ga0207639_10163838 3300026041 Unclassified 1876
250 Ga0207678_10105057 3300026067 Bacteria 2410
251 Ga0207702_10181846 3300026078 Bacteria 1937
252 Ga0207702_10740291 3300026078 Bacteria 970
253 Ga0207641_10000048 3300026088 Bacteria 178206
254 Ga0207648_10000559 3300026089 Bacteria 41660
255 Ga0207648_10002425 3300026089 Bacteria 20066
256 Ga0207648_10101434 3300026089 Bacteria 2522
257 Ga0207676_10030006 3300026095 Bacteria 4076
258 Ga0207676_10077826 3300026095 Bacteria 2684
259 Ga0207674_10068160 3300026116 Bacteria 3581
260 Ga0207675_100278366 3300026118 Bacteria 1625
261 Ga0207683_10000691 3300026121 Bacteria 30953
262 Ga0207698_10030554 3300026142 Bacteria 3876
263 Ga0207698_10387774 3300026142 Bacteria 1331
264 Ga0268266_10102421 3300028379 Bacteria 2525
265 Ga0268264_10002129 3300028381 Bacteria 17662
266 Ga0268264_10044870 3300028381 Bacteria 3669
267 Ga0316181_1218589 3300030744 Bacteria 1412
268 Ga0265327_10000152 3300031251 Bacteria 149065
269 Ga0307516_10113329 3300031730 Bacteria 2510
270 Ga0307405_10000012 3300031731 Bacteria 233774
271 Ga0307407_10000038 3300031903 Bacteria 68710
272 Ga0307409_100567846 3300031995 Bacteria 1116
273 Ga0307416_100000007 3300032002 Bacteria 433284
274 Ga0307414_10001873 3300032004 Bacteria 10862
275 Ga0307414_10003132 3300032004 Bacteria 8783
276 Ga0307415_100765452 3300032126 Bacteria 878
277 Ga0395899_0015505 3300037312 Bacteria 5810
278 Ga0395900_0017094 3300037418 Bacteria 7405
279 Ga0395901_0012317 3300038443 Bacteria 8679
280 Ga0451798_0995417 3300041458 Bacteria 825
281 Ga0451802_1573301 3300041460 Bacteria 857
282 Ga0466972_0004619 3300044658 Bacteria 6896
283 Ga0466964_0067973 3300044706 Bacteria 1499
284 Ga0466970_0041248 3300044765 Bacteria 2452
285 Ga0466970_0363166 3300044765 Bacteria 822
286 Ga0466959_0030795 3300045049 Unclassified 3973
287 Ga0495627_004756 3300046453 Bacteria 5613
288 Ga0495608_0397384 3300046511 Bacteria 843
289 Ga0495610_0042272 3300046512 Bacteria 2281
290 Ga0495633_0000485 3300046558 Bacteria 40274
291 Ga0495625_0073056 3300046660 Bacteria 2405
292 Ga0495686_0011745 3300047472 Bacteria 6166
293 Ga0496114_0405870 3300048917 Unclassified 1207
294 Ga0496121_0000011 3300048924 Bacteria 792193
295 Ga0496122_0001345 3300048925 Bacteria 40096
296 Ga0496123_0016360 3300048926 Bacteria 6030
297 Ga0496124_0126804 3300048927 Bacteria 2032
298 Ga0501047_0172271 3300049581 Bacteria 2033
299 Ga0501048_0658425 3300049582 Bacteria 752
300 nmdc:mga0k408_232713_c1 3300050493 Bacteria 1100
301 Ga0500658_0008498 3300053134 Bacteria 3792
302 Ga0500577_0001948 3300053142 Bacteria 5282
303 Ga0500590_020864 3300053148 Bacteria 3401
304 Ga0500604_0026432 3300053151 Bacteria 1674
305 Ga0500636_0004685 3300053177 Bacteria 7763
306 Ga0500645_046687 3300053730 Bacteria 1271
307 Ga0500645_075841 3300053730 Unclassified 962

