F414552

General Info

Members Datasets Scaffolds Average Seq Length
340 242 680 307

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2808606448|2809234451
Length 346
Sequence GASPLPAIPPPATVRTSDGPSTPGTPGTPGSPGTPDSRSPLARAEHFVWLTARVLEQRLFAHHFRGGDPDPVETALEAYRNEDGGYGHALEPDLRGPVSQPLHTACALRVLDAVGRCGGQRAERVCRYLTSVSTPDGALPVTRASRSGYPAAPYVPVVADPPGELLVTGPVVGLLHRNEVWHAWLFRATDFCWQAAESLVSPHPHEVEAAVAFLDAAPDRPRAQAAADRLGRLVREQGLAVLDPDGPDAGPVPPGQAPGGHPFPHDCGRDPLFPHDYARDPRSLARAWFTDDEMARSLDLLAAGQEEDGGWPVRRHRWAPVPALETRGRVTLDALCTLRAYGRPLG

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
6 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
7 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
8 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
9 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
10 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
11 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
12 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
13 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
14 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
15 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
16 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
17 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
18 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
19 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
20 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
21 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
22 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
23 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
24 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
25 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
26 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
27 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
28 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
29 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
30 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
31 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
32 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
33 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
34 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
35 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
36 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
37 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
38 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
39 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
40 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
41 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
42 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
43 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
44 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
45 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
46 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
47 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
48 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
49 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
50 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
51 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
52 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
53 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
54 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
58 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
59 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
60 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
61 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
62 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
63 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
64 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
65 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
66 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
67 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
68 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
69 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
70 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
71 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
72 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
73 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
74 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
75 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
76 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
77 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
78 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
79 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
