F414498

General Info

Members Datasets Scaffolds Average Seq Length
340 206 680 170

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0014999|Ga0501033_0014999_266_784
Length 172
Sequence MTDFKKAILAGGCFWGMQDLIRKQPGVVATRVGYTGDPNTPNATYRHHGTHAEGIEIIYDPAHTDYRAILEFFFQIHDPTTKNRQGNDVGPSYRSAIFYLDEDQKAIAEDTIADVEASGLWPGTVVTEVSPAGDFWQAEPEHQDYLLHYPNGYTCHFIRPGWKLPRRTAADR

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
21 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
22 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
23 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
24 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
25 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
26 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
27 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
28 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
31 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
37 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
38 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
39 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
40 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
41 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
42 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
43 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
77 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
78 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
79 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
80 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
81 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
91 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
92 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
93 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
94 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
95 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
96 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
97 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
98 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
101 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
102 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
103 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
104 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
109 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
110 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
111 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
112 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
113 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
120 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
121 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
122 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
123 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
124 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
131 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
132 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
133 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
145 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
146 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
147 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
148 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
149 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
150 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
151 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
152 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
153 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
154 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
155 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
156 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
159 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
162 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
163 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
164 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
165 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
166 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
167 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
171 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
174 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
175 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
176 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
177 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
178 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
179 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
184 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
185 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
186 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
187 2842694124 Methylopila sp. R-72369 Isolate Unclassified
188 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
189 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
190 2919404418 Luteibacter sp. 3190 Isolate Unclassified
191 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
192 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
193 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
194 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
195 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
196 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
197 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
198 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
199 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
200 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
201 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
202 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
203 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
204 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
205 8054472261 Pseudonocardia terrae RS11V-5 Isolate Rhizosphere
206 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.12
Metatranscriptomes 4.12
Isolates 6.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.41
Nodule 4.12
Rhizoplane 4.71
Rhizosphere 67.06
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0014999 3300049570 Bacteria 5881
2 JGI24740J21852_10002411 3300001979 Bacteria 8498
3 Ga0006556J51387_1043898 3300003479 Bacteria 1310
4 Ga0055540_1000038 3300003792 Bacteria 161988
5 Ga0058861_10093589 3300004800 Bacteria 759
6 Ga0070683_101270475 3300005329 Bacteria 707
7 Ga0070680_100000353 3300005336 Bacteria 30899
8 Ga0070680_100012105 3300005336 Bacteria 6697
9 Ga0070692_10005021 3300005345 Bacteria 5593
10 Ga0070688_100596416 3300005365 Bacteria 845
11 Ga0070714_100141954 3300005435 Bacteria 2157
12 Ga0070663_100005982 3300005455 Bacteria 7282
13 Ga0070663_100059792 3300005455 Bacteria 2739
14 Ga0070663_100259513 3300005455 Bacteria 1378
15 Ga0070663_100607028 3300005455 Bacteria 921
16 Ga0070681_10000322 3300005458 Bacteria 39028
17 Ga0070681_10003313 3300005458 Bacteria 15047
18 Ga0070679_100000402 3300005530 Bacteria 36897
19 Ga0070679_100043365 3300005530 Bacteria 4480
20 Ga0068853_100064778 3300005539 Bacteria 3170
21 Ga0070696_100117661 3300005546 Bacteria 1920
22 Ga0070693_100287633 3300005547 Bacteria 1103
23 Ga0068855_100029362 3300005563 Bacteria 6575
24 Ga0068855_100412801 3300005563 Bacteria 1478
25 Ga0068857_100375929 3300005577 Bacteria 1318
26 Ga0068854_100005652 3300005578 Bacteria 7900
27 Ga0068854_100011955 3300005578 Bacteria 5672
28 Ga0068856_100004603 3300005614 Bacteria 13721
29 Ga0068852_100026691 3300005616 Bacteria 4699
30 Ga0068852_100124141 3300005616 Bacteria 2368
31 Ga0068852_100299786 3300005616 Bacteria 1555
32 Ga0068861_101072564 3300005719 Bacteria 773
33 Ga0068860_100391899 3300005843 Bacteria 1373
34 Ga0081540_1033949 3300005983 Bacteria 2760
35 Ga0075365_10000129 3300006038 Bacteria 23100
36 Ga0075365_10043789 3300006038 Bacteria 2931
37 Ga0075365_10159601 3300006038 Bacteria 1571