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013104 Ga0157370_10525611 Ga0157370_105256112 223
2 3300049581 Ga0501047_0172271 Ga0501047_0172271_1316_2020 224
3 3300049582 Ga0501048_0658425 Ga0501048_0658425_37_741 224
4 3300053177 Ga0500636_0004685 Ga0500636_0004685_7049_7726 225
5 3300005353 Ga0070669_100321584 Ga0070669_1003215841 226
6 3300005356 Ga0070674_100140024 Ga0070674_1001400242 226
7 3300005365 Ga0070688_100344460 Ga0070688_1003444601 226
8 3300009148 Ga0105243_10490527 Ga0105243_104905271 226
9 3300013297 Ga0157378_10159831 Ga0157378_101598311 226
10 3300013308 Ga0157375_10257775 Ga0157375_102577752 226
11 3300014745 Ga0157377_10007905 Ga0157377_100079054 226
12 3300026089 Ga0207648_10101434 Ga0207648_101014342 226
13 3300003322 rootL2_10220197 rootL2_102201973 227
14 3300005985 Ga0081539_10000935 Ga0081539_1000093553 227
15 3300053151 Ga0500604_0026432 Ga0500604_0026432_47_751 227
16 3300005364 Ga0070673_100618133 Ga0070673_1006181332 228
17 3300025900 Ga0207710_10024833 Ga0207710_100248332 228
18 3300025911 Ga0207654_10010581 Ga0207654_100105817 228
19 3300025934 Ga0207686_10166929 Ga0207686_101669292 228
20 3300048927 Ga0496124_0126804 Ga0496124_0126804_1032_1736 228
21 iso_pu_bacteria 2585427687 2586208566 228
22 iso_pu_bacteria 2738541283 2738754801 228
23 iso_pu_bacteria 2738541283 2738759311 228
24 iso_pu_bacteria 2738541302 2738853027 228
25 iso_pu_bacteria 2739367651 2739586403 228
26 iso_pu_bacteria 2739367656 2739615767 228
27 iso_pu_bacteria 2739367656 2739617731 228
28 iso_pu_bacteria 2818991437 2819549095 228
29 iso_pu_bacteria 2842722452 2842725656 228
30 iso_pu_bacteria 2842909656 2842914412 228
31 iso_pu_bacteria 2849281842 2849282913 228
32 iso_pu_bacteria 2857627736 2857628455 228
33 iso_pu_bacteria 2857627736 2857630676 228
34 iso_pu_bacteria 2904445276 2904445625 228
35 iso_pu_bacteria 2904445276 2904449172 228
36 iso_pu_bacteria 2945997725 2946001175 228
37 iso_pu_bacteria 2954016120 2954018078 228
38 3300005328 Ga0070676_10014223 Ga0070676_100142233 229
39 3300005331 Ga0070670_100079953 Ga0070670_1000799533 229
40 3300005335 Ga0070666_10023572 Ga0070666_100235723 229
41 3300005338 Ga0068868_100012496 Ga0068868_1000124963 229
42 3300005339 Ga0070660_100000268 Ga0070660_10000026816 229
43 3300005347 Ga0070668_100384913 Ga0070668_1003849132 229
44 3300005353 Ga0070669_100060017 Ga0070669_1000600172 229
45 3300005356 Ga0070674_100089454 Ga0070674_1000894542 229
46 3300005364 Ga0070673_100188177 Ga0070673_1001881772 229
47 3300005367 Ga0070667_100043145 Ga0070667_1000431452 229
48 3300005456 Ga0070678_100026834 Ga0070678_1000268342 229
49 3300005457 Ga0070662_100130649 Ga0070662_1001306492 229
50 3300005459 Ga0068867_100032180 Ga0068867_1000321802 229
51 3300005539 Ga0068853_100223757 Ga0068853_1002237571 229
52 3300005539 Ga0068853_100781173 Ga0068853_1007811731 229
53 3300005543 Ga0070672_100044396 Ga0070672_1000443963 229
54 3300005563 Ga0068855_100245749 Ga0068855_1002457493 229
55 3300005578 Ga0068854_100784691 Ga0068854_1007846911 229
56 3300005614 Ga0068856_100539656 Ga0068856_1005396562 229
57 3300005617 Ga0068859_100260079 Ga0068859_1002600792 229
58 3300005718 Ga0068866_10131545 Ga0068866_101315451 229
59 3300005719 Ga0068861_100212883 Ga0068861_1002128832 229
