F414753

General Info

Members Datasets Scaffolds Average Seq Length
341 153 682 276

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10705819|Ga0157380_107058191
Length 293
Sequence MSTTGTGLDPVSRDFYRRVMHQLQAHDIPFLVGGAYAFERYTGIGLHTKDFDLFVHPRDVDPALEMLALNGCQTDTPFPHWLAKAECGEDVVDLIYSSGNGVALVDDGWFRHSVEEIVLDVPVRLIPAEEMIWSKAFIMERERYDGADVAHILRACADTLDWPRLLQRFDTNWRVLLQHLVMFGFIYPCERARIPAAVMRELTGRLDRELTRPAADRVCQGTLISRAQYLVDVEHWGYSDPRLAPHGNITSEERERWTWSSPKIRRVLHAPDRRSLGQFPRSGALPNQGESVN

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
28 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
37 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
104 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
105 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
106 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
107 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
108 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
109 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
110 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
113 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
114 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
117 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
121 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
123 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
124 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
125 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
126 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
127 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
128 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
129 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
130 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
131 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
132 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
133 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
134 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
135 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
138 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
139 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
140 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
141 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
142 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
143 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
144 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
145 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
146 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
151 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
152 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
153 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.71
Metatranscriptomes 0.29
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.64
Nodule 0
Rhizoplane 0.59
Rhizosphere 96.77
Stem 0
Stem Tuber 0
Unclassified 6.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10705819 3300014326 Bacteria 1014
2 JGI25406J46586_10010136 3300003203 Bacteria 4192
3 Ga0058862_12669425 3300004803 Bacteria 1440
4 Ga0070658_10139700 3300005327 Bacteria 2023
5 Ga0070676_10071507 3300005328 Unclassified 2084
6 Ga0070670_100076618 3300005331 Unclassified 2873
7 Ga0070680_100028221 3300005336 Bacteria 4500
8 Ga0070689_100010557 3300005340 Bacteria 6583
9 Ga0070689_100086388 3300005340 Unclassified 2467
10 Ga0070687_100004640 3300005343 Bacteria 5491
11 Ga0070692_10137536 3300005345 Bacteria 1379
12 Ga0070668_100229646 3300005347 Unclassified 1533
13 Ga0070668_100303803 3300005347 Bacteria 1339
14 Ga0070668_100456648 3300005347 Bacteria 1099