80 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
83 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
86 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
87 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
88 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
89 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
90 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
91 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
92 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
93 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
94 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
95 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
96 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
97 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
98 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
99 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
100 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
101 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
102 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
103 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
104 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
105 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
106 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
107 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
108 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
109 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
110 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
111 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
112 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
113 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
114 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
115 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
116 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
117 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
126 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
129 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
130 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
131 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
132 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
140 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
142 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
143 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
144 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
145 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
146 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
147 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
148 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
149 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
150 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
151 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
152 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
153 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
154 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
155 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
156 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
157 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
158 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
159 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
160 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
161 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
162 2808606448 Streptomyces sp. 193411 Isolate Unclassified
163 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
164 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
165 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
166 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
167 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
168 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
169 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
170 2643221548 Streptomyces sp. Root55 Isolate Unclassified
171 2643221578 Streptomyces sp. Root63 Isolate Unclassified
172 2643221647 Streptomyces sp. Root369 Isolate Unclassified
173 2643221670 Streptomyces sp. Root431 Isolate Unclassified
174 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
175 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
176 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
177 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
178 2643221714 Streptomyces sp. Root264 Isolate Unclassified
179 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
180 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
181 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
182 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
183 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
184 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
185 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
186 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
187 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
188 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
189 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
190 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
191 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
192 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
193 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
194 2862574272 Streptomyces sp. AcE210 Isolate Nodule
195 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
196 2866552031 Saccharopolyspora rhizosphaerae H219 Isolate Unclassified
197 2867428634 Streptomyces sp. RP5T Isolate Unclassified
198 2867475112 Streptomyces sp. TM32 Isolate Unclassified
199 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
200 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
201 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
202 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
203 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
204 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
205 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
206 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
207 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
208 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
209 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
210 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
211 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
212 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
213 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
214 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
215 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
216 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
217 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
218 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
219 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
220 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
221 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
222 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
223 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
224 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
225 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
226 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
227 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
228 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
229 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
230 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
231 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
232 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
233 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
234 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
235 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
236 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
237 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
238 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
239 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
240 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
241 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
242 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.18
Metatranscriptomes 0
Isolates 23.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.35
Nodule 0.88
Rhizoplane 0.59
Rhizosphere 73.53
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10036640 3300003215 Bacteria 1569
2 rootH1_10154913 3300003323 Bacteria 3568
3 JGI25160J50197_1024249 3300003354 Bacteria 1725
4 Ga0081455_10048126 3300005937 Bacteria 3686
5 Ga0075365_10116433 3300006038 Bacteria 1840
6 Ga0070715_10034182 3300006163 Bacteria 2082
7 Ga0105251_10124187 3300009011 Bacteria 1172
8 Ga0105243_10026371 3300009148 Bacteria 4447
9 Ga0105246_10023218 3300011119 Bacteria 4011
10 Ga0157372_10234843 3300013307 Bacteria 2127
11 Ga0182008_10000799 3300014497 Bacteria 22034
12 Ga0182006_1019286 3300015261 Bacteria 2871
13 Ga0182007_10000101 3300015262 Bacteria 60723
14 Ga0182005_1018833 3300015265 Bacteria 1907
15 Ga0183367_1019 3300015688 Bacteria 100516
16 Ga0209758_1012962 3300025297 Bacteria 4601
17 Ga0207426_1001178 3300025302 Bacteria 23387
18 Ga0207426_1011754 3300025302 Bacteria 3315
19 Ga0207426_1014844 3300025302 Bacteria 2845