38 Ga0075368_10068526 3300006042 Bacteria 1430
39 Ga0075368_10128822 3300006042 Bacteria 1051
40 Ga0075363_100000026 3300006048 Bacteria 30639
41 Ga0075363_100001955 3300006048 Bacteria 8181
42 Ga0075363_100007557 3300006048 Bacteria 5007
43 Ga0075363_100011733 3300006048 Bacteria 4205
44 Ga0075363_100356668 3300006048 Bacteria 855
45 Ga0075363_100368357 3300006048 Bacteria 841
46 Ga0075364_10007057 3300006051 Bacteria 6642
47 Ga0075364_10009004 3300006051 Bacteria 5979
48 Ga0075364_10009262 3300006051 Bacteria 5904
49 Ga0075364_10025321 3300006051 Bacteria 3776
50 Ga0075364_10070334 3300006051 Bacteria 2304
51 Ga0075362_10018226 3300006177 Bacteria 2902
52 Ga0075362_10023435 3300006177 Bacteria 2611
53 Ga0075362_10104270 3300006177 Bacteria 1329
54 Ga0075367_10008589 3300006178 Bacteria 5300
55 Ga0075367_10127343 3300006178 Bacteria 1572
56 Ga0075367_10268711 3300006178 Bacteria 1071
57 Ga0075369_10021295 3300006186 Bacteria 2662
58 Ga0075366_10036711 3300006195 Bacteria 2889
59 Ga0075366_10594405 3300006195 Bacteria 686
60 Ga0075370_10007700 3300006353 Bacteria 5499
61 Ga0075370_10054986 3300006353 Bacteria 2261
62 Ga0075370_10083590 3300006353 Bacteria 1837
63 Ga0105240_10539306 3300009093 Bacteria 1292
64 Ga0105245_10030988 3300009098 Bacteria 4731
65 Ga0105245_10506006 3300009098 Bacteria 1225
66 Ga0105242_10809153 3300009176 Bacteria 928
67 Ga0105237_10000178 3300009545 Bacteria 89960
68 Ga0105237_10117909 3300009545 Bacteria 2648
69 Ga0105238_10290526 3300009551 Bacteria 1617
70 Ga0105238_10365850 3300009551 Bacteria 1432
71 Ga0105238_10605232 3300009551 Bacteria 1104
72 Ga0105239_10007662 3300010375 Bacteria 12369
73 Ga0105239_10269014 3300010375 Bacteria 1916
74 Ga0105239_10477251 3300010375 Bacteria 1416
75 Ga0157373_10027202 3300013100 Bacteria 4126
76 Ga0157373_10034652 3300013100 Bacteria 3626
77 Ga0157371_10036105 3300013102 Bacteria 3540
78 Ga0157371_10050166 3300013102 Bacteria 2965
79 Ga0157371_10103981 3300013102 Bacteria 2015
80 Ga0157370_10055694 3300013104 Bacteria 3765
81 Ga0157369_10006863 3300013105 Bacteria 13136
82 Ga0157369_10678019 3300013105 Bacteria 1062
83 Ga0157372_10000860 3300013307 Bacteria 32907
84 Ga0157372_10162143 3300013307 Bacteria 2584
85 Ga0157375_11416664 3300013308 Bacteria 819
86 Ga0157380_10047448 3300014326 Bacteria 3379
87 Ga0182005_1000004 3300015265 Bacteria 609645
88 Ga0206356_10204999 3300020070 Bacteria 3181
89 Ga0206351_11001281 3300020077 Bacteria 1507
90 Ga0206352_10103915 3300020078 Bacteria 3805
91 Ga0206350_10580427 3300020080 Bacteria 1013
92 Ga0206350_11225466 3300020080 Bacteria 3443
93 Ga0206354_10789885 3300020081 Bacteria 2803
94 Ga0206354_11261967 3300020081 Bacteria 1093
95 Ga0154015_1575378 3300020610 Bacteria 1224
96 Ga0224712_10022151 3300022467 Bacteria 2186
97 Ga0224712_10102595 3300022467 Bacteria 1215
98 Ga0224712_10164665 3300022467 Bacteria 991
99 Ga0209026_1034617 3300025250 Bacteria 742
100 Ga0209051_1000014 3300025303 Bacteria 552732
101 Ga0209051_1005546 3300025303 Bacteria 7341
102 Ga0209051_1013091 3300025303 Bacteria 3968
103 Ga0207647_10002421 3300025904 Bacteria 14153
104 Ga0207705_10005319 3300025909 Bacteria 9630
105 Ga0207705_10006006 3300025909 Bacteria 9037
106 Ga0207707_10000252 3300025912 Bacteria 58932
107 Ga0207707_10001857 3300025912 Bacteria 19297
108 Ga0207707_10008630 3300025912 Bacteria 8840
109 Ga0207695_10009525 3300025913 Bacteria 12010
110 Ga0207695_10042288 3300025913 Bacteria 4869
111 Ga0207695_10336718 3300025913 Bacteria 1397
112 Ga0207671_10037325 3300025914 Bacteria 3603
113 Ga0207671_10142515 3300025914 Bacteria 1847
114 Ga0207671_10603312 3300025914 Bacteria 875
115 Ga0207660_10004881 3300025917 Bacteria 8733
116 Ga0207660_10053180 3300025917 Bacteria 2885
117 Ga0207660_10367875 3300025917 Bacteria 1154
118 Ga0207660_10413819 3300025917 Bacteria 1087
119 Ga0207657_10028550 3300025919 Bacteria 5088
120 Ga0207657_10760658 3300025919 Bacteria 750