60 3300005840 Ga0068870_10015695 Ga0068870_100156952 229
61 3300005843 Ga0068860_100254002 Ga0068860_1002540022 229
62 3300005844 Ga0068862_100326471 Ga0068862_1003264712 229
63 3300006237 Ga0097621_100188121 Ga0097621_1001881212 229
64 3300006881 Ga0068865_100003179 Ga0068865_1000031792 229
65 3300006931 Ga0097620_100260090 Ga0097620_1002600902 229
66 3300009093 Ga0105240_11176087 Ga0105240_111760871 229
67 3300009098 Ga0105245_10394144 Ga0105245_103941442 229
68 3300009176 Ga0105242_10208083 Ga0105242_102080832 229
69 3300009545 Ga0105237_10615650 Ga0105237_106156502 229
70 3300011119 Ga0105246_10027811 Ga0105246_100278113 229
71 3300013104 Ga0157370_10141493 Ga0157370_101414933 229
72 3300013105 Ga0157369_10599184 Ga0157369_105991842 229
73 3300013297 Ga0157378_10037322 Ga0157378_100373223 229
74 3300013308 Ga0157375_10050996 Ga0157375_100509963 229
75 3300025893 Ga0207682_10025545 Ga0207682_100255452 229
76 3300025907 Ga0207645_10001934 Ga0207645_100019342 229
77 3300025908 Ga0207643_10023541 Ga0207643_100235412 229
78 3300025911 Ga0207654_10061631 Ga0207654_100616312 229
79 3300025913 Ga0207695_10194167 Ga0207695_101941672 229
80 3300025919 Ga0207657_10002015 Ga0207657_1000201514 229
81 3300025926 Ga0207659_10061796 Ga0207659_100617962 229
82 3300025933 Ga0207706_10090243 Ga0207706_100902432 229
83 3300025937 Ga0207669_10074448 Ga0207669_100744482 229
84 3300025942 Ga0207689_10003214 Ga0207689_1000321414 229
85 3300025944 Ga0207661_11036711 Ga0207661_110367111 229
86 3300025949 Ga0207667_10109051 Ga0207667_101090512 229
87 3300025972 Ga0207668_10155808 Ga0207668_101558082 229
88 3300025981 Ga0207640_10197673 Ga0207640_101976731 229
89 3300025986 Ga0207658_10052466 Ga0207658_100524663 229
90 3300026023 Ga0207677_10115962 Ga0207677_101159622 229
91 3300026041 Ga0207639_10163838 Ga0207639_101638382 229
92 3300026078 Ga0207702_10740291 Ga0207702_107402911 229
93 3300026089 Ga0207648_10000559 Ga0207648_100005594 229
94 3300026118 Ga0207675_100278366 Ga0207675_1002783662 229
95 3300026121 Ga0207683_10000691 Ga0207683_1000069113 229
96 3300028379 Ga0268266_10102421 Ga0268266_101024212 229
97 3300028381 Ga0268264_10044870 Ga0268264_100448703 229
98 3300031730 Ga0307516_10113329 Ga0307516_101133292 229
99 3300041458 Ga0451798_0995417 Ga0451798_0995417_98_787 229
100 3300047472 Ga0495686_0011745 Ga0495686_0011745_455_1144 229
101 3300050493 nmdc:mga0k408_232713_c1 nmdc:mga0k408_232713_c1_62_751 229
102 3300053730 Ga0500645_046687 Ga0500645_046687_226_930 229
103 3300005335 Ga0070666_10000043 Ga0070666_1000004387 230
104 3300005338 Ga0068868_100172611 Ga0068868_1001726112 230
105 3300005355 Ga0070671_100273498 Ga0070671_1002734982 230
106 3300005367 Ga0070667_100027384 Ga0070667_1000273842 230
107 3300005543 Ga0070672_100064723 Ga0070672_1000647232 230
108 3300005616 Ga0068852_100016169 Ga0068852_1000161692 230
109 3300005617 Ga0068859_100000012 Ga0068859_10000001296 230
110 3300005618 Ga0068864_100001692 Ga0068864_10000169219 230
111 3300005834 Ga0068851_10204510 Ga0068851_102045102 230
112 3300005841 Ga0068863_100200091 Ga0068863_1002000911 230
113 3300005842 Ga0068858_100026261 Ga0068858_1000262614 230
114 3300005843 Ga0068860_100003621 Ga0068860_1000036216 230
115 3300006237 Ga0097621_100227056 Ga0097621_1002270562 230
116 3300006931 Ga0097620_100000012 Ga0097620_10000001296 230