20 Ga0207426_1019057 3300025302 Bacteria 2406
21 Ga0207647_10009431 3300025904 Bacteria 6934
22 Ga0307517_10007357 3300028786 Bacteria 16069
23 Ga0307515_10001401 3300028794 Bacteria 54557
24 Ga0307515_10049027 3300028794 Bacteria 6370
25 Ga0307515_10106213 3300028794 Bacteria 3333
26 Ga0307511_10000234 3300030521 Bacteria 56601
27 Ga0307511_10094979 3300030521 Bacteria 1995
28 Ga0307512_10022360 3300030522 Bacteria 5685
29 Ga0307512_10078458 3300030522 Bacteria 2393
30 Ga0307513_10001846 3300031456 Bacteria 30093
31 Ga0307513_10088323 3300031456 Bacteria 3168
32 Ga0307509_10038113 3300031507 Bacteria 5247
33 Ga0307508_10007702 3300031616 Bacteria 10011
34 Ga0307508_10014505 3300031616 Bacteria 7188
35 Ga0307508_10016982 3300031616 Bacteria 6621
36 Ga0307508_10020377 3300031616 Bacteria 6022
37 Ga0307508_10333826 3300031616 Bacteria 1107
38 Ga0307514_10023150 3300031649 Bacteria 5043
39 Ga0307514_10087422 3300031649 Bacteria 2284
40 Ga0307514_10095185 3300031649 Bacteria 2155
41 Ga0307516_10012425 3300031730 Bacteria 9177
42 Ga0307516_10018458 3300031730 Bacteria 7249
43 Ga0307516_10057780 3300031730 Bacteria 3778
44 Ga0307516_10062717 3300031730 Bacteria 3601
45 Ga0307518_10242992 3300031838 Bacteria 1152
46 Ga0307507_10006947 3300033179 Bacteria 16843
47 Ga0307507_10090860 3300033179 Bacteria 2618
48 Ga0307510_10086965 3300033180 Bacteria 2995
49 Ga0395900_0236463 3300037418 Bacteria 1835
50 Ga0395900_0237417 3300037418 Bacteria 1830
51 Ga0395898_0009932 3300037466 Bacteria 9969
52 Ga0439436_0002334 3300041404 Bacteria 5685
53 Ga0439436_0004182 3300041404 Bacteria 4421
54 Ga0439439_0012748 3300041406 Bacteria 2034
55 Ga0451800_1367007 3300041459 Bacteria 1966
56 Ga0451853_0097410 3300041512 Bacteria 3564
57 Ga0451853_2802168 3300041512 Bacteria 2069
58 Ga0439433_0001744 3300041999 Bacteria 4516
59 Ga0439433_0002511 3300041999 Bacteria 3895
60 Ga0439448_0016748 3300042005 Bacteria 2233
61 Ga0439449_0004503 3300042007 Bacteria 5382
62 Ga0439455_0042856 3300042012 Bacteria 1163
63 Ga0439457_000719 3300042014 Bacteria 9817
64 Ga0439457_001035 3300042014 Bacteria 8392
65 Ga0439457_018534 3300042014 Bacteria 1547
66 Ga0439462_0022305 3300042015 Bacteria 1656
67 Ga0450894_002239 3300042131 Bacteria 2622
68 Ga0450898_001714 3300042134 Bacteria 2946
69 Ga0450903_002243 3300042138 Bacteria 3449
70 Ga0450906_005089 3300042145 Bacteria 2724
71 Ga0439458_0001276 3300042157 Bacteria 6353
72 Ga0439458_0010646 3300042157 Bacteria 2052
73 Ga0466969_0148345 3300044656 Bacteria 1081
74 Ga0466972_0010910 3300044658 Bacteria 4559
75 Ga0466972_0018327 3300044658 Bacteria 3498
76 Ga0466972_0031645 3300044658 Bacteria 2601
77 Ga0466965_0000651 3300044683 Bacteria 12718
78 Ga0466965_0020235 3300044683 Bacteria 3197
79 Ga0466965_0090424 3300044683 Bacteria 1557
80 Ga0466966_0001585 3300044684 Bacteria 14619
81 Ga0466966_0005464 3300044684 Bacteria 8355
82 Ga0466961_0001910 3300044693 Bacteria 12987
83 Ga0466961_0028569 3300044693 Bacteria 3586
84 Ga0466961_0047426 3300044693 Bacteria 2747
85 Ga0466963_0000490 3300044694 Bacteria 18414
86 Ga0466971_0000946 3300044719 Bacteria 11903
87 Ga0466970_0000076 3300044765 Bacteria 40216
88 Ga0466970_0000200 3300044765 Bacteria 29103
89 Ga0466970_0166957 3300044765 Bacteria 1219
90 Ga0466957_0000184 3300044842 Bacteria 28327
91 Ga0466960_0004335 3300044901 Bacteria 5535
92 Ga0466959_0001263 3300045049 Bacteria 15278
93 Ga0466959_0115936 3300045049 Bacteria 1908
94 Ga0466958_0148862 3300045836 Bacteria 1476
95 Ga0466967_0001562 3300045976 Bacteria 13431
96 Ga0466967_0035624 3300045976 Bacteria 4239
97 Ga0495617_010473 3300046452 Bacteria 3175
98 Ga0495627_034567 3300046453 Bacteria 1579
99 Ga0495592_0009832 3300046454 Bacteria 7199
100 Ga0495603_0001951 3300046455 Bacteria 12168
101 Ga0495603_0002087 3300046455 Bacteria 11746
102 Ga0495603_0017056 3300046455 Bacteria 4395
103 Ga0495603_0028326 3300046455 Bacteria 3378
104 Ga0495603_0041567 3300046455 Bacteria 2748
105 Ga0495629_0001954 3300046459 Bacteria 16060
106 Ga0495629_0002613 3300046459 Bacteria 13806
107 Ga0495629_0002785 3300046459 Bacteria 13347
108 Ga0495629_0003765 3300046459 Bacteria 11426
109 Ga0495629_0016779 3300046459 Bacteria 5255
110 Ga0495629_0031836 3300046459 Bacteria 3734
111 Ga0495629_0107178 3300046459 Bacteria 1949
112 Ga0495629_0155826 3300046459 Bacteria 1587
113 Ga0495629_0272505 3300046459 Bacteria 1162
114 Ga0495638_0025172 3300046460 Bacteria 3872
115 Ga0495638_0157974 3300046460 Bacteria 1310
116 Ga0495651_0000688 3300046462 Bacteria 26306
117 Ga0495653_0040887 3300046463 Bacteria 3622
118 Ga0495582_0089332 3300046473 Bacteria 1717
