F414384

General Info

Members Datasets Scaffolds Average Seq Length
340 193 680 194

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10010164|Ga0265760_100101642
Length 225
Sequence VEVLRVRHYSESFGQKRCDDSRSTVGRGRCLAMNPWIAKALVLAGTLVMIAIRAPHGQQSRTAKVATSYKTPLETGLLVLAWVGFLVPLLWVASPAFSFAEYGLGAGSLFAGVMCLAIGLWLFYRSHADLGTNWSITLEVREQHRLITQGVYRRIRRPMYLALALYSIGQALVIPNWVAGPSNLVAFAILCALRVRAEEKMMVKEFGDEYAAYSARTKRLIPGVW

Samples

Sample ID Description Type Environment
1 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
124 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
125 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
130 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
131 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
134 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
140 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
153 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
154 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
160 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
161 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
165 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
175 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
193 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.65
Rhizosphere 97.06
Stem 0
Stem Tuber 0
Unclassified 32.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265760_10010164 3300031090 Bacteria 2684
2 Ga0065712_10004815 3300005290 Bacteria 3303
3 Ga0065715_10115317 3300005293 Bacteria 2419
4 Ga0065715_10195961 3300005293 Unclassified 1379
5 Ga0065707_10177800 3300005295 Unclassified 1438
6 Ga0065707_10277912 3300005295 Unclassified 1055
7 Ga0070676_10028077 3300005328 Bacteria 3195
8 Ga0070690_100557627 3300005330 Unclassified 864
9 Ga0070690_100744012 3300005330 Unclassified 756
10 Ga0070670_100037488 3300005331 Bacteria 4172
11 Ga0070670_100042712 3300005331 Bacteria 3898
12 Ga0070677_10000863 3300005333 Bacteria 9988
13 Ga0068869_100417256 3300005334 Bacteria 1107
14 Ga0070689_100649018 3300005340 Unclassified 918
15 Ga0070691_10000329 3300005341 Bacteria 16785
16 Ga0070661_100388251 3300005344 Bacteria 1102
17 Ga0070692_10530189 3300005345 Unclassified 768
18 Ga0070668_100013477 3300005347 Bacteria 6103
19 Ga0070668_100213077 3300005347 Unclassified 1590
20 Ga0070668_101049643 3300005347 Unclassified 734
21 Ga0070669_100016272 3300005353 Bacteria 5305
22 Ga0070669_100112143 3300005353 Unclassified 2071
23 Ga0070669_100222531 3300005353 Unclassified 1493
24 Ga0070669_100611159 3300005353 Unclassified 914
25 Ga0070675_100088416 3300005354 Unclassified 2592
26 Ga0070674_100000584 3300005356 Bacteria 18432
27 Ga0070674_100505253 3300005356 Bacteria 1007
28 Ga0070703_10165339 3300005406 Unclassified 843
29 Ga0070709_10031954 3300005434 Bacteria 3171
30 Ga0070709_10732017 3300005434 Bacteria 772
31 Ga0070701_10042910 3300005438 Bacteria 2311
32 Ga0070701_10351486 3300005438 Unclassified 921
33 Ga0070701_10578180 3300005438 Unclassified 741
34 Ga0070705_100054035 3300005440 Bacteria 2354
35 Ga0070705_100125719 3300005440 Unclassified 1664
36 Ga0070705_100214558 3300005440 Bacteria 1329
37 Ga0070700_100023670 3300005441 Bacteria 3594
38 Ga0070694_100013687 3300005444 Bacteria 5069
39 Ga0070678_100012862 3300005456 Bacteria 5221
40 Ga0070678_100485564 3300005456 Bacteria 1088
41 Ga0070662_100183099 3300005457 Unclassified 1653
42 Ga0068867_100034469 3300005459 Bacteria 3668
43 Ga0068867_100114198 3300005459 Bacteria 2079
44 Ga0068867_100343315 3300005459 Bacteria 1244
45 Ga0070706_100238320 3300005467 Unclassified 1698
46 Ga0070707_100135497 3300005468 Bacteria 2396