117 3300009098 Ga0105245_10120110 Ga0105245_101201102 230
118 3300009101 Ga0105247_10002821 Ga0105247_100028215 230
119 3300009174 Ga0105241_10000783 Ga0105241_100007838 230
120 3300009176 Ga0105242_10774463 Ga0105242_107744632 230
121 3300009545 Ga0105237_10004113 Ga0105237_100041132 230
122 3300009553 Ga0105249_10001020 Ga0105249_1000102024 230
123 3300009553 Ga0105249_10501311 Ga0105249_105013112 230
124 3300011119 Ga0105246_10024263 Ga0105246_100242634 230
125 3300011119 Ga0105246_10266930 Ga0105246_102669301 230
126 3300013296 Ga0157374_10349821 Ga0157374_103498212 230
127 3300013297 Ga0157378_10206574 Ga0157378_102065742 230
128 3300013297 Ga0157378_10384786 Ga0157378_103847861 230
129 3300013306 Ga0163162_10002878 Ga0163162_1000287812 230
130 3300014325 Ga0163163_10080192 Ga0163163_100801923 230
131 3300014968 Ga0157379_10084606 Ga0157379_100846061 230
132 3300014969 Ga0157376_10060470 Ga0157376_100604702 230
133 3300025903 Ga0207680_10001039 Ga0207680_100010396 230
134 3300025914 Ga0207671_10002831 Ga0207671_100028315 230
135 3300025931 Ga0207644_10376904 Ga0207644_103769042 230
136 3300025940 Ga0207691_10088448 Ga0207691_100884483 230
137 3300025942 Ga0207689_10017970 Ga0207689_100179704 230
138 3300025960 Ga0207651_10030334 Ga0207651_100303343 230
139 3300025961 Ga0207712_10009910 Ga0207712_100099104 230
140 3300025972 Ga0207668_10168718 Ga0207668_101687182 230
141 3300026035 Ga0207703_10012291 Ga0207703_100122912 230
142 3300026088 Ga0207641_10000048 Ga0207641_1000004856 230
143 3300026095 Ga0207676_10030006 Ga0207676_100300062 230
144 3300026142 Ga0207698_10030554 Ga0207698_100305545 230
145 3300028381 Ga0268264_10002129 Ga0268264_100021297 230
146 iso_pu_bacteria 2818991444 2819590956 230
147 iso_pu_bacteria 2821136567 2821142407 230
148 iso_pu_bacteria 2902048731 2902053099 230
149 iso_pu_bacteria 2904467357 2904470426 230
150 iso_pu_bacteria 2929154850 2929156282 230
151 iso_pu_bacteria 2929177148 2929181982 230
152 iso_pu_bacteria 2929239360 2929243516 230
153 iso_pu_bacteria 2945977869 2945977921 230
154 iso_pu_bacteria 2946013367 2946016226 230
155 3300048917 Ga0496114_0405870 Ga0496114_0405870_453_1148 231
156 3300003781 Ga0055536_1000153 Ga0055536_100015324 232
157 3300003791 Ga0055530_10002032 Ga0055530_1000203212 232
158 3300005288 Ga0065714_10002200 Ga0065714_1000220096 232
159 3300005288 Ga0065714_10067281 Ga0065714_100672812 232
160 3300013100 Ga0157373_10085659 Ga0157373_100856592 232
161 3300013102 Ga0157371_10000129 Ga0157371_1000012912 232
162 3300013104 Ga0157370_10002662 Ga0157370_1000266210 232
163 3300013104 Ga0157370_10113209 Ga0157370_101132093 232
164 3300013104 Ga0157370_10208571 Ga0157370_102085712 232
165 3300013104 Ga0157370_10630459 Ga0157370_106304591 232
166 3300013105 Ga0157369_10000071 Ga0157369_1000007154 232
167 3300013306 Ga0163162_10000522 Ga0163162_1000052220 232
168 3300014497 Ga0182008_10000227 Ga0182008_1000022718 232
169 3300014497 Ga0182008_10000319 Ga0182008_100003199 232
170 3300015261 Ga0182006_1000218 Ga0182006_100021816 232
171 3300015261 Ga0182006_1000230 Ga0182006_100023018 232
172 3300015262 Ga0182007_10000006 Ga0182007_10000006264 232
173 3300015682 Ga0183373_1001 Ga0183373_10011114 232
174 3300017792 Ga0163161_10000538 Ga0163161_1000053824 232