15 Ga0070669_100082638 3300005353 Unclassified 2394
16 Ga0070675_100083957 3300005354 Unclassified 2659
17 Ga0070674_100017210 3300005356 Bacteria 4542
18 Ga0070688_100164427 3300005365 Unclassified 1527
19 Ga0070667_100076514 3300005367 Bacteria 2858
20 Ga0070701_10197536 3300005438 Bacteria 1187
21 Ga0070705_100017803 3300005440 Bacteria 3714
22 Ga0070694_100190988 3300005444 Bacteria 1521
23 Ga0070708_100003480 3300005445 Bacteria 12323
24 Ga0070708_100027850 3300005445 Unclassified 4854
25 Ga0070708_100166888 3300005445 Bacteria 2054
26 Ga0070663_100019304 3300005455 Bacteria 4490
27 Ga0068867_100016254 3300005459 Bacteria 5285
28 Ga0068867_100085716 3300005459 Bacteria 2382
29 Ga0070706_100012206 3300005467 Bacteria 7963
30 Ga0070706_100255738 3300005467 Bacteria 1635
31 Ga0070706_100464240 3300005467 Bacteria 1178
32 Ga0070706_100512275 3300005467 Bacteria 1116
33 Ga0070707_100103169 3300005468 Bacteria 2763
34 Ga0070698_100011605 3300005471 Bacteria 9348
35 Ga0070698_100016616 3300005471 Bacteria 7766
36 Ga0070699_100020026 3300005518 Bacteria 5764
37 Ga0070697_100059318 3300005536 Bacteria 3116
38 Ga0070697_100070132 3300005536 Bacteria 2872
39 Ga0070697_100212335 3300005536 Bacteria 1648
40 Ga0070672_100085109 3300005543 Unclassified 2540
41 Ga0070672_100317648 3300005543 Bacteria 1323
42 Ga0070686_100016680 3300005544 Unclassified 4276
43 Ga0070686_100028777 3300005544 Bacteria 3372
44 Ga0070695_100120969 3300005545 Bacteria 1791
45 Ga0070704_100048978 3300005549 Bacteria 2961
46 Ga0068857_100295291 3300005577 Bacteria 1493
47 Ga0070702_100008674 3300005615 Bacteria 4936
48 Ga0070702_100088925 3300005615 Unclassified 1868
49 Ga0068859_100011427 3300005617 Bacteria 8925
50 Ga0068859_100723812 3300005617 Bacteria 1085
51 Ga0068864_100280575 3300005618 Bacteria 1555
52 Ga0068861_100060163 3300005719 Bacteria 2910
53 Ga0068862_100290934 3300005844 Bacteria 1500
54 Ga0068862_100545529 3300005844 Bacteria 1106
55 Ga0081539_10000454 3300005985 Bacteria 87230
56 Ga0081539_10004323 3300005985 Bacteria 15853
57 Ga0075362_10042257 3300006177 Unclassified 2014
58 Ga0075367_10037419 3300006178 Bacteria 2820
59 Ga0075366_10000494 3300006195 Bacteria 18228
60 Ga0075370_10090694 3300006353 Bacteria 1763
61 Ga0068871_100035841 3300006358 Bacteria 3946
62 Ga0075428_100000958 3300006844 Bacteria 30591
63 Ga0075428_100001955 3300006844 Bacteria 22149
64 Ga0075428_100020581 3300006844 Bacteria 7305
65 Ga0075428_100026447 3300006844 Bacteria 6422
66 Ga0075428_100042115 3300006844 Bacteria 5023
67 Ga0075428_100072169 3300006844 Bacteria 3772
68 Ga0075428_100143254 3300006844 Bacteria 2598
69 Ga0075428_100203473 3300006844 Bacteria 2140
70 Ga0075428_100299316 3300006844 Bacteria 1729
71 Ga0075430_100000404 3300006846 Bacteria 31995
72 Ga0075430_100000993 3300006846 Bacteria 22410
73 Ga0075430_100001785 3300006846 Bacteria 17586
74 Ga0075430_100016695 3300006846 Bacteria 6254
75 Ga0075430_100095625 3300006846 Bacteria 2483
76 Ga0075430_100123629 3300006846 Bacteria 2157
77 Ga0075431_100000082 3300006847 Bacteria 56660
78 Ga0075431_100000934 3300006847 Bacteria 25824
79 Ga0075431_100001308 3300006847 Bacteria 22782
80 Ga0075431_100001849 3300006847 Bacteria 20046
81 Ga0075431_100002286 3300006847 Bacteria 18391
82 Ga0075431_100002433 3300006847 Bacteria 17914
83 Ga0075431_100012063 3300006847 Bacteria 8720
84 Ga0075431_100020867 3300006847 Bacteria 6695
85 Ga0075431_100076318 3300006847 Bacteria 3458
86 Ga0075431_100104374 3300006847 Bacteria 2925
87 Ga0075431_100316348 3300006847 Bacteria 1575
88 Ga0075431_100407340 3300006847 Bacteria 1360
89 Ga0075433_10051733 3300006852 Bacteria 3578