47 Ga0070698_100540225 3300005471 Bacteria 1105
48 Ga0070699_100059171 3300005518 Unclassified 3320
49 Ga0070699_100278638 3300005518 Unclassified 1497
50 Ga0070699_100422608 3300005518 Bacteria 1206
51 Ga0070699_100425955 3300005518 Unclassified 1202
52 Ga0070684_100093330 3300005535 Bacteria 2679
53 Ga0070697_100214126 3300005536 Unclassified 1641
54 Ga0068853_100692167 3300005539 Bacteria 972
55 Ga0070672_100392698 3300005543 Bacteria 1188
56 Ga0070686_100364848 3300005544 Unclassified 1089
57 Ga0070686_100498379 3300005544 Bacteria 945
58 Ga0070695_100005267 3300005545 Bacteria 7613
59 Ga0070695_100005467 3300005545 Bacteria 7478
60 Ga0070696_100003174 3300005546 Bacteria 10946
61 Ga0070696_100144227 3300005546 Unclassified 1743
62 Ga0070665_100570830 3300005548 Bacteria 1144
63 Ga0070665_101231743 3300005548 Unclassified 759
64 Ga0070704_100033822 3300005549 Bacteria 3460
65 Ga0070704_100907295 3300005549 Bacteria 793
66 Ga0070664_100005812 3300005564 Bacteria 9950
67 Ga0070664_101260846 3300005564 Bacteria 698
68 Ga0068857_100045676 3300005577 Bacteria 3886
69 Ga0070702_100002195 3300005615 Bacteria 8316
70 Ga0070702_100294842 3300005615 Unclassified 1119
71 Ga0068852_101310106 3300005616 Unclassified 746
72 Ga0068859_100710122 3300005617 Bacteria 1096
73 Ga0068859_100918359 3300005617 Unclassified 960
74 Ga0068864_100026897 3300005618 Bacteria 4852
75 Ga0068864_100483567 3300005618 Unclassified 1189
76 Ga0068861_100000857 3300005719 Bacteria 18411
77 Ga0068861_100111107 3300005719 Bacteria 2196
78 Ga0068861_100288358 3300005719 Bacteria 1416
79 Ga0068861_100625070 3300005719 Unclassified 991
80 Ga0068861_100951989 3300005719 Unclassified 817
81 Ga0068863_100013274 3300005841 Bacteria 7948
82 Ga0068863_100045780 3300005841 Unclassified 4153
83 Ga0068863_100696674 3300005841 Bacteria 1009
84 Ga0068863_101826973 3300005841 Unclassified 617
85 Ga0068858_100019149 3300005842 Bacteria 6403
86 Ga0068858_100180146 3300005842 Bacteria 1995
87 Ga0068858_100700433 3300005842 Unclassified 986
88 Ga0068860_100550744 3300005843 Bacteria 1156
89 Ga0068862_100007130 3300005844 Bacteria 9282
90 Ga0068862_100016428 3300005844 Bacteria 6159
91 Ga0068862_100067473 3300005844 Bacteria 3083
92 Ga0070717_10775473 3300006028 Unclassified 872
93 Ga0075432_10100422 3300006058 Unclassified 1069
94 Ga0070716_101060201 3300006173 Unclassified 644
95 Ga0097621_100074388 3300006237 Bacteria 2814
96 Ga0068871_100995392 3300006358 Unclassified 780
97 Ga0075428_100013696 3300006844 Bacteria 9029
98 Ga0075428_100016288 3300006844 Bacteria 8216
99 Ga0075428_100032336 3300006844 Bacteria 5778
100 Ga0075428_100033926 3300006844 Bacteria 5630
101 Ga0075428_100040381 3300006844 Bacteria 5134
102 Ga0075428_100258174 3300006844 Bacteria 1877
103 Ga0075428_100416681 3300006844 Bacteria 1439
104 Ga0075428_100485763 3300006844 Bacteria 1322
105 Ga0075428_100577108 3300006844 Bacteria 1202
106 Ga0075430_100004414 3300006846 Bacteria 11876
107 Ga0075430_100123658 3300006846 Unclassified 2156
108 Ga0075430_100454757 3300006846 Unclassified 1057
109 Ga0075431_100034586 3300006847 Bacteria 5206
110 Ga0075431_100095181 3300006847 Bacteria 3074
111 Ga0075431_100180654 3300006847 Bacteria 2165
112 Ga0075431_100323120 3300006847 Bacteria 1556
113 Ga0075433_10627675 3300006852 Unclassified 943
114 Ga0075433_10644932 3300006852 Bacteria 929
115 Ga0075433_10667918 3300006852 Unclassified 911
116 Ga0075433_10687154 3300006852 Unclassified 897
117 Ga0075434_100018673 3300006871 Bacteria 6700
118 Ga0075434_100056276 3300006871 Bacteria 3908
119 Ga0075434_100176084 3300006871 Bacteria 2159