121 Ga0207649_10065175 3300025920 Bacteria 2305
122 Ga0207652_10000145 3300025921 Bacteria 76311
123 Ga0207652_10007394 3300025921 Bacteria 8855
124 Ga0207652_10151394 3300025921 Bacteria 2077
125 Ga0207694_10267501 3300025924 Bacteria 1402
126 Ga0207694_10616879 3300025924 Bacteria 913
127 Ga0207687_10205455 3300025927 Bacteria 1542
128 Ga0207661_10214118 3300025944 Bacteria 1699
129 Ga0207661_10797616 3300025944 Bacteria 869
130 Ga0207667_10014125 3300025949 Bacteria 9114
131 Ga0207667_10025455 3300025949 Bacteria 6474
132 Ga0207667_10098838 3300025949 Bacteria 3011
133 Ga0207667_10236809 3300025949 Bacteria 1868
134 Ga0207640_10006644 3300025981 Bacteria 6355
135 Ga0207640_10032480 3300025981 Bacteria 3237
136 Ga0207640_10054305 3300025981 Bacteria 2618
137 Ga0207639_10001218 3300026041 Bacteria 17476
138 Ga0207639_10469178 3300026041 Bacteria 1146
139 Ga0207678_10002678 3300026067 Bacteria 16167
140 Ga0207678_10010632 3300026067 Bacteria 8085
141 Ga0207678_10045760 3300026067 Bacteria 3784
142 Ga0207678_10107925 3300026067 Bacteria 2375
143 Ga0207678_10313309 3300026067 Bacteria 1349
144 Ga0207702_10015375 3300026078 Bacteria 6342
145 Ga0207675_100208076 3300026118 Bacteria 1881
146 Ga0207698_10002630 3300026142 Bacteria 10666
147 Ga0207698_10017940 3300026142 Bacteria 4811
148 Ga0207698_10569240 3300026142 Bacteria 1113
149 Ga0209813_10292037 3300027866 Bacteria 631
150 Ga0265339_10052311 3300031249 Bacteria 2225
151 Ga0265327_10156302 3300031251 Bacteria 1056
152 Ga0265314_10022668 3300031711 Bacteria 4808
153 Ga0265342_10008171 3300031712 Bacteria 7548
154 Ga0307516_10182455 3300031730 Bacteria 1831
155 Ga0307413_10000173 3300031824 Bacteria 18182
156 Ga0307413_10161081 3300031824 Bacteria 1576
157 Ga0307413_10374448 3300031824 Bacteria 1107
158 Ga0307413_10443344 3300031824 Bacteria 1029
159 Ga0307409_100147563 3300031995 Bacteria 2036
160 Ga0307409_100405206 3300031995 Bacteria 1304
161 Ga0307409_100668892 3300031995 Bacteria 1034
162 Ga0307416_100036475 3300032002 Bacteria 3771
163 Ga0307414_10029905 3300032004 Bacteria 3551
164 Ga0307414_10388107 3300032004 Bacteria 1209
165 Ga0307414_10716803 3300032004 Bacteria 907
166 Ga0307411_10078046 3300032005 Bacteria 2269
167 Ga0307411_10566208 3300032005 Bacteria 972
168 Ga0307415_100020830 3300032126 Bacteria 4014
169 Ga0307415_100441349 3300032126 Bacteria 1123
170 Ga0373937_1787211 3300036401 Bacteria 561
171 Ga0395900_0147585 3300037418 Bacteria 2404
172 Ga0436364_0161756 3300037853 Bacteria 1423
173 Ga0436364_0739477 3300037853 Bacteria 555
174 Ga0436365_0217155 3300039437 Bacteria 41866
175 Ga0436360_0103678 3300039438 Bacteria 1214
176 Ga0439466_0025230 3300041411 Bacteria 2076
177 Ga0451793_0682662 3300041452 Bacteria 2272
178 Ga0451839_0928442 3300041496 Bacteria 558
179 Ga0439462_0050304 3300042015 Bacteria 1119
180 Ga0466972_0386054 3300044658 Bacteria 656
181 Ga0466965_0162827 3300044683 Bacteria 1170
182 Ga0466963_0287022 3300044694 Bacteria 1157
183 Ga0466971_0028480 3300044719 Bacteria 2499
184 Ga0466959_0336639 3300045049 Bacteria 1030
185 Ga0466967_0256443 3300045976 Bacteria 1672
186 Ga0466967_0288832 3300045976 Bacteria 1575
187 Ga0466967_0394931 3300045976 Bacteria 1345
188 Ga0495592_0103451 3300046454 Bacteria 2026
189 Ga0495638_0120022 3300046460 Bacteria 1555
190 Ga0495639_0084305 3300046475 Bacteria 1484
191 Ga0495662_0178866 3300046476 Bacteria 1045
192 Ga0495594_0036986 3300046499 Bacteria 2664
193 Ga0495607_0001982 3300046501 Bacteria 17242
194 Ga0495606_0001837 3300046507 Bacteria 26825
195 Ga0495652_0364828 3300046529 Bacteria 1031
196 Ga0495665_0008209 3300046531 Bacteria 5663
197 Ga0495640_0195483 3300046533 Bacteria 1284
198 Ga0495635_0720064 3300046663 Bacteria 646
199 Ga0495599_0128409 3300046678 Bacteria 1575
200 Ga0495623_0212263 3300046679 Bacteria 1107
201 Ga0495658_0029477 3300046683 Bacteria 2972
202 Ga0495581_0047018 3300047315 Bacteria 2494
203 Ga0495676_0064320 3300047321 Bacteria 2854