175 3300017792 Ga0163161_10000560 Ga0163161_100005606 232
176 3300017792 Ga0163161_10000698 Ga0163161_1000069814 232
177 3300017792 Ga0163161_10011213 Ga0163161_100112138 232
178 3300017792 Ga0163161_10147378 Ga0163161_101473782 232
179 3300025292 Ga0209676_1000090 Ga0209676_100009064 232
180 3300025298 Ga0209050_1000091 Ga0209050_100009164 232
181 3300025914 Ga0207671_10017420 Ga0207671_100174206 232
182 3300025949 Ga0207667_10446842 Ga0207667_104468422 232
183 3300031731 Ga0307405_10000012 Ga0307405_1000001248 232
184 3300031903 Ga0307407_10000038 Ga0307407_1000003831 232
185 3300031995 Ga0307409_100567846 Ga0307409_1005678462 232
186 3300032002 Ga0307416_100000007 Ga0307416_10000000731 232
187 3300032004 Ga0307414_10001873 Ga0307414_100018736 232
188 3300041460 Ga0451802_1573301 Ga0451802_1573301_15_713 232
189 3300046512 Ga0495610_0042272 Ga0495610_0042272_480_1178 232
190 iso_pu_bacteria 2738543023 2739300083 232
191 iso_pu_bacteria 2852627209 2852628740 232
192 iso_pu_bacteria 2883068021 2883072150 232
193 3300005365 Ga0070688_100424010 Ga0070688_1004240101 233
194 3300005617 Ga0068859_100017867 Ga0068859_1000178675 233
195 3300005618 Ga0068864_100108184 Ga0068864_1001081842 233
196 3300005842 Ga0068858_100039957 Ga0068858_1000399573 233
197 3300005844 Ga0068862_100055959 Ga0068862_1000559594 233
198 3300006931 Ga0097620_100017868 Ga0097620_1000178682 233
199 3300009101 Ga0105247_10000259 Ga0105247_1000025914 233
200 3300009553 Ga0105249_10002010 Ga0105249_100020106 233
201 3300025900 Ga0207710_10000244 Ga0207710_1000024412 233
202 3300025942 Ga0207689_10033130 Ga0207689_100331302 233
203 3300025961 Ga0207712_10002043 Ga0207712_100020434 233
204 3300026095 Ga0207676_10077826 Ga0207676_100778262 233
205 3300053730 Ga0500645_075841 Ga0500645_075841_36_737 233
206 3300004803 Ga0058862_12360975 Ga0058862_123609752 234
207 3300005327 Ga0070658_10000091 Ga0070658_1000009120 234
208 3300005330 Ga0070690_100152475 Ga0070690_1001524751 234
209 3300005336 Ga0070680_100537792 Ga0070680_1005377921 234
210 3300005344 Ga0070661_100007517 Ga0070661_1000075172 234
211 3300005354 Ga0070675_100219632 Ga0070675_1002196322 234
212 3300005457 Ga0070662_100043833 Ga0070662_1000438333 234
213 3300005458 Ga0070681_10036765 Ga0070681_100367652 234
214 3300005458 Ga0070681_10639101 Ga0070681_106391012 234
215 3300005530 Ga0070679_100012664 Ga0070679_1000126644 234
216 3300005535 Ga0070684_100098642 Ga0070684_1000986422 234
217 3300005563 Ga0068855_100000070 Ga0068855_10000007013 234
218 3300005563 Ga0068855_100225885 Ga0068855_1002258852 234
219 3300005563 Ga0068855_100255526 Ga0068855_1002555262 234
220 3300005578 Ga0068854_100031979 Ga0068854_1000319792 234
221 3300005616 Ga0068852_100066406 Ga0068852_1000664063 234
222 3300005834 Ga0068851_10093749 Ga0068851_100937492 234
223 3300006237 Ga0097621_100002771 Ga0097621_1000027715 234
224 3300006358 Ga0068871_100005308 Ga0068871_1000053085 234
225 3300009093 Ga0105240_10000200 Ga0105240_1000020035 234
226 3300009174 Ga0105241_10001680 Ga0105241_100016805 234
227 3300009545 Ga0105237_10000239 Ga0105237_1000023921 234
228 3300009545 Ga0105237_10029929 Ga0105237_100299291 234
229 3300009551 Ga0105238_10041113 Ga0105238_100411133 234
230 3300010375 Ga0105239_10000006 Ga0105239_10000006118 234