90 Ga0075433_10087177 3300006852 Bacteria 2757
91 Ga0075433_10128149 3300006852 Bacteria 2254
92 Ga0075433_10255368 3300006852 Bacteria 1555
93 Ga0075434_100021028 3300006871 Bacteria 6339
94 Ga0075434_100066624 3300006871 Bacteria 3587
95 Ga0075434_100086845 3300006871 Unclassified 3128
96 Ga0075434_100156237 3300006871 Bacteria 2300
97 Ga0075434_100176345 3300006871 Bacteria 2157
98 Ga0075429_100000023 3300006880 Bacteria 68064
99 Ga0075429_100007755 3300006880 Bacteria 9321
100 Ga0075429_100011837 3300006880 Bacteria 7565
101 Ga0075429_100054061 3300006880 Bacteria 3493
102 Ga0075429_100098278 3300006880 Bacteria 2554
103 Ga0075429_100122135 3300006880 Bacteria 2277
104 Ga0075429_100197152 3300006880 Bacteria 1764
105 Ga0075429_100364096 3300006880 Bacteria 1266
106 Ga0075429_100426765 3300006880 Bacteria 1161
107 Ga0068865_100060018 3300006881 Bacteria 2661
108 Ga0075436_100032820 3300006914 Bacteria 3578
109 Ga0075436_100036749 3300006914 Bacteria 3382
110 Ga0075436_100329450 3300006914 Bacteria 1098
111 Ga0097620_100011426 3300006931 Bacteria 8925
112 Ga0097620_100723781 3300006931 Bacteria 1085
113 Ga0075435_100004101 3300007076 Bacteria 9983
114 Ga0075435_100030020 3300007076 Bacteria 4271
115 Ga0075435_100049425 3300007076 Bacteria 3382
116 Ga0075435_100309531 3300007076 Unclassified 1351
117 Ga0105240_10000112 3300009093 Bacteria 169461
118 Ga0111539_10000603 3300009094 Bacteria 46477
119 Ga0111539_10002644 3300009094 Bacteria 23738
120 Ga0111539_10003359 3300009094 Bacteria 21129
121 Ga0111539_10014232 3300009094 Bacteria 9935
122 Ga0105245_10077995 3300009098 Bacteria 3022
123 Ga0105247_10283884 3300009101 Bacteria 1143
124 Ga0114129_10000441 3300009147 Bacteria 49260
125 Ga0114129_10001852 3300009147 Bacteria 28822
126 Ga0114129_10004164 3300009147 Bacteria 20433
127 Ga0114129_10020175 3300009147 Bacteria 9485
128 Ga0114129_10041387 3300009147 Bacteria 6493
129 Ga0114129_10055977 3300009147 Bacteria 5527
130 Ga0114129_10062740 3300009147 Bacteria 5190
131 Ga0114129_10065825 3300009147 Bacteria 5057
132 Ga0114129_10075390 3300009147 Bacteria 4697
133 Ga0114129_10081548 3300009147 Bacteria 4496
134 Ga0114129_10118423 3300009147 Bacteria 3648
135 Ga0114129_10151425 3300009147 Bacteria 3174
136 Ga0114129_10487055 3300009147 Bacteria 1613
137 Ga0105243_10173582 3300009148 Bacteria 1869
138 Ga0105242_10024232 3300009176 Bacteria 4791
139 Ga0105248_10009545 3300009177 Bacteria 10680
140 Ga0105249_10013078 3300009553 Bacteria 7329
141 Ga0105249_10026553 3300009553 Bacteria 5220
142 Ga0105249_10172048 3300009553 Unclassified 2101
143 Ga0105249_10175839 3300009553 Bacteria 2079
144 Ga0105239_10021416 3300010375 Bacteria 7127
145 Ga0105239_10903265 3300010375 Bacteria 1014
146 Ga0163162_10317410 3300013306 Bacteria 1691
147 Ga0157377_10008435 3300014745 Bacteria 5026
148 Ga0157379_10084876 3300014968 Bacteria 2837
149 Ga0207642_10032900 3300025899 Bacteria 2188
150 Ga0207645_10025946 3300025907 Bacteria 3790
151 Ga0207643_10069344 3300025908 Bacteria 2026
152 Ga0207684_10000279 3300025910 Bacteria 74399
153 Ga0207684_10136775 3300025910 Bacteria 2104
154 Ga0207684_10265938 3300025910 Bacteria 1480
155 Ga0207695_10000196 3300025913 Bacteria 171024
156 Ga0207660_10023808 3300025917 Bacteria 4139
157 Ga0207662_10001787 3300025918 Bacteria 10553
158 Ga0207646_10046882 3300025922 Bacteria 3877
159 Ga0207646_10063285 3300025922 Bacteria 3303
160 Ga0207646_10256880 3300025922 Bacteria 1579
161 Ga0207681_10310807 3300025923 Bacteria 1250
162 Ga0207687_10462576 3300025927 Bacteria 1054
163 Ga0207706_10023232 3300025933 Bacteria 5569
164 Ga0207706_10166385 3300025933 Unclassified 1938