204 Ga0495675_0044059 3300047444 Bacteria 2842
205 Ga0495686_0127364 3300047472 Bacteria 1513
206 Ga0495593_0026264 3300047673 Bacteria 3217
207 Ga0496100_0001099 3300048903 Bacteria 13076
208 Ga0496101_0007760 3300048904 Bacteria 6973
209 Ga0496101_0258020 3300048904 Bacteria 1359
210 Ga0496101_0472083 3300048904 Bacteria 990
211 Ga0496105_0191001 3300048908 Bacteria 1674
212 Ga0496108_0017658 3300048911 Bacteria 5838
213 Ga0496108_0394975 3300048911 Bacteria 1208
214 Ga0496109_0005414 3300048912 Bacteria 10674
215 Ga0496109_0182585 3300048912 Bacteria 1971
216 Ga0496110_0217593 3300048913 Bacteria 1737
217 Ga0496110_0509713 3300048913 Bacteria 1095
218 Ga0496112_0006682 3300048915 Bacteria 10156
219 Ga0496112_0148610 3300048915 Bacteria 2311
220 Ga0496113_0799296 3300048916 Bacteria 749
221 Ga0496115_0310296 3300048918 Bacteria 1292
222 Ga0496118_0000029 3300048921 Bacteria 340978
223 Ga0496123_0051120 3300048926 Bacteria 2755
224 Ga0496123_0109774 3300048926 Bacteria 1580
225 Ga0496126_0210024 3300048929 Bacteria 1639
226 Ga0501033_0020077 3300049570 Bacteria 5051
227 Ga0501033_0720311 3300049570 Bacteria 678
228 Ga0501034_0188595 3300049571 Bacteria 2025
229 Ga0501036_0011003 3300049572 Bacteria 7483
230 Ga0501036_0077752 3300049572 Bacteria 2808
231 Ga0501037_0102809 3300049573 Bacteria 2061
232 Ga0501038_0021898 3300049574 Bacteria 5733
233 Ga0501039_0010561 3300049575 Bacteria 7038
234 Ga0501040_0023307 3300049576 Bacteria 4150
235 Ga0501041_0000885 3300049577 Bacteria 16198
236 Ga0501043_0019287 3300049579 Bacteria 5353
237 Ga0501046_0009949 3300049580 Bacteria 8192
238 Ga0501047_0088855 3300049581 Bacteria 2967
239 Ga0501048_0012686 3300049582 Bacteria 6265
240 Ga0501069_0008915 3300049585 Bacteria 5288
241 Ga0501069_0016889 3300049585 Bacteria 3922
242 Ga0501069_0203303 3300049585 Bacteria 1148
243 Ga0501069_0746000 3300049585 Bacteria 592
244 Ga0501070_0000053 3300049586 Bacteria 100509
245 Ga0501070_0005185 3300049586 Bacteria 11099
246 Ga0501070_0008974 3300049586 Bacteria 8457
247 Ga0501070_0023425 3300049586 Bacteria 5172
248 Ga0501070_0071843 3300049586 Bacteria 2865
249 Ga0501071_0003094 3300049587 Bacteria 10319
250 Ga0501072_0002474 3300049588 Bacteria 13843
251 Ga0501073_0046701 3300049589 Bacteria 3044
252 Ga0501074_0000954 3300049590 Bacteria 18705
253 Ga0501074_0002371 3300049590 Bacteria 13121
254 Ga0501074_0012980 3300049590 Bacteria 6056
255 Ga0501074_0192857 3300049590 Bacteria 1452
256 Ga0501075_0022319 3300049591 Bacteria 4622
257 Ga0501076_0008428 3300049592 Bacteria 7555
258 Ga0501077_0005564 3300049593 Bacteria 7669
259 Ga0501245_002620 3300049708 Bacteria 2413
260 Ga0501079_0002420 3300049741 Bacteria 13540
261 Ga0501079_0401233 3300049741 Bacteria 1075
262 Ga0501080_0000938 3300049742 Bacteria 23852
263 Ga0501080_0022063 3300049742 Bacteria 5899
264 Ga0501081_0000963 3300049743 Bacteria 17110
265 Ga0501083_0058838 3300049744 Bacteria 2571
266 Ga0501083_1009201 3300049744 Bacteria 541
267 Ga0501035_0000542 3300049822 Bacteria 41925
268 Ga0501035_0014357 3300049822 Bacteria 7312
269 Ga0501035_0037250 3300049822 Bacteria 4405
270 Ga0501044_0000153 3300049823 Bacteria 85673
271 Ga0501044_0011030 3300049823 Bacteria 9807
272 Ga0501044_0078175 3300049823 Bacteria 3353
273 Ga0501044_0432811 3300049823 Bacteria 1224
274 Ga0501045_0001596 3300049824 Bacteria 15141
275 nmdc:mga03683_120911_c1 3300050489 Bacteria 1164
276 nmdc:mga03683_21150_c1 3300050489 Bacteria 2504
277 nmdc:mga03n38_1243_c1 3300050490 Bacteria 7169
278 nmdc:mga03n38_228677_c1 3300050490 Bacteria 974
279 nmdc:mga03n38_452947_c1 3300050490 Bacteria 714
280 nmdc:mga03n38_60120_c1 3300050490 Bacteria 1727
281 nmdc:mga03n38_8666_c1 3300050490 Bacteria 3662
282 nmdc:mga00v17_105404_c1 3300050491 Bacteria 1784
283 nmdc:mga00v17_12583_c1 3300050491 Bacteria 4672
284 nmdc:mga00v17_2314_c1 3300050491 Bacteria 9769
285 nmdc:mga00v17_245637_c1 3300050491 Bacteria 1161