120 Ga0075429_100048097 3300006880 Bacteria 3709
121 Ga0075429_100960084 3300006880 Unclassified 747
122 Ga0075429_101090050 3300006880 Unclassified 697
123 Ga0068865_100312907 3300006881 Bacteria 1261
124 Ga0075436_100534487 3300006914 Unclassified 860
125 Ga0097620_100710092 3300006931 Bacteria 1096
126 Ga0097620_100918404 3300006931 Unclassified 960
127 Ga0075435_100012425 3300007076 Bacteria 6305
128 Ga0075435_100802218 3300007076 Unclassified 820
129 Ga0075435_100969613 3300007076 Bacteria 742
130 Ga0111539_10003927 3300009094 Bacteria 19542
131 Ga0111539_10071371 3300009094 Bacteria 4097
132 Ga0111539_10071740 3300009094 Bacteria 4086
133 Ga0111539_10117942 3300009094 Bacteria 3111
134 Ga0111539_10336899 3300009094 Bacteria 1756
135 Ga0111539_10370901 3300009094 Bacteria 1666
136 Ga0111539_10878261 3300009094 Bacteria 1043
137 Ga0111539_11295414 3300009094 Bacteria 846
138 Ga0105245_10689524 3300009098 Bacteria 1054
139 Ga0105247_10010240 3300009101 Bacteria 5675
140 Ga0114129_10016424 3300009147 Bacteria 10535
141 Ga0114129_10023709 3300009147 Bacteria 8699
142 Ga0114129_10295056 3300009147 Unclassified 2162
143 Ga0114129_10302051 3300009147 Bacteria 2133
144 Ga0114129_10455806 3300009147 Unclassified 1676
145 Ga0105243_10041053 3300009148 Bacteria 3617
146 Ga0105243_10141146 3300009148 Bacteria 2055
147 Ga0105243_10400812 3300009148 Bacteria 1274
148 Ga0105241_10245183 3300009174 Bacteria 1516
149 Ga0105241_10266050 3300009174 Bacteria 1459
150 Ga0105242_10423192 3300009176 Bacteria 1248
151 Ga0105242_10939515 3300009176 Unclassified 868
152 Ga0105248_10006048 3300009177 Bacteria 13280
153 Ga0105249_10151393 3300009553 Bacteria 2234
154 Ga0105249_10261619 3300009553 Bacteria 1719
155 Ga0105249_10300577 3300009553 Bacteria 1609
156 Ga0105249_10453614 3300009553 Bacteria 1321
157 Ga0105246_10043680 3300011119 Bacteria 3042
158 Ga0105246_11327263 3300011119 Unclassified 668
159 Ga0157369_10886058 3300013105 Unclassified 915
160 Ga0157374_10024494 3300013296 Bacteria 5412
161 Ga0157378_10376185 3300013297 Bacteria 1394
162 Ga0157372_10181098 3300013307 Bacteria 2439
163 Ga0157375_10074884 3300013308 Bacteria 3408
164 Ga0163163_10035542 3300014325 Bacteria 4834
165 Ga0163163_10040464 3300014325 Bacteria 4551
166 Ga0163163_10078892 3300014325 Bacteria 3290
167 Ga0163163_10387170 3300014325 Bacteria 1456
168 Ga0163163_11454370 3300014325 Unclassified 747
169 Ga0157380_10014411 3300014326 Bacteria 5783
170 Ga0157380_10295011 3300014326 Bacteria 1490
171 Ga0157380_10392465 3300014326 Bacteria 1314
172 Ga0157377_10228909 3300014745 Unclassified 1194
173 Ga0157379_10049613 3300014968 Bacteria 3749
174 Ga0157379_11151595 3300014968 Unclassified 744
175 Ga0163161_11203608 3300017792 Bacteria 655
176 Ga0207682_10006675 3300025893 Bacteria 4636
177 Ga0207692_10319803 3300025898 Bacteria 949
178 Ga0207642_10009914 3300025899 Bacteria 3334
179 Ga0207710_10003339 3300025900 Bacteria 7170
180 Ga0207710_10277848 3300025900 Unclassified 842
181 Ga0207688_10190390 3300025901 Unclassified 1227
182 Ga0207699_10033652 3300025906 Unclassified 2899
183 Ga0207645_10050054 3300025907 Bacteria 2668
184 Ga0207645_10204801 3300025907 Bacteria 1298
185 Ga0207684_10646415 3300025910 Bacteria 901
186 Ga0207671_10032867 3300025914 Bacteria 3861
187 Ga0207662_10152199 3300025918 Bacteria 1472
188 Ga0207649_10598846 3300025920 Bacteria 847
189 Ga0207646_10231424 3300025922 Unclassified 1670
190 Ga0207681_10020351 3300025923 Bacteria 4203
191 Ga0207681_10036789 3300025923 Bacteria 3232
192 Ga0207681_10099626 3300025923 Bacteria 2093
193 Ga0207650_10030216 3300025925 Bacteria 3901