119 Ga0495582_0152414 3300046473 Bacteria 1313
120 Ga0495605_0009572 3300046474 Bacteria 5441
121 Ga0495639_0087597 3300046475 Bacteria 1457
122 Ga0495639_0101991 3300046475 Bacteria 1356
123 Ga0495662_0000491 3300046476 Bacteria 18031
124 Ga0495662_0007738 3300046476 Bacteria 5292
125 Ga0495664_0001121 3300046477 Bacteria 13882
126 Ga0495585_0063116 3300046492 Bacteria 2034
127 Ga0495594_0000407 3300046499 Bacteria 21745
128 Ga0495594_0014628 3300046499 Bacteria 4114
129 Ga0495594_0028684 3300046499 Bacteria 3004
130 Ga0495594_0043046 3300046499 Bacteria 2474
131 Ga0495594_0100925 3300046499 Bacteria 1623
132 Ga0495607_0009680 3300046501 Bacteria 6508
133 Ga0495607_0044823 3300046501 Bacteria 2605
134 Ga0495583_0033592 3300046506 Bacteria 2466
135 Ga0495608_0040089 3300046511 Bacteria 3138
136 Ga0495616_0012227 3300046513 Bacteria 4882
137 Ga0495618_0022755 3300046514 Bacteria 3871
138 Ga0495620_0004374 3300046515 Bacteria 7971
139 Ga0495628_0016290 3300046516 Bacteria 6202
140 Ga0495628_0056968 3300046516 Bacteria 3074
141 Ga0495630_0005530 3300046517 Bacteria 8919
142 Ga0495632_0097453 3300046519 Bacteria 1388
143 Ga0495643_0003800 3300046522 Bacteria 10910
144 Ga0495643_0007655 3300046522 Bacteria 6928
145 Ga0495648_0117861 3300046524 Bacteria 1432
146 Ga0495648_0118620 3300046524 Bacteria 1426
147 Ga0495666_0007794 3300046526 Bacteria 5361
148 Ga0495652_0015609 3300046529 Bacteria 6798
149 Ga0495654_0015867 3300046530 Bacteria 3993
150 Ga0495640_0102982 3300046533 Bacteria 1872
151 Ga0495586_0025162 3300046535 Bacteria 3184
152 Ga0495586_0158018 3300046535 Bacteria 1278
153 Ga0495587_0003329 3300046536 Bacteria 10723
154 Ga0495609_0012770 3300046538 Bacteria 3980
155 Ga0495597_0096178 3300046542 Bacteria 1252
156 Ga0495645_0049296 3300046543 Bacteria 3067
157 Ga0495622_0028150 3300046557 Bacteria 2623
158 Ga0495633_0008544 3300046558 Bacteria 5755
159 Ga0495668_0014441 3300046616 Bacteria 4629
160 Ga0495634_0003706 3300046642 Bacteria 12174
161 Ga0495611_0015444 3300046648 Bacteria 3264
162 Ga0495625_0005605 3300046660 Bacteria 11379
163 Ga0495635_0020254 3300046663 Bacteria 4634
164 Ga0495661_0065361 3300046665 Bacteria 2143
165 Ga0495588_0001179 3300046674 Bacteria 11251
166 Ga0495588_0001713 3300046674 Bacteria 9339
167 Ga0495588_0005467 3300046674 Bacteria 5655
168 Ga0495657_0003111 3300046675 Bacteria 13697
169 Ga0495657_0014256 3300046675 Bacteria 5840
170 Ga0495657_0018805 3300046675 Bacteria 4993
171 Ga0495646_0001099 3300046680 Bacteria 15732
172 Ga0495658_0040561 3300046683 Bacteria 2589
173 Ga0495613_0002309 3300046689 Bacteria 14449
174 Ga0495613_0009741 3300046689 Bacteria 7141
175 Ga0495613_0012311 3300046689 Bacteria 6354
176 Ga0495613_0047573 3300046689 Bacteria 3168
177 Ga0495613_0241945 3300046689 Bacteria 1261
178 Ga0495624_0101275 3300046690 Bacteria 1773
179 Ga0495670_0011616 3300046691 Bacteria 4334
180 Ga0495671_0007350 3300046692 Bacteria 6286
181 Ga0495649_0135881 3300046694 Bacteria 1296
182 Ga0495589_0002367 3300046794 Bacteria 10586
183 Ga0495589_0004125 3300046794 Bacteria 7773
184 Ga0495589_0054205 3300046794 Bacteria 1977
185 Ga0495600_0018415 3300046809 Bacteria 4449
186 Ga0495581_0011165 3300047315 Bacteria 5191
187 Ga0495581_0192159 3300047315 Bacteria 1194
188 Ga0495604_0000236 3300047317 Bacteria 49736
189 Ga0495604_0013146 3300047317 Bacteria 6591
190 Ga0495636_0001829 3300047318 Bacteria 8134
191 Ga0495636_0007056 3300047318 Bacteria 4419
192 Ga0495636_0042139 3300047318 Bacteria 1896
193 Ga0495676_0002285 3300047321 Bacteria 17003
194 Ga0495676_0005964 3300047321 Bacteria 11194
195 Ga0495676_0027561 3300047321 Bacteria 4867
196 Ga0495676_0034111 3300047321 Bacteria 4273
197 Ga0495680_0015226 3300047322 Bacteria 6640
198 Ga0495683_0087560 3300047323 Bacteria 1512
199 Ga0495683_0165386 3300047323 Bacteria 1020
200 Ga0495687_001583 3300047443 Bacteria 20608
201 Ga0495687_005250 3300047443 Bacteria 8322
202 Ga0495687_022248 3300047443 Bacteria 3047
203 Ga0495687_024226 3300047443 Bacteria 2887
204 Ga0495687_025764 3300047443 Bacteria 2773
205 Ga0495687_042331 3300047443 Bacteria 1990
206 Ga0495687_073878 3300047443 Bacteria 1358
207 Ga0495687_081993 3300047443 Bacteria 1260
208 Ga0495675_0025742 3300047444 Bacteria 3749
209 Ga0495675_0128789 3300047444 Bacteria 1574
210 Ga0495679_069465 3300047446 Bacteria 1017
211 Ga0495685_001011 3300047447 Bacteria 8558
212 Ga0495685_001256 3300047447 Bacteria 7762
213 Ga0495685_004581 3300047447 Bacteria 4479
214 Ga0495685_009293 3300047447 Bacteria 3279
215 Ga0495685_012477 3300047447 Bacteria 2879
216 Ga0495681_0001306 3300047470 Bacteria 18862