286 nmdc:mga00v17_8297_c1 3300050491 Bacteria 5587
287 nmdc:mga0yw44_113_c1 3300050492 Bacteria 28386
288 nmdc:mga0yw44_133404_c1 3300050492 Bacteria 1609
289 nmdc:mga0yw44_60899_c1 3300050492 Bacteria 2314
290 nmdc:mga06z11_130926_c1 3300050494 Bacteria 1409
291 nmdc:mga06z11_4390_c1 3300050494 Bacteria 5549
292 nmdc:mga06z11_51272_c1 3300050494 Bacteria 2113
293 nmdc:mga06z11_98483_c1 3300050494 Bacteria 1600
294 nmdc:mga04h51_324320_c1 3300050495 Bacteria 632
295 nmdc:mga07m45_138757_c1 3300050496 Bacteria 1408
296 nmdc:mga07m45_63267_c2 3300050496 Bacteria 1762
297 nmdc:mga07m45_74043_c1 3300050496 Bacteria 1940
298 nmdc:mga07m45_8329_c1 3300050496 Bacteria 5325
299 nmdc:mga05p37_236577_c1 3300050507 Bacteria 2198
300 nmdc:mga0qj67_1156493_c1 3300050509 Bacteria 603
301 nmdc:mga0sz30_1760_c1 3300050516 Bacteria 7684
302 nmdc:mga0sz30_27854_c1 3300050516 Bacteria 2323
303 nmdc:mga0sz30_32773_c1 3300050516 Bacteria 2156
304 Ga0495601_0505753 3300053077 Bacteria 779
305 Ga0495655_0014360 3300053083 Bacteria 1659
306 Ga0495655_0061877 3300053083 Bacteria 1023
307 Ga0495655_0078113 3300053083 Bacteria 940
308 Ga0500651_0158230 3300053093 Bacteria 1356
309 Ga0500592_051378 3300053116 Bacteria 670
310 Ga0500593_074453 3300053117 Bacteria 1468
311 Ga0500658_0363630 3300053134 Bacteria 664
312 Ga0500559_0011160 3300053136 Bacteria 3844
313 Ga0500568_0056162 3300053139 Bacteria 1535
314 Ga0501084_0015756 3300054114 Bacteria 6268
315 Ga0587069_074195 3300059642 Bacteria 652
316 Ga0501082_0008211 3300060353 Bacteria 9006
317 Ga0530510_0009630 3300061734 Bacteria 6776
318 2513888152 2513237141 Bacteria 8496279
319 2738708032 2738541274 Bacteria 6909446
320 2739334281 2738543028 Bacteria 6917070
321 2842694200 2842694124 Bacteria 4063419
322 2857576923 2857576091 Bacteria 5465855
323 2902802433 2902799365 Bacteria 5419524
324 2919405534 2919404418 Bacteria 4232372
325 2935770718 2935769743 Bacteria 7878163
326 2935786996 2935785616 Bacteria 7962367
327 2935795044 2935793552 Bacteria 8012592
328 2935961037 2935959822 Bacteria 7869783
329 2939583081 2939582691 Bacteria 7088898
330 8016523452 8016522445 Bacteria 8156687
331 8016536956 8016530956 Bacteria 8155261
332 8016541222 8016539877 Bacteria 8155419
333 8016552033 8016548790 Bacteria 8155074
334 8016560409 8016557553 Bacteria 8154380
335 8016566611 8016566248 Bacteria 8158151
336 8016579355 8016575299 Bacteria 8154085
337 8019536656 8019530166 Bacteria 8155624
338 8019547942 8019547302 Bacteria 7996444
339 8054473890 8054472261 Bacteria 7464355
340 8056830856 8056829672 Bacteria 9045328
341 Ga0501033_0014999
342 JGI24740J21852_10002411
343 Ga0006556J51387_1043898
344 Ga0055540_1000038
345 Ga0058861_10093589
346 Ga0070683_101270475
347 Ga0070680_100000353
348 Ga0070680_100012105
349 Ga0070692_10005021
350 Ga0070688_100596416
351 Ga0070714_100141954
352 Ga0070663_100005982
353 Ga0070663_100059792
354 Ga0070663_100259513
355 Ga0070663_100607028
356 Ga0070681_10000322
357 Ga0070681_10003313
358 Ga0070679_100000402
359 Ga0070679_100043365
360 Ga0068853_100064778
361 Ga0070696_100117661
362 Ga0070693_100287633
363 Ga0068855_100029362
364 Ga0068855_100412801
365 Ga0068857_100375929
366 Ga0068854_100005652
367 Ga0068854_100011955
368 Ga0068856_100004603
369 Ga0068852_100026691
370 Ga0068852_100124141
371 Ga0068852_100299786
372 Ga0068861_101072564
373 Ga0068860_100391899
374 Ga0081540_1033949
375 Ga0075365_10000129
376 Ga0075365_10043789
377 Ga0075365_10159601
378 Ga0075368_10068526
379 Ga0075368_10128822
380 Ga0075363_100000026
381 Ga0075363_100001955
382 Ga0075363_100007557
383 Ga0075363_100011733
384 Ga0075363_100356668
385 Ga0075363_100368357
386 Ga0075364_10007057
387 Ga0075364_10009004
388 Ga0075364_10009262
389 Ga0075364_10025321
390 Ga0075364_10070334
391 Ga0075362_10018226
392 Ga0075362_10023435
393 Ga0075362_10104270
394 Ga0075367_10008589
395 Ga0075367_10127343
396 Ga0075367_10268711
397 Ga0075369_10021295
398 Ga0075366_10036711