165 Ga0207670_10162488 3300025936 Unclassified 1668
166 Ga0207669_10156341 3300025937 Bacteria 1604
167 Ga0207704_10321165 3300025938 Unclassified 1194
168 Ga0207691_10046618 3300025940 Bacteria 3981
169 Ga0207689_10011926 3300025942 Bacteria 7448
170 Ga0207668_10357535 3300025972 Bacteria 1223
171 Ga0207678_10014867 3300026067 Bacteria 6846
172 Ga0207708_10060956 3300026075 Bacteria 2880
173 Ga0207648_10001348 3300026089 Bacteria 27180
174 Ga0207648_10015429 3300026089 Bacteria 7028
175 Ga0207676_10189475 3300026095 Bacteria 1809
176 Ga0207675_100006965 3300026118 Bacteria 10696
177 Ga0207675_100312998 3300026118 Bacteria 1531
178 Ga0207683_10024272 3300026121 Bacteria 5220
179 Ga0209983_1024079 3300027665 Bacteria 1281
180 Ga0207428_10000174 3300027907 Bacteria 89762
181 Ga0207428_10001223 3300027907 Bacteria 27543
182 Ga0207428_10025667 3300027907 Bacteria 4929
183 Ga0207428_10156945 3300027907 Bacteria 1730
184 Ga0268265_10184194 3300028380 Bacteria 1797
185 Ga0268265_10269992 3300028380 Bacteria 1517
186 Ga0268264_10136122 3300028381 Bacteria 2184
187 Ga0307408_100015821 3300031548 Bacteria 5026
188 Ga0307408_100193839 3300031548 Bacteria 1639
189 Ga0307408_100638504 3300031548 Bacteria 950
190 Ga0307405_10363458 3300031731 Bacteria 1121
191 Ga0307410_10087387 3300031852 Bacteria 2205
192 Ga0307410_10241049 3300031852 Bacteria 1401
193 Ga0307410_10418512 3300031852 Bacteria 1086
194 Ga0307406_10233147 3300031901 Bacteria 1376
195 Ga0307412_10159476 3300031911 Bacteria 1674
196 Ga0307409_100591457 3300031995 Bacteria 1095
197 Ga0307409_100913053 3300031995 Bacteria 892
198 Ga0307416_100069524 3300032002 Bacteria 2914
199 Ga0307416_100078557 3300032002 Bacteria 2777
200 Ga0307416_100152509 3300032002 Bacteria 2122
201 Ga0307416_100213470 3300032002 Bacteria 1843
202 Ga0373932_0032166 3300035112 Bacteria 1466
203 Ga0373931_0002062 3300035691 Bacteria 8837
204 Ga0395899_0023903 3300037312 Bacteria 4624
205 Ga0395900_0020251 3300037418 Bacteria 6789
206 Ga0395900_0132203 3300037418 Bacteria 2557
207 Ga0395898_0048703 3300037466 Bacteria 4154
208 Ga0395905_0095646 3300037471 Bacteria 2788
209 Ga0395905_0650841 3300037471 Bacteria 956
210 Ga0395901_0016328 3300038443 Bacteria 7562
211 Ga0451576_0285145 3300045051 Bacteria 1727
212 Ga0495669_0029795 3300046684 Bacteria 2394
213 Ga0495669_0128688 3300046684 Bacteria 1191
214 Ga0495669_0131892 3300046684 Bacteria 1176
215 Ga0495677_0064348 3300047445 Bacteria 1363
216 Ga0496102_0096815 3300048905 Bacteria 2736
217 Ga0496108_0267397 3300048911 Bacteria 1488
218 Ga0501031_0020113 3300049568 Bacteria 4351
219 Ga0501033_0359807 3300049570 Bacteria 1018
220 Ga0501034_0311017 3300049571 Bacteria 1510
221 Ga0501036_0089404 3300049572 Bacteria 2602
222 Ga0501036_0251741 3300049572 Bacteria 1480
223 Ga0501036_0434473 3300049572 Bacteria 1094
224 Ga0501038_0046754 3300049574 Bacteria 3752
225 Ga0501039_0083078 3300049575 Bacteria 2494
226 Ga0501039_0089412 3300049575 Bacteria 2400
227 Ga0501040_0017368 3300049576 Bacteria 4774
228 Ga0501040_0020482 3300049576 Bacteria 4408
229 Ga0501040_0098500 3300049576 Bacteria 2038
230 Ga0501040_0161315 3300049576 Bacteria 1585
231 Ga0501041_0054020 3300049577 Bacteria 2450
232 Ga0501041_0365611 3300049577 Bacteria 912
233 Ga0501046_0007135 3300049580 Bacteria 9829
234 Ga0501048_0092901 3300049582 Bacteria 2128
235 Ga0501048_0182006 3300049582 Bacteria 1490
236 Ga0501068_0058101 3300049584 Bacteria 2347
237 Ga0501070_0139000 3300049586 Bacteria 2006
238 Ga0501071_0069112 3300049587 Bacteria 2571
239 Ga0501071_0190129 3300049587 Bacteria 1540
240 Ga0501072_0015209 3300049588 Bacteria 5900