217 Ga0495684_0084971 3300047471 Bacteria 2400
218 Ga0495686_0014026 3300047472 Bacteria 5536
219 Ga0495686_0106436 3300047472 Bacteria 1686
220 Ga0495593_0005164 3300047673 Bacteria 7717
221 Ga0495593_0014246 3300047673 Bacteria 4521
222 Ga0495602_0011559 3300048088 Bacteria 9121
223 Ga0495614_0014737 3300048089 Bacteria 3419
224 Ga0495626_0010267 3300048091 Bacteria 5012
225 Ga0501033_0003725 3300049570 Bacteria 12398
226 Ga0501033_0032202 3300049570 Bacteria 3937
227 Ga0501036_0004655 3300049572 Bacteria 11085
228 Ga0501037_0125670 3300049573 Bacteria 1842
229 Ga0501038_0005024 3300049574 Bacteria 12284
230 Ga0501043_0199512 3300049579 Bacteria 1553
231 Ga0501047_0394905 3300049581 Bacteria 1216
232 Ga0501070_0279268 3300049586 Bacteria 1363
233 Ga0501235_030708 3300049669 Bacteria 1212
234 Ga0501035_0264458 3300049822 Bacteria 1457
235 Ga0501044_0015316 3300049823 Bacteria 8259
236 Ga0501044_0037062 3300049823 Bacteria 5098
237 Ga0501044_0376453 3300049823 Bacteria 1335
238 Ga0501044_0413185 3300049823 Bacteria 1260
239 nmdc:mga03n38_153639_c1 3300050490 Bacteria 1160
240 nmdc:mga06z11_6386_c1 3300050494 Bacteria 4792
241 Ga0495612_0093997 3300053078 Bacteria 1272
242 Ga0495619_0036742 3300053085 Bacteria 3191
243 Ga0500578_0026045 3300053086 Bacteria 3753
244 Ga0500644_0004045 3300053088 Bacteria 3647
245 Ga0500640_034136 3300053095 Bacteria 2233
246 Ga0500660_138552 3300053100 Bacteria 972
247 Ga0500560_012250 3300053107 Bacteria 2216
248 Ga0500628_004375 3300053129 Bacteria 2339
249 Ga0500652_002654 3300053131 Bacteria 5403
250 Ga0500658_0002535 3300053134 Bacteria 7076
251 Ga0500559_0096747 3300053136 Bacteria 1357
252 Ga0500561_0021406 3300053137 Bacteria 1523
253 Ga0500588_0015974 3300053146 Bacteria 1934
254 Ga0500600_0009862 3300053149 Bacteria 5771
255 Ga0500616_0006868 3300053153 Bacteria 7348
256 Ga0500633_0001149 3300053160 Bacteria 4805
257 Ga0500587_000600 3300053739 Bacteria 4500
258 Ga0466962_0000129 3300061719 Bacteria 31015
259 Ga0466962_0068068 3300061719 Bacteria 1700
260 2809234451 2808606448 Bacteria 8656184
261 2547407250 2547132111 Bacteria 8013147
262 2554255900 2554235005 Bacteria 6457341
263 2585297368 2582581312 Bacteria 7308206
264 2585307795 2582581313 Bacteria 10042643
265 2585318410 2582581314 Bacteria 11452267
266 2616699351 2616644814 Bacteria 11555299
267 2616905064 2616644941 Bacteria 8510691
268 2643761439 2643221548 Bacteria 8053412
269 2643899079 2643221578 Bacteria 9213798
270 2644267120 2643221647 Bacteria 10741251
271 2644388526 2643221670 Bacteria 6497041
272 2644402837 2643221673 Bacteria 9196637
273 2644430413 2643221677 Bacteria 7584031
274 2644442270 2643221678 Bacteria 9540101
275 2644459159 2643221682 Bacteria 6743283
276 2644626400 2643221714 Bacteria 9015452
277 2784590744 2784132148 Bacteria 8627943
278 2785340813 2784746763 Bacteria 9783172
279 2785371949 2784746768 Bacteria 10036182
280 2786673054 2786546132 Bacteria 10419719
281 2808844457 2808606359 Bacteria 9866990
282 2808914036 2808606375 Bacteria 9466072
283 2811844025 2808606982 Bacteria 7791042
284 2812355569 2811994879 Bacteria 9313447
285 2812478413 2811994917 Bacteria 7761064
286 2819697756 2818991463 Bacteria 7948711
287 2862182377 2862178590 Bacteria 8583590
288 2862284228 2862281513 Bacteria 9621493
289 2862297203 2862290372 Bacteria 7471434
290 2862391589 2862382967 Bacteria 10317375
291 2862510545 2862507626 Bacteria 9425308
292 2862577090 2862574272 Bacteria 10567477
293 2863409026 2863404153 Bacteria 9672205
294 2866556109 2866552031 Bacteria 5824618
295 2867435375 2867428634 Bacteria 9590268
296 2867478941 2867475112 Bacteria 6909112
297 2873153710 2873151551 Bacteria 8625867
298 2875397101 2875391855 Bacteria 7600475
299 2877678632 2877676314 Bacteria 9512378
300 2912717204 2912715099 Bacteria 9460473
301 2912729795 2912723979 Bacteria 8557534
302 2918506891 2918501144 Bacteria 8668083
303 2919474092 2919468124 Bacteria 9133025
304 2935393447 2935390628 Bacteria 7043367
305 2946047451 2946045630 Bacteria 8527308
306 2946070239 2946064051 Bacteria 8957905
307 2946078116 2946072368 Bacteria 8999607
308 2947226574 2947224130 Bacteria 9938529
309 2954010692 2954002825 Bacteria 9173742
310 2954383595 2954380949 Bacteria 10050426
311 2954679368 2954673503 Bacteria 9685905
312 2954684787 2954682443 Bacteria 9862841
313 2954694386 2954691527 Bacteria 10720516
314 2954709589 2954701450 Bacteria 10834262
315 2954713891 2954711539 Bacteria 10867210
316 2954723858 2954721474 Bacteria 10456478
317 2954737977 2954731030 Bacteria 10243860
318 2954742759 2954740390 Bacteria 10229294
319 2954756836 2954749733 Bacteria 10366972