399 Ga0075366_10594405
400 Ga0075370_10007700
401 Ga0075370_10054986
402 Ga0075370_10083590
403 Ga0105240_10539306
404 Ga0105245_10030988
405 Ga0105245_10506006
406 Ga0105242_10809153
407 Ga0105237_10000178
408 Ga0105237_10117909
409 Ga0105238_10290526
410 Ga0105238_10365850
411 Ga0105238_10605232
412 Ga0105239_10007662
413 Ga0105239_10269014
414 Ga0105239_10477251
415 Ga0157373_10027202
416 Ga0157373_10034652
417 Ga0157371_10036105
418 Ga0157371_10050166
419 Ga0157371_10103981
420 Ga0157370_10055694
421 Ga0157369_10006863
422 Ga0157369_10678019
423 Ga0157372_10000860
424 Ga0157372_10162143
425 Ga0157375_11416664
426 Ga0157380_10047448
427 Ga0182005_1000004
428 Ga0206356_10204999
429 Ga0206351_11001281
430 Ga0206352_10103915
431 Ga0206350_10580427
432 Ga0206350_11225466
433 Ga0206354_10789885
434 Ga0206354_11261967
435 Ga0154015_1575378
436 Ga0224712_10022151
437 Ga0224712_10102595
438 Ga0224712_10164665
439 Ga0209026_1034617
440 Ga0209051_1000014
441 Ga0209051_1005546
442 Ga0209051_1013091
443 Ga0207647_10002421
444 Ga0207705_10005319
445 Ga0207705_10006006
446 Ga0207707_10000252
447 Ga0207707_10001857
448 Ga0207707_10008630
449 Ga0207695_10009525
450 Ga0207695_10042288
451 Ga0207695_10336718
452 Ga0207671_10037325
453 Ga0207671_10142515
454 Ga0207671_10603312
455 Ga0207660_10004881
456 Ga0207660_10053180
457 Ga0207660_10367875
458 Ga0207660_10413819
459 Ga0207657_10028550
460 Ga0207657_10760658
461 Ga0207649_10065175
462 Ga0207652_10000145
463 Ga0207652_10007394
464 Ga0207652_10151394
465 Ga0207694_10267501
466 Ga0207694_10616879
467 Ga0207687_10205455
468 Ga0207661_10214118
469 Ga0207661_10797616
470 Ga0207667_10014125
471 Ga0207667_10025455
472 Ga0207667_10098838
473 Ga0207667_10236809
474 Ga0207640_10006644
475 Ga0207640_10032480
476 Ga0207640_10054305
477 Ga0207639_10001218
478 Ga0207639_10469178
479 Ga0207678_10002678
480 Ga0207678_10010632
481 Ga0207678_10045760
482 Ga0207678_10107925
483 Ga0207678_10313309
484 Ga0207702_10015375
485 Ga0207675_100208076
486 Ga0207698_10002630
487 Ga0207698_10017940
488 Ga0207698_10569240
489 Ga0209813_10292037
490 Ga0265339_10052311
491 Ga0265327_10156302
492 Ga0265314_10022668
493 Ga0265342_10008171
494 Ga0307516_10182455
495 Ga0307413_10000173
496 Ga0307413_10161081
497 Ga0307413_10374448
498 Ga0307413_10443344
499 Ga0307409_100147563
500 Ga0307409_100405206
501 Ga0307409_100668892
502 Ga0307416_100036475
503 Ga0307414_10029905
504 Ga0307414_10388107
505 Ga0307414_10716803
506 Ga0307411_10078046
507 Ga0307411_10566208
508 Ga0307415_100020830
509 Ga0307415_100441349
510 Ga0373937_1787211
511 Ga0395900_0147585
512 Ga0436364_0161756
513 Ga0436364_0739477
514 Ga0436365_0217155
515 Ga0436360_0103678
516 Ga0439466_0025230
517 Ga0451793_0682662
518 Ga0451839_0928442
519 Ga0439462_0050304
520 Ga0466972_0386054
521 Ga0466965_0162827
522 Ga0466963_0287022
523 Ga0466971_0028480
524 Ga0466959_0336639
525 Ga0466967_0256443
526 Ga0466967_0288832
527 Ga0466967_0394931
528 Ga0495592_0103451
529 Ga0495638_0120022
530 Ga0495639_0084305
531 Ga0495662_0178866
532 Ga0495594_0036986
533 Ga0495607_0001982
534 Ga0495606_0001837
535 Ga0495652_0364828
536 Ga0495665_0008209
537 Ga0495640_0195483
538 Ga0495635_0720064
539 Ga0495599_0128409
540 Ga0495623_0212263
541 Ga0495658_0029477
542 Ga0495581_0047018
543 Ga0495676_0064320
544 Ga0495675_0044059
545 Ga0495686_0127364
546 Ga0495593_0026264
547 Ga0496100_0001099
548 Ga0496101_0007760
549 Ga0496101_0258020
550 Ga0496101_0472083
551 Ga0496105_0191001
552 Ga0496108_0017658
553 Ga0496108_0394975
554 Ga0496109_0005414
555 Ga0496109_0182585
556 Ga0496110_0217593
557 Ga0496110_0509713
558 Ga0496112_0006682
559 Ga0496112_0148610
560 Ga0496113_0799296
561 Ga0496115_0310296
562 Ga0496118_0000029
563 Ga0496123_0051120
564 Ga0496123_0109774
565 Ga0496126_0210024
566 Ga0501033_0020077
567 Ga0501033_0720311
568 Ga0501034_0188595
569 Ga0501036_0011003
570 Ga0501036_0077752
571 Ga0501037_0102809
572 Ga0501038_0021898