241 Ga0501072_0029720 3300049588 Bacteria 4270
242 Ga0501072_0043865 3300049588 Bacteria 3516
243 Ga0501073_0038244 3300049589 Bacteria 3405
244 Ga0501074_0204077 3300049590 Bacteria 1408
245 Ga0501075_0004088 3300049591 Bacteria 9853
246 Ga0501075_0024279 3300049591 Bacteria 4443
247 Ga0501075_0068864 3300049591 Bacteria 2674
248 Ga0501075_0319627 3300049591 Bacteria 1183
249 Ga0501076_0003244 3300049592 Bacteria 11380
250 Ga0501076_0023919 3300049592 Bacteria 4714
251 Ga0501076_0098517 3300049592 Bacteria 2355
252 Ga0501077_0009393 3300049593 Bacteria 6076
253 Ga0501077_0044210 3300049593 Bacteria 2830
254 Ga0501077_0089389 3300049593 Bacteria 1952
255 Ga0501225_0088341 3300049705 Bacteria 896
256 Ga0501079_0002633 3300049741 Bacteria 13063
257 Ga0501079_0008761 3300049741 Bacteria 7667
258 Ga0501079_0100815 3300049741 Bacteria 2239
259 Ga0501079_0117227 3300049741 Bacteria 2070
260 Ga0501079_0312824 3300049741 Bacteria 1229
261 Ga0501080_0338345 3300049742 Bacteria 1360
262 Ga0501080_0463495 3300049742 Bacteria 1135
263 Ga0501081_0004120 3300049743 Bacteria 9314
264 Ga0501081_0006423 3300049743 Bacteria 7628
265 Ga0501081_0032518 3300049743 Bacteria 3539
266 Ga0501081_0071340 3300049743 Bacteria 2421
267 Ga0501081_0375212 3300049743 Bacteria 1050
268 Ga0501045_0036525 3300049824 Bacteria 3567
269 Ga0501045_0334160 3300049824 Bacteria 1127
270 nmdc:mga03n38_246979_c1 3300050490 Unclassified 941
271 nmdc:mga00v17_10425_c1 3300050491 Bacteria 5074
272 nmdc:mga0k408_526_c1 3300050493 Bacteria 21072
273 nmdc:mga06z11_5727_c1 3300050494 Bacteria 5005
274 nmdc:mga07m45_54164_c1 3300050496 Bacteria 2267
275 nmdc:mga05p37_106014_c1 3300050507 Bacteria 3457
276 nmdc:mga05p37_119152_c1 3300050507 Bacteria 3243
277 nmdc:mga05p37_12755_c1 3300050507 Bacteria 10045
278 nmdc:mga05p37_152449_c1 3300050507 Bacteria 2826
279 nmdc:mga05p37_20607_c1 3300050507 Bacteria 7978
280 nmdc:mga05p37_23863_c1 3300050507 Bacteria 7428
281 nmdc:mga05p37_24241_c1 3300050507 Bacteria 7372
282 nmdc:mga05p37_2509_c1 3300050507 Bacteria 21339
283 nmdc:mga05p37_272706_c1 3300050507 Bacteria 2021
284 nmdc:mga05p37_3290_c1 3300050507 Bacteria 18843
285 nmdc:mga05p37_41612_c1 3300050507 Bacteria 5642
286 nmdc:mga05p37_432794_c1 3300050507 Bacteria 1528
287 nmdc:mga05p37_5040_c1 3300050507 Bacteria 15477
288 nmdc:mga05p37_74871_c1 3300050507 Bacteria 4167
289 nmdc:mga09592_114551_c1 3300050508 Bacteria 2314
290 nmdc:mga09592_144906_c1 3300050508 Bacteria 2048
291 nmdc:mga09592_25306_c1 3300050508 Bacteria 4912
292 nmdc:mga09592_323478_c1 3300050508 Bacteria 1336
293 nmdc:mga09592_371074_c1 3300050508 Bacteria 1238
294 nmdc:mga09592_55784_c1 3300050508 Bacteria 3339
295 nmdc:mga09592_56942_c1 3300050508 Bacteria 3303
296 nmdc:mga09592_61420_c1 3300050508 Bacteria 3178
297 nmdc:mga09592_721_c1 3300050508 Bacteria 25415
298 nmdc:mga09592_86776_c1 3300050508 Bacteria 2671
299 nmdc:mga0qj67_2832_c1 3300050509 Bacteria 12432
300 nmdc:mga0qj67_5818_c1 3300050509 Bacteria 9024
301 nmdc:mga0qj67_6578_c1 3300050509 Bacteria 8537
302 nmdc:mga0qj67_7655_c1 3300050509 Bacteria 7982
303 nmdc:mga06r32_1319_c1 3300050510 Bacteria 22367
304 nmdc:mga06r32_14329_c1 3300050510 Bacteria 7193
305 nmdc:mga06r32_21578_c1 3300050510 Bacteria 5946
306 nmdc:mga06r32_2498_c1 3300050510 Bacteria 16455
307 nmdc:mga06r32_30212_c1 3300050510 Bacteria 5084
308 nmdc:mga06r32_330725_c1 3300050510 Bacteria 1509
309 nmdc:mga06r32_42299_c1 3300050510 Bacteria 4332
310 nmdc:mga06r32_501742_c1 3300050510 Bacteria 1190
311 nmdc:mga06r32_56087_c1 3300050510 Bacteria 3781
312 nmdc:mga06r32_89651_c1 3300050510 Bacteria 3003
313 nmdc:mga08y16_17083_c1 3300050511 Bacteria 7640