231 3300010375 Ga0105239_10001375 Ga0105239_1000137520 234
232 3300010375 Ga0105239_10236889 Ga0105239_102368892 234
233 3300013100 Ga0157373_10007016 Ga0157373_100070165 234
234 3300013100 Ga0157373_10031358 Ga0157373_100313582 234
235 3300013100 Ga0157373_10482084 Ga0157373_104820841 234
236 3300013102 Ga0157371_10138800 Ga0157371_101388002 234
237 3300013104 Ga0157370_10001754 Ga0157370_100017544 234
238 3300013104 Ga0157370_10007770 Ga0157370_100077705 234
239 3300013105 Ga0157369_10009456 Ga0157369_100094565 234
240 3300013105 Ga0157369_10346903 Ga0157369_103469031 234
241 3300013296 Ga0157374_10285643 Ga0157374_102856432 234
242 3300013306 Ga0163162_10327451 Ga0163162_103274512 234
243 3300013307 Ga0157372_10172055 Ga0157372_101720552 234
244 3300014497 Ga0182008_10007453 Ga0182008_100074531 234
245 3300014745 Ga0157377_10100254 Ga0157377_101002542 234
246 3300014968 Ga0157379_10711174 Ga0157379_107111741 234
247 3300015261 Ga0182006_1003449 Ga0182006_10034495 234
248 3300017792 Ga0163161_10063834 Ga0163161_100638342 234
249 3300025242 Ga0209258_100081 Ga0209258_10008159 234
250 3300025254 Ga0209148_1000276 Ga0209148_100027659 234
251 3300025321 Ga0207656_10067649 Ga0207656_100676492 234
252 3300025909 Ga0207705_10000132 Ga0207705_1000013220 234
253 3300025911 Ga0207654_10027042 Ga0207654_100270422 234
254 3300025911 Ga0207654_10254893 Ga0207654_102548931 234
255 3300025911 Ga0207654_10307325 Ga0207654_103073252 234
256 3300025912 Ga0207707_10283927 Ga0207707_102839272 234
257 3300025912 Ga0207707_10677061 Ga0207707_106770611 234
258 3300025913 Ga0207695_10000055 Ga0207695_1000005535 234
259 3300025913 Ga0207695_10046150 Ga0207695_100461503 234
260 3300025914 Ga0207671_10001276 Ga0207671_1000127632 234
261 3300025914 Ga0207671_10003182 Ga0207671_100031822 234
262 3300025917 Ga0207660_10341670 Ga0207660_103416702 234
263 3300025919 Ga0207657_10049952 Ga0207657_100499522 234
264 3300025921 Ga0207652_10006969 Ga0207652_100069697 234
265 3300025926 Ga0207659_10116151 Ga0207659_101161512 234
266 3300025931 Ga0207644_10015289 Ga0207644_100152891 234
267 3300025933 Ga0207706_10023785 Ga0207706_100237852 234
268 3300025949 Ga0207667_10000009 Ga0207667_10000009496 234
269 3300025949 Ga0207667_10087532 Ga0207667_100875322 234
270 3300025949 Ga0207667_10105536 Ga0207667_101055362 234
271 3300026078 Ga0207702_10181846 Ga0207702_101818462 234
272 3300026142 Ga0207698_10387774 Ga0207698_103877741 234
273 3300031251 Ga0265327_10000152 Ga0265327_10000152112 234
274 3300032126 Ga0307415_100765452 Ga0307415_1007654521 234
275 3300037312 Ga0395899_0015505 Ga0395899_0015505_4007_4711 234
276 3300037418 Ga0395900_0017094 Ga0395900_0017094_3847_4551 234
277 3300038443 Ga0395901_0012317 Ga0395901_0012317_207_911 234
278 3300045049 Ga0466959_0030795 Ga0466959_0030795_2090_2794 234
279 3300046511 Ga0495608_0397384 Ga0495608_0397384_60_764 234
280 3300046660 Ga0495625_0073056 Ga0495625_0073056_328_1032 234
281 3300048924 Ga0496121_0000011 Ga0496121_0000011_286643_287347 234
282 3300048925 Ga0496122_0001345 Ga0496122_0001345_2515_3243 234
283 3300048926 Ga0496123_0016360 Ga0496123_0016360_855_1583 234
284 3300053134 Ga0500658_0008498 Ga0500658_0008498_426_1130 234
285 3300053142 Ga0500577_0001948 Ga0500577_0001948_2002_2706 234
286 3300053148 Ga0500590_020864 Ga0500590_020864_2307_3011 234