320 2954761720 2954759201 Bacteria 9358192
321 2966600486 2966598605 Bacteria 7676064
322 2990067368 2990059506 Bacteria 9321252
323 2997454981 2997451912 Bacteria 8492419
324 2997602582 2997600082 Bacteria 9896405
325 3006494099 3006493962 Bacteria 8825450
326 8008563180 8008558824 Bacteria 10610750
327 8008576782 8008574985 Bacteria 7815457
328 8023627655 8023623736 Bacteria 8593882
329 8025483118 8025478263 Bacteria 8209203
330 8025533423 8025530807 Bacteria 8495698
331 8047895701 8047893842 Bacteria 11723082
332 8048130038 8048127548 Bacteria 11053136
333 8048363238 8048356638 Bacteria 11044339
334 8048372725 8048369669 Bacteria 11666822
335 8048381659 8048379754 Bacteria 11877923
336 8048408675 8048406513 Bacteria 8936924
337 8054164000 8054160619 Bacteria 7783213
338 8056449604 8056447290 Bacteria 7680491
339 8056669794 8056667051 Bacteria 6953971
340 8056830120 8056829672 Bacteria 9045328
341 JGI25153J46596_10036640
342 rootH1_10154913
343 JGI25160J50197_1024249
344 Ga0081455_10048126
345 Ga0075365_10116433
346 Ga0070715_10034182
347 Ga0105251_10124187
348 Ga0105243_10026371
349 Ga0105246_10023218
350 Ga0157372_10234843
351 Ga0182008_10000799
352 Ga0182006_1019286
353 Ga0182007_10000101
354 Ga0182005_1018833
355 Ga0183367_1019
356 Ga0209758_1012962
357 Ga0207426_1001178
358 Ga0207426_1011754
359 Ga0207426_1014844
360 Ga0207426_1019057
361 Ga0207647_10009431
362 Ga0307517_10007357
363 Ga0307515_10001401
364 Ga0307515_10049027
365 Ga0307515_10106213
366 Ga0307511_10000234
367 Ga0307511_10094979
368 Ga0307512_10022360
369 Ga0307512_10078458
370 Ga0307513_10001846
371 Ga0307513_10088323
372 Ga0307509_10038113
373 Ga0307508_10007702
374 Ga0307508_10014505
375 Ga0307508_10016982
376 Ga0307508_10020377
377 Ga0307508_10333826
378 Ga0307514_10023150
379 Ga0307514_10087422
380 Ga0307514_10095185
381 Ga0307516_10012425
382 Ga0307516_10018458
383 Ga0307516_10057780
384 Ga0307516_10062717
385 Ga0307518_10242992
386 Ga0307507_10006947
387 Ga0307507_10090860
388 Ga0307510_10086965
389 Ga0395900_0236463
390 Ga0395900_0237417
391 Ga0395898_0009932
392 Ga0439436_0002334
393 Ga0439436_0004182
394 Ga0439439_0012748
395 Ga0451800_1367007
396 Ga0451853_0097410
397 Ga0451853_2802168
398 Ga0439433_0001744
399 Ga0439433_0002511
400 Ga0439448_0016748
401 Ga0439449_0004503
402 Ga0439455_0042856
403 Ga0439457_000719
404 Ga0439457_001035
405 Ga0439457_018534
406 Ga0439462_0022305
407 Ga0450894_002239
408 Ga0450898_001714
409 Ga0450903_002243
410 Ga0450906_005089
411 Ga0439458_0001276
412 Ga0439458_0010646
413 Ga0466969_0148345
414 Ga0466972_0010910
415 Ga0466972_0018327
416 Ga0466972_0031645
417 Ga0466965_0000651
418 Ga0466965_0020235
419 Ga0466965_0090424
420 Ga0466966_0001585
421 Ga0466966_0005464
422 Ga0466961_0001910
423 Ga0466961_0028569
424 Ga0466961_0047426
425 Ga0466963_0000490
426 Ga0466971_0000946
427 Ga0466970_0000076
428 Ga0466970_0000200
429 Ga0466970_0166957
430 Ga0466957_0000184
431 Ga0466960_0004335
432 Ga0466959_0001263
433 Ga0466959_0115936
434 Ga0466958_0148862
435 Ga0466967_0001562
436 Ga0466967_0035624
437 Ga0495617_010473
438 Ga0495627_034567
439 Ga0495592_0009832
440 Ga0495603_0001951
441 Ga0495603_0002087
442 Ga0495603_0017056
443 Ga0495603_0028326
444 Ga0495603_0041567
445 Ga0495629_0001954
446 Ga0495629_0002613
447 Ga0495629_0002785
448 Ga0495629_0003765
449 Ga0495629_0016779
450 Ga0495629_0031836
451 Ga0495629_0107178
452 Ga0495629_0155826
453 Ga0495629_0272505
454 Ga0495638_0025172
455 Ga0495638_0157974
456 Ga0495651_0000688
457 Ga0495653_0040887
458 Ga0495582_0089332
459 Ga0495582_0152414
460 Ga0495605_0009572
461 Ga0495639_0087597
462 Ga0495639_0101991
463 Ga0495662_0000491
464 Ga0495662_0007738
465 Ga0495664_0001121
466 Ga0495585_0063116
467 Ga0495594_0000407
468 Ga0495594_0014628
469 Ga0495594_0028684
470 Ga0495594_0043046
471 Ga0495594_0100925
472 Ga0495607_0009680
473 Ga0495607_0044823
474 Ga0495583_0033592
475 Ga0495608_0040089
476 Ga0495616_0012227
477 Ga0495618_0022755
478 Ga0495620_0004374
479 Ga0495628_0016290
480 Ga0495628_0056968
481 Ga0495630_0005530
482 Ga0495632_0097453
483 Ga0495643_0003800
484 Ga0495643_0007655
485 Ga0495648_0117861
486 Ga0495648_0118620
487 Ga0495666_0007794
488 Ga0495652_0015609
489 Ga0495654_0015867
490 Ga0495640_0102982
491 Ga0495586_0025162
492 Ga0495586_0158018
493 Ga0495587_0003329
494 Ga0495609_0012770
495 Ga0495597_0096178
496 Ga0495645_0049296
497 Ga0495622_0028150
498 Ga0495633_0008544
499 Ga0495668_0014441
500 Ga0495634_0003706
501 Ga0495611_0015444
502 Ga0495625_0005605
503 Ga0495635_0020254
504 Ga0495661_0065361
505 Ga0495588_0001179
506 Ga0495588_0001713
507 Ga0495588_0005467
508 Ga0495657_0003111