314 nmdc:mga08y16_23251_c1 3300050511 Bacteria 6544
315 nmdc:mga08y16_74_c1 3300050511 Bacteria 83677
316 nmdc:mga0n895_145789_c1 3300050512 Bacteria 2397
317 nmdc:mga0n895_35795_c1 3300050512 Bacteria 4790
318 nmdc:mga0n895_48643_c1 3300050512 Unclassified 4151
319 nmdc:mga0n895_7989_c1 3300050512 Bacteria 9124
320 nmdc:mga0rr50_10680_c1 3300050513 Bacteria 5844
321 nmdc:mga0rr50_659278_c1 3300050513 Bacteria 893
322 nmdc:mga0rr50_7359_c1 3300050513 Bacteria 6784
323 nmdc:mga08x19_110653_c1 3300050514 Bacteria 1832
324 nmdc:mga08x19_1992_c1 3300050514 Bacteria 12500
325 nmdc:mga08x19_70159_c1 3300050514 Bacteria 2283
326 nmdc:mga0a205_122157_c1 3300050515 Bacteria 2504
327 nmdc:mga0a205_2294_c1 3300050515 Bacteria 16885
328 nmdc:mga0a205_309812_c1 3300050515 Unclassified 1451
329 nmdc:mga0a205_99868_c1 3300050515 Bacteria 2801
330 Ga0501084_0017837 3300054114 Bacteria 5908
331 Ga0501084_0029126 3300054114 Bacteria 4618
332 Ga0501084_0154883 3300054114 Bacteria 1932
333 Ga0501084_0163734 3300054114 Bacteria 1877
334 Ga0501082_0009524 3300060353 Bacteria 8358
335 Ga0501082_0028128 3300060353 Bacteria 4844
336 Ga0501082_0137762 3300060353 Bacteria 2118
337 Ga0501082_0199420 3300060353 Bacteria 1741
338 Ga0530510_0005484 3300061734 Bacteria 8784
339 Ga0530510_0083781 3300061734 Bacteria 2322
340 Ga0530510_0194247 3300061734 Bacteria 1507
341 Ga0530510_0229144 3300061734 Bacteria 1382
342 Ga0157380_10705819
343 JGI25406J46586_10010136
344 Ga0058862_12669425
345 Ga0070658_10139700
346 Ga0070676_10071507
347 Ga0070670_100076618
348 Ga0070680_100028221
349 Ga0070689_100010557
350 Ga0070689_100086388
351 Ga0070687_100004640
352 Ga0070692_10137536
353 Ga0070668_100229646
354 Ga0070668_100303803
355 Ga0070668_100456648
356 Ga0070669_100082638
357 Ga0070675_100083957
358 Ga0070674_100017210
359 Ga0070688_100164427
360 Ga0070667_100076514
361 Ga0070701_10197536
362 Ga0070705_100017803
363 Ga0070694_100190988
364 Ga0070708_100003480
365 Ga0070708_100027850
366 Ga0070708_100166888
367 Ga0070663_100019304
368 Ga0068867_100016254
369 Ga0068867_100085716
370 Ga0070706_100012206
371 Ga0070706_100255738
372 Ga0070706_100464240
373 Ga0070706_100512275
374 Ga0070707_100103169
375 Ga0070698_100011605
376 Ga0070698_100016616
377 Ga0070699_100020026
378 Ga0070697_100059318
379 Ga0070697_100070132
380 Ga0070697_100212335
381 Ga0070672_100085109
382 Ga0070672_100317648
383 Ga0070686_100016680
384 Ga0070686_100028777
385 Ga0070695_100120969
386 Ga0070704_100048978
387 Ga0068857_100295291
388 Ga0070702_100008674
389 Ga0070702_100088925
390 Ga0068859_100011427
391 Ga0068859_100723812
392 Ga0068864_100280575
393 Ga0068861_100060163
394 Ga0068862_100290934
395 Ga0068862_100545529
396 Ga0081539_10000454
397 Ga0081539_10004323
398 Ga0075362_10042257
399 Ga0075367_10037419
400 Ga0075366_10000494
401 Ga0075370_10090694
402 Ga0068871_100035841
403 Ga0075428_100000958
404 Ga0075428_100001955
405 Ga0075428_100020581
406 Ga0075428_100026447
407 Ga0075428_100042115
408 Ga0075428_100072169
409 Ga0075428_100143254
410 Ga0075428_100203473
411 Ga0075428_100299316
412 Ga0075430_100000404
413 Ga0075430_100000993
414 Ga0075430_100001785
415 Ga0075430_100016695
416 Ga0075430_100095625
417 Ga0075430_100123629
418 Ga0075431_100000082
419 Ga0075431_100000934
420 Ga0075431_100001308
421 Ga0075431_100001849
422 Ga0075431_100002286
423 Ga0075431_100002433
424 Ga0075431_100012063
425 Ga0075431_100020867
426 Ga0075431_100076318
427 Ga0075431_100104374
428 Ga0075431_100316348
429 Ga0075431_100407340
430 Ga0075433_10051733
431 Ga0075433_10087177
432 Ga0075433_10128149
433 Ga0075433_10255368
434 Ga0075434_100021028