287 iso_pu_bacteria 2739367663 2739644838 234
288 iso_pu_bacteria 2884791551 2884793920 234
289 3300005288 Ga0065714_10065826 Ga0065714_100658267 235
290 3300013104 Ga0157370_10004768 Ga0157370_100047684 235
291 3300044706 Ga0466964_0067973 Ga0466964_0067973_160_867 235
292 3300044765 Ga0466970_0041248 Ga0466970_0041248_224_931 235
293 iso_pu_bacteria 2929177148 2929182027 235
294 iso_pu_bacteria 2945977869 2945977968 235
295 iso_pu_bacteria 2946013367 2946016179 235
296 3300002773 JGI25152J39213_1000797 JGI25152J39213_10007978 236
297 3300002774 JGI25150J39212_1000005 JGI25150J39212_100000582 236
298 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004250 236
299 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004250 236
300 3300005288 Ga0065714_10069489 Ga0065714_100694893 236
301 3300005329 Ga0070683_100149897 Ga0070683_1001498972 236
302 3300005719 Ga0068861_100276880 Ga0068861_1002768802 236
303 3300009148 Ga0105243_10635369 Ga0105243_106353692 236
304 3300013102 Ga0157371_10005158 Ga0157371_100051584 236
305 3300013102 Ga0157371_10006529 Ga0157371_100065297 236
306 3300013102 Ga0157371_10033415 Ga0157371_100334153 236
307 3300013104 Ga0157370_10097544 Ga0157370_100975442 236
308 3300013104 Ga0157370_10125417 Ga0157370_101254172 236
309 3300013307 Ga0157372_10130064 Ga0157372_101300641 236
310 3300013308 Ga0157375_10380362 Ga0157375_103803621 236
311 3300014497 Ga0182008_10158045 Ga0182008_101580452 236
312 3300025245 Ga0207425_1000008 Ga0207425_1000008187 236
313 3300025258 Ga0209129_1000040 Ga0209129_100004079 236
314 3300025294 Ga0209025_1000020 Ga0209025_1000020187 236
315 3300025297 Ga0209758_1000022 Ga0209758_1000022187 236
316 3300025911 Ga0207654_10052568 Ga0207654_100525682 236
317 3300025944 Ga0207661_10084462 Ga0207661_100844622 236
318 3300032004 Ga0307414_10003132 Ga0307414_100031324 236
319 3300046453 Ga0495627_004756 Ga0495627_004756_3089_3880 236
320 3300046558 Ga0495633_0000485 Ga0495633_0000485_37889_38680 236
321 3300005459 Ga0068867_100010336 Ga0068867_1000103363 237
322 3300009176 Ga0105242_10036573 Ga0105242_100365732 237
323 3300025934 Ga0207686_10010515 Ga0207686_100105152 237
324 3300026067 Ga0207678_10105057 Ga0207678_101050572 237
325 3300026089 Ga0207648_10002425 Ga0207648_100024255 237
326 3300030744 Ga0316181_1218589 Ga0316181_12185893 237
327 3300005288 Ga0065714_10004920 Ga0065714_100049203 238
328 3300044765 Ga0466970_0363166 Ga0466970_0363166_60_776 238
329 3300003323 rootH1_10022072 rootH1_1002207218 239
330 3300005577 Ga0068857_100154752 Ga0068857_1001547523 239
331 3300006358 Ga0068871_100326211 Ga0068871_1003262112 239
332 3300006881 Ga0068865_100210839 Ga0068865_1002108392 239
333 3300025986 Ga0207658_10047674 Ga0207658_100476744 239
334 3300026116 Ga0207674_10068160 Ga0207674_100681602 239
335 3300044658 Ga0466972_0004619 Ga0466972_0004619_2766_3485 239
336 3300002739 JGI25158J39367_1007551 JGI25158J39367_10075511 241
337 3300002987 JGI25159J45721_1014186 JGI25159J45721_10141862 241
338 3300003354 JGI25160J50197_1005770 JGI25160J50197_10057702 241
339 3300025208 Ga0209436_103942 Ga0209436_1039422 241
340 3300025284 Ga0209130_1002679 Ga0209130_10026797 241
341 3300025302 Ga0207426_1000154 Ga0207426_100015465 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21906