509 Ga0495657_0014256
510 Ga0495657_0018805
511 Ga0495646_0001099
512 Ga0495658_0040561
513 Ga0495613_0002309
514 Ga0495613_0009741
515 Ga0495613_0012311
516 Ga0495613_0047573
517 Ga0495613_0241945
518 Ga0495624_0101275
519 Ga0495670_0011616
520 Ga0495671_0007350
521 Ga0495649_0135881
522 Ga0495589_0002367
523 Ga0495589_0004125
524 Ga0495589_0054205
525 Ga0495600_0018415
526 Ga0495581_0011165
527 Ga0495581_0192159
528 Ga0495604_0000236
529 Ga0495604_0013146
530 Ga0495636_0001829
531 Ga0495636_0007056
532 Ga0495636_0042139
533 Ga0495676_0002285
534 Ga0495676_0005964
535 Ga0495676_0027561
536 Ga0495676_0034111
537 Ga0495680_0015226
538 Ga0495683_0087560
539 Ga0495683_0165386
540 Ga0495687_001583
541 Ga0495687_005250
542 Ga0495687_022248
543 Ga0495687_024226
544 Ga0495687_025764
545 Ga0495687_042331
546 Ga0495687_073878
547 Ga0495687_081993
548 Ga0495675_0025742
549 Ga0495675_0128789
550 Ga0495679_069465
551 Ga0495685_001011
552 Ga0495685_001256
553 Ga0495685_004581
554 Ga0495685_009293
555 Ga0495685_012477
556 Ga0495681_0001306
557 Ga0495684_0084971
558 Ga0495686_0014026
559 Ga0495686_0106436
560 Ga0495593_0005164
561 Ga0495593_0014246
562 Ga0495602_0011559
563 Ga0495614_0014737
564 Ga0495626_0010267
565 Ga0501033_0003725
566 Ga0501033_0032202
567 Ga0501036_0004655
568 Ga0501037_0125670
569 Ga0501038_0005024
570 Ga0501043_0199512
571 Ga0501047_0394905
572 Ga0501070_0279268
573 Ga0501235_030708
574 Ga0501035_0264458
575 Ga0501044_0015316
576 Ga0501044_0037062
577 Ga0501044_0376453
578 Ga0501044_0413185
579 nmdc:mga03n38_153639_c1
580 nmdc:mga06z11_6386_c1
581 Ga0495612_0093997
582 Ga0495619_0036742
583 Ga0500578_0026045
584 Ga0500644_0004045
585 Ga0500640_034136
586 Ga0500660_138552
587 Ga0500560_012250
588 Ga0500628_004375
589 Ga0500652_002654
590 Ga0500658_0002535
591 Ga0500559_0096747
592 Ga0500561_0021406
593 Ga0500588_0015974
594 Ga0500600_0009862
595 Ga0500616_0006868
596 Ga0500633_0001149
597 Ga0500587_000600
598 Ga0466962_0000129
599 Ga0466962_0068068
600 2809234451
601 2547407250
602 2554255900
603 2585297368
604 2585307795
605 2585318410
606 2616699351
607 2616905064
608 2643761439
609 2643899079
610 2644267120
611 2644388526
612 2644402837
613 2644430413
614 2644442270
615 2644459159
616 2644626400
617 2784590744
618 2785340813
619 2785371949
620 2786673054
621 2808844457
622 2808914036
623 2811844025
624 2812355569
625 2812478413
626 2819697756
627 2862182377
628 2862284228
629 2862297203
630 2862391589
631 2862510545
632 2862577090
633 2863409026
634 2866556109
635 2867435375
636 2867478941
637 2873153710
638 2875397101
639 2877678632
640 2912717204
641 2912729795
642 2918506891
643 2919474092
644 2935393447
645 2946047451
646 2946070239
647 2946078116
648 2947226574
649 2954010692
650 2954383595
651 2954679368
652 2954684787
653 2954694386
654 2954709589
655 2954713891
656 2954723858
657 2954737977
658 2954742759
659 2954756836
660 2954761720
661 2966600486
662 2990067368
663 2997454981
664 2997602582
665 3006494099
666 8008563180
667 8008576782
668 8023627655
669 8025483118
670 8025533423
671 8047895701
672 8048130038
673 8048363238
674 8048372725
675 8048381659
676 8048408675
677 8054164000
678 8056449604
679 8056669794
680 8056830120

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xra-assembly1.cif.gz_A drimenyl diphosphate synthase d303a from streptomyces showdoensis in complex with farnesyl diphosphate (fpp) and mg2+ 0.6217 18 307
8fni-assembly1.cif.gz_6 cryo-em structure of rnase-treated resc-b in trypanosomal rna editing 0.6166 22 218
6o60-assembly1.cif.gz_B crystal structure of ggtase3-fbxl2-skp1 complex 0.5895 16 310
4d94-assembly1.cif.gz_A crystal structure of tep1r 0.5858 19 307
6sbf-assembly1.cif.gz_A structure of type ii terpene cyclase mste_y157f from scytonema (apo) 0.5792 18 305
ID Description Score Start End Superfamily
af_Q9FM64_196_292_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.622 143 216 1.25.40.10
af_A0A0R0IMF2_21_133_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6086 143 211 1.25.40.10
af_Q9C9H9_178_283_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6065 143 232 1.25.40.10
af_I1JZP1_227_335_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6013 143 211 1.25.40.10
af_I1JAS4_165_281_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5789 143 212 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0K8PYV0-F1-model_v4 Prenyltransferase 0.9987 21 313
AF-A0A117Q9C5-F1-model_v4 deleted 0.9979 33 313
AF-K4R1Q0-F1-model_v4 Uncharacterized protein 0.9977 17 313
AF-A0A6G2VHR6-F1-model_v4 Prenyltransferase 0.9918 27 261
AF-C7Q7Z9-F1-model_v4 Prenyltransferase 0.9878 18 311

Map