573 Ga0501039_0010561
574 Ga0501040_0023307
575 Ga0501041_0000885
576 Ga0501043_0019287
577 Ga0501046_0009949
578 Ga0501047_0088855
579 Ga0501048_0012686
580 Ga0501069_0008915
581 Ga0501069_0016889
582 Ga0501069_0203303
583 Ga0501069_0746000
584 Ga0501070_0000053
585 Ga0501070_0005185
586 Ga0501070_0008974
587 Ga0501070_0023425
588 Ga0501070_0071843
589 Ga0501071_0003094
590 Ga0501072_0002474
591 Ga0501073_0046701
592 Ga0501074_0000954
593 Ga0501074_0002371
594 Ga0501074_0012980
595 Ga0501074_0192857
596 Ga0501075_0022319
597 Ga0501076_0008428
598 Ga0501077_0005564
599 Ga0501245_002620
600 Ga0501079_0002420
601 Ga0501079_0401233
602 Ga0501080_0000938
603 Ga0501080_0022063
604 Ga0501081_0000963
605 Ga0501083_0058838
606 Ga0501083_1009201
607 Ga0501035_0000542
608 Ga0501035_0014357
609 Ga0501035_0037250
610 Ga0501044_0000153
611 Ga0501044_0011030
612 Ga0501044_0078175
613 Ga0501044_0432811
614 Ga0501045_0001596
615 nmdc:mga03683_120911_c1
616 nmdc:mga03683_21150_c1
617 nmdc:mga03n38_1243_c1
618 nmdc:mga03n38_228677_c1
619 nmdc:mga03n38_452947_c1
620 nmdc:mga03n38_60120_c1
621 nmdc:mga03n38_8666_c1
622 nmdc:mga00v17_105404_c1
623 nmdc:mga00v17_12583_c1
624 nmdc:mga00v17_2314_c1
625 nmdc:mga00v17_245637_c1
626 nmdc:mga00v17_8297_c1
627 nmdc:mga0yw44_113_c1
628 nmdc:mga0yw44_133404_c1
629 nmdc:mga0yw44_60899_c1
630 nmdc:mga06z11_130926_c1
631 nmdc:mga06z11_4390_c1
632 nmdc:mga06z11_51272_c1
633 nmdc:mga06z11_98483_c1
634 nmdc:mga04h51_324320_c1
635 nmdc:mga07m45_138757_c1
636 nmdc:mga07m45_63267_c2
637 nmdc:mga07m45_74043_c1
638 nmdc:mga07m45_8329_c1
639 nmdc:mga05p37_236577_c1
640 nmdc:mga0qj67_1156493_c1
641 nmdc:mga0sz30_1760_c1
642 nmdc:mga0sz30_27854_c1
643 nmdc:mga0sz30_32773_c1
644 Ga0495601_0505753
645 Ga0495655_0014360
646 Ga0495655_0061877
647 Ga0495655_0078113
648 Ga0500651_0158230
649 Ga0500592_051378
650 Ga0500593_074453
651 Ga0500658_0363630
652 Ga0500559_0011160
653 Ga0500568_0056162
654 Ga0501084_0015756
655 Ga0587069_074195
656 Ga0501082_0008211
657 Ga0530510_0009630
658 2513888152
659 2738708032
660 2739334281
661 2842694200
662 2857576923
663 2902802433
664 2919405534
665 2935770718
666 2935786996
667 2935795044
668 2935961037
669 2939583081
670 8016523452
671 8016536956
672 8016541222
673 8016552033
674 8016560409
675 8016566611
676 8016579355
677 8019536656
678 8019547942
679 8054473890
680 8056830856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

6

156

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lwl-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55a from clostridium oremlandii 0.9464 2 143
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9436 2 165
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9406 4 166
4lwm-assembly1.cif.gz_A crystal structure of methionine sulfoxide reductase u16c/e55d from clostridium oremlandii with methionie sulfoxide 0.9314 2 145
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9295 4 166
ID Description Score Start End Superfamily
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9404 1 165 3.30.1060.10
af_P0A086_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9312 1 148 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9295 1 165 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9254 4 146 3.30.1060.10
af_O02089_1_199_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9248 2 149 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A524GBY9-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9554 2 137 GO:0008113
GO:0033744
AF-A0A1G8TXS4-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9541 2 134 GO:0008113
GO:0033744
GO:0036211
AF-K4QSG8-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9532 11 141 GO:0008113
GO:0033744
GO:0036211
AF-O69761-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9506 2 158 GO:0008113
GO:0033744
GO:0036211
AF-A0A2A4U721-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9503 2 162 GO:0008113
GO:0033744
GO:0036211

Map