NrtR_WHD

NrtR DNA-binding winged helix domain

146

206

0.97

PF19368

AraR_C

AraR C-terminal winged HTH domain

142

222

0.9

PF00293

NUDIX

NUDIX domain

5

133

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3gz8-assembly2.cif.gz_D cocrystal structure of nudix domain of shewanella oneidensis nrtr complexed with adp ribose 0.8577 3 143
5deq-assembly1.cif.gz_A crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose 0.8442 5 218
3i9x-assembly1.cif.gz_A-2 crystal structure of a mutt/nudix family protein from listeria innocua 0.839 9 144
5deq-assembly1.cif.gz_A crystal structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi in complex with l-arabinose 0.8263 5 218
5bs6-assembly1.cif.gz_B apo structure of transcriptional factor arar from bacteroides thetaiotaomicron vpi 0.8256 6 220
ID Description Score Start End Superfamily
3gz5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9281 157 216 1.10.10.10
3gz5B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9147 152 216 1.10.10.10
3gz6B01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8916 14 130 3.90.79.10
af_O06597_8_150_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8812 15 148 3.90.79.10
3gz8B01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8757 15 143 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7W4GJB4-F1-model_v4 NUDIX hydrolase 0.966 14 102 GO:0016787
AF-A0A350KDX0-F1-model_v4 deleted 0.9645 8 106
AF-A0A4Q3NZA9-F1-model_v4 deleted 0.9557 8 98
AF-A0A7V4N3V5-F1-model_v4 NUDIX hydrolase 0.9534 6 107 GO:0016787
AF-A0A7W0UB59-F1-model_v4 NUDIX hydrolase 0.9475 13 147 GO:0016787

Feature Viewer

pLDDT pTM Quality
85.81 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map