435 Ga0075434_100066624
436 Ga0075434_100086845
437 Ga0075434_100156237
438 Ga0075434_100176345
439 Ga0075429_100000023
440 Ga0075429_100007755
441 Ga0075429_100011837
442 Ga0075429_100054061
443 Ga0075429_100098278
444 Ga0075429_100122135
445 Ga0075429_100197152
446 Ga0075429_100364096
447 Ga0075429_100426765
448 Ga0068865_100060018
449 Ga0075436_100032820
450 Ga0075436_100036749
451 Ga0075436_100329450
452 Ga0097620_100011426
453 Ga0097620_100723781
454 Ga0075435_100004101
455 Ga0075435_100030020
456 Ga0075435_100049425
457 Ga0075435_100309531
458 Ga0105240_10000112
459 Ga0111539_10000603
460 Ga0111539_10002644
461 Ga0111539_10003359
462 Ga0111539_10014232
463 Ga0105245_10077995
464 Ga0105247_10283884
465 Ga0114129_10000441
466 Ga0114129_10001852
467 Ga0114129_10004164
468 Ga0114129_10020175
469 Ga0114129_10041387
470 Ga0114129_10055977
471 Ga0114129_10062740
472 Ga0114129_10065825
473 Ga0114129_10075390
474 Ga0114129_10081548
475 Ga0114129_10118423
476 Ga0114129_10151425
477 Ga0114129_10487055
478 Ga0105243_10173582
479 Ga0105242_10024232
480 Ga0105248_10009545
481 Ga0105249_10013078
482 Ga0105249_10026553
483 Ga0105249_10172048
484 Ga0105249_10175839
485 Ga0105239_10021416
486 Ga0105239_10903265
487 Ga0163162_10317410
488 Ga0157377_10008435
489 Ga0157379_10084876
490 Ga0207642_10032900
491 Ga0207645_10025946
492 Ga0207643_10069344
493 Ga0207684_10000279
494 Ga0207684_10136775
495 Ga0207684_10265938
496 Ga0207695_10000196
497 Ga0207660_10023808
498 Ga0207662_10001787
499 Ga0207646_10046882
500 Ga0207646_10063285
501 Ga0207646_10256880
502 Ga0207681_10310807
503 Ga0207687_10462576
504 Ga0207706_10023232
505 Ga0207706_10166385
506 Ga0207670_10162488
507 Ga0207669_10156341
508 Ga0207704_10321165
509 Ga0207691_10046618
510 Ga0207689_10011926
511 Ga0207668_10357535
512 Ga0207678_10014867
513 Ga0207708_10060956
514 Ga0207648_10001348
515 Ga0207648_10015429
516 Ga0207676_10189475
517 Ga0207675_100006965
518 Ga0207675_100312998
519 Ga0207683_10024272
520 Ga0209983_1024079
521 Ga0207428_10000174
522 Ga0207428_10001223
523 Ga0207428_10025667
524 Ga0207428_10156945
525 Ga0268265_10184194
526 Ga0268265_10269992
527 Ga0268264_10136122
528 Ga0307408_100015821
529 Ga0307408_100193839
530 Ga0307408_100638504
531 Ga0307405_10363458
532 Ga0307410_10087387
533 Ga0307410_10241049
534 Ga0307410_10418512
535 Ga0307406_10233147
536 Ga0307412_10159476
537 Ga0307409_100591457
538 Ga0307409_100913053
539 Ga0307416_100069524
540 Ga0307416_100078557
541 Ga0307416_100152509
542 Ga0307416_100213470
543 Ga0373932_0032166
544 Ga0373931_0002062
545 Ga0395899_0023903
546 Ga0395900_0020251
547 Ga0395900_0132203
548 Ga0395898_0048703
549 Ga0395905_0095646
550 Ga0395905_0650841
551 Ga0395901_0016328
552 Ga0451576_0285145
553 Ga0495669_0029795
554 Ga0495669_0128688
555 Ga0495669_0131892
556 Ga0495677_0064348
557 Ga0496102_0096815
558 Ga0496108_0267397
559 Ga0501031_0020113
560 Ga0501033_0359807
561 Ga0501034_0311017
562 Ga0501036_0089404
563 Ga0501036_0251741
564 Ga0501036_0434473
565 Ga0501038_0046754
566 Ga0501039_0083078
567 Ga0501039_0089412
568 Ga0501040_0017368
569 Ga0501040_0020482
570 Ga0501040_0098500
571 Ga0501040_0161315
572 Ga0501041_0054020
573 Ga0501041_0365611
574 Ga0501046_0007135
575 Ga0501048_0092901
576 Ga0501048_0182006
577 Ga0501068_0058101
578 Ga0501070_0139000
579 Ga0501071_0069112
580 Ga0501071_0190129
581 Ga0501072_0015209
582 Ga0501072_0029720
583 Ga0501072_0043865
584 Ga0501073_0038244
585 Ga0501074_0204077
586 Ga0501075_0004088
587 Ga0501075_0024279
588 Ga0501075_0068864
589 Ga0501075_0319627
590 Ga0501076_0003244
591 Ga0501076_0023919
592 Ga0501076_0098517
593 Ga0501077_0009393
594 Ga0501077_0044210
595 Ga0501077_0089389
596 Ga0501225_0088341
597 Ga0501079_0002633
598 Ga0501079_0008761
599 Ga0501079_0100815
600 Ga0501079_0117227
601 Ga0501079_0312824
602 Ga0501080_0338345
603 Ga0501080_0463495
604 Ga0501081_0004120
605 Ga0501081_0006423
606 Ga0501081_0032518
607 Ga0501081_0071340
608 Ga0501081_0375212
609 Ga0501045_0036525
610 Ga0501045_0334160
611 nmdc:mga03n38_246979_c1
612 nmdc:mga00v17_10425_c1
613 nmdc:mga0k408_526_c1
614 nmdc:mga06z11_5727_c1
615 nmdc:mga07m45_54164_c1
616 nmdc:mga05p37_106014_c1
617 nmdc:mga05p37_119152_c1
618 nmdc:mga05p37_12755_c1
619 nmdc:mga05p37_152449_c1
620 nmdc:mga05p37_20607_c1
621 nmdc:mga05p37_23863_c1
622 nmdc:mga05p37_24241_c1
623 nmdc:mga05p37_2509_c1
624 nmdc:mga05p37_272706_c1
625 nmdc:mga05p37_3290_c1
626 nmdc:mga05p37_41612_c1
627 nmdc:mga05p37_432794_c1
628 nmdc:mga05p37_5040_c1
629 nmdc:mga05p37_74871_c1
630 nmdc:mga09592_114551_c1
631 nmdc:mga09592_144906_c1
632 nmdc:mga09592_25306_c1
633 nmdc:mga09592_323478_c1
634 nmdc:mga09592_371074_c1
635 nmdc:mga09592_55784_c1
636 nmdc:mga09592_56942_c1
637 nmdc:mga09592_61420_c1
638 nmdc:mga09592_721_c1
639 nmdc:mga09592_86776_c1
640 nmdc:mga0qj67_2832_c1
641 nmdc:mga0qj67_5818_c1
642 nmdc:mga0qj67_6578_c1
643 nmdc:mga0qj67_7655_c1
644 nmdc:mga06r32_1319_c1
645 nmdc:mga06r32_14329_c1
646 nmdc:mga06r32_21578_c1
647 nmdc:mga06r32_2498_c1
648 nmdc:mga06r32_30212_c1
649 nmdc:mga06r32_330725_c1
650 nmdc:mga06r32_42299_c1
651 nmdc:mga06r32_501742_c1
652 nmdc:mga06r32_56087_c1
653 nmdc:mga06r32_89651_c1
654 nmdc:mga08y16_17083_c1
655 nmdc:mga08y16_23251_c1
656 nmdc:mga08y16_74_c1
657 nmdc:mga0n895_145789_c1
658 nmdc:mga0n895_35795_c1
659 nmdc:mga0n895_48643_c1
660 nmdc:mga0n895_7989_c1
661 nmdc:mga0rr50_10680_c1
662 nmdc:mga0rr50_659278_c1
663 nmdc:mga0rr50_7359_c1
664 nmdc:mga08x19_110653_c1
665 nmdc:mga08x19_1992_c1
666 nmdc:mga08x19_70159_c1
667 nmdc:mga0a205_122157_c1
668 nmdc:mga0a205_2294_c1
669 nmdc:mga0a205_309812_c1
670 nmdc:mga0a205_99868_c1
671 Ga0501084_0017837
672 Ga0501084_0029126
673 Ga0501084_0154883
674 Ga0501084_0163734
675 Ga0501082_0009524
676 Ga0501082_0028128
677 Ga0501082_0137762
678 Ga0501082_0199420
679 Ga0530510_0005484
680 Ga0530510_0083781
681 Ga0530510_0194247
682 Ga0530510_0229144

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.7562 47 91
1r9c-assembly1.cif.gz_A crystal structure of fosfomycin resistance protein fosx from mesorhizobium loti 0.741 49 91
2p7p-assembly2.cif.gz_D crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes complexed with mn(ii) and sulfate ion 0.7314 49 91
2p7m-assembly4.cif.gz_B crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7303 49 91
2p7m-assembly4.cif.gz_D-2 crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes at ph 6.5 0.7182 47 91
ID Description Score Start End Superfamily
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7607 49 91 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7563 47 91 3.10.180.10
3vb0B01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7442 47 91 3.10.180.10
2ewrA00 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.7201 5 128 3.30.460.40
af_A4IAC0_1_224_3.30.460.40 Alpha Beta;2-Layer Sandwich;Beta Polymerase; domain 2; 0.6382 16 132 3.30.460.40
ID Description Score Start End GO Terms
AF-A0A517SDL2-F1-model_v4 Uncharacterized protein 0.9776 7 255
AF-A0A2N5K9V3-F1-model_v4 Nucleotidyltransferase family protein 0.9764 3 262
AF-K9WEY8-F1-model_v4 Nucleotidyltransferase family protein 0.9749 3 261
AF-A0A1G1GCV8-F1-model_v4 Nucleotidyltransferase family protein 0.9745 3 239
AF-A0A2V8GYY9-F1-model_v4 Nucleotidyltransferase family protein 0.9738 20 262

Map