194 Ga0207659_10024712 3300025926 Unclassified 4030
195 Ga0207706_10070082 3300025933 Bacteria 3083
196 Ga0207670_10751655 3300025936 Bacteria 810
197 Ga0207669_10523374 3300025937 Bacteria 952
198 Ga0207669_10774935 3300025937 Bacteria 794
199 Ga0207704_10340648 3300025938 Bacteria 1164
200 Ga0207665_10319218 3300025939 Bacteria 1165
201 Ga0207691_10450529 3300025940 Bacteria 1095
202 Ga0207691_11135374 3300025940 Unclassified 649
203 Ga0207711_10020579 3300025941 Bacteria 5505
204 Ga0207679_10024900 3300025945 Unclassified 4109
205 Ga0207712_10030841 3300025961 Bacteria 3607
206 Ga0207712_10552281 3300025961 Bacteria 991
207 Ga0207668_10243257 3300025972 Unclassified 1457
208 Ga0207658_10528265 3300025986 Bacteria 1054
209 Ga0207703_10105426 3300026035 Bacteria 2396
210 Ga0207703_10188166 3300026035 Bacteria 1826
211 Ga0207708_10004708 3300026075 Bacteria 10034
212 Ga0207708_10033656 3300026075 Unclassified 3895
213 Ga0207708_10137508 3300026075 Bacteria 1914
214 Ga0207708_10232404 3300026075 Unclassified 1481
215 Ga0207641_10020736 3300026088 Bacteria 5401
216 Ga0207641_10037027 3300026088 Unclassified 4073
217 Ga0207641_10043569 3300026088 Unclassified 3770
218 Ga0207641_10097763 3300026088 Bacteria 2581
219 Ga0207648_10006984 3300026089 Bacteria 11167
220 Ga0207648_10181745 3300026089 Bacteria 1862
221 Ga0207676_10026327 3300026095 Bacteria 4326
222 Ga0207676_10106254 3300026095 Bacteria 2339
223 Ga0207674_10008477 3300026116 Bacteria 11870
224 Ga0207675_100001111 3300026118 Bacteria 26632
225 Ga0207675_100014817 3300026118 Bacteria 7275
226 Ga0207675_100202875 3300026118 Unclassified 1905
227 Ga0207675_100725419 3300026118 Bacteria 1004
228 Ga0207683_10063118 3300026121 Bacteria 3263
229 Ga0207428_10044619 3300027907 Bacteria 3576
230 Ga0207428_10092419 3300027907 Bacteria 2348
231 Ga0207428_10292854 3300027907 Bacteria 1206
232 Ga0268265_10031633 3300028380 Bacteria 3823
233 Ga0268265_10055887 3300028380 Bacteria 3001
234 Ga0268265_10326823 3300028380 Bacteria 1391
235 Ga0268264_10462818 3300028381 Bacteria 1231
236 Ga0265334_10013992 3300028573 Bacteria 3350
237 Ga0265760_10053529 3300031090 Unclassified 1218
238 Ga0265760_10071552 3300031090 Unclassified 1064
239 Ga0373958_0023171 3300034819 Bacteria 1166
240 Ga0373959_0019384 3300034820 Unclassified 1288
241 Ga0373928_0006113 3300035084 Bacteria 2310
242 Ga0373934_0110909 3300035086 Bacteria 1113
243 Ga0373940_0004468 3300035088 Bacteria 2957
244 Ga0373949_0001434 3300035090 Bacteria 6818
245 Ga0373951_0021592 3300035091 Bacteria 1479
246 Ga0373952_0001053 3300035092 Bacteria 5036
247 Ga0373932_0000885 3300035112 Bacteria 8772
248 Ga0373939_0000945 3300035114 Bacteria 7236
249 Ga0373939_0086933 3300035114 Bacteria 1050
250 Ga0373941_0011060 3300035115 Bacteria 2324
251 Ga0373941_0055958 3300035115 Bacteria 1269
252 Ga0373945_0225402 3300035116 Bacteria 785
253 Ga0373956_0228417 3300035119 Unclassified 884
254 Ga0373960_0022846 3300035121 Bacteria 1679
255 Ga0373960_0048731 3300035121 Unclassified 1251
256 Ga0373943_0101444 3300035170 Unclassified 1506
257 Ga0373946_0107043 3300035171 Bacteria 1261
258 Ga0373961_0002759 3300035241 Bacteria 4481
259 Ga0373962_0193652 3300035242 Unclassified 685
260 Ga0373935_0385296 3300035692 Unclassified 1004
261 Ga0373935_0561005 3300035692 Unclassified 833
262 Ga0373947_0142802 3300035725 Unclassified 1537
263 Ga0373947_0737360 3300035725 Bacteria 672
264 Ga0373925_0042353 3300037068 Unclassified 3378
265 Ga0373925_0243167 3300037068 Unclassified 1442
266 Ga0373925_0303611 3300037068 Bacteria 1289
267 Ga0436365_0630442 3300039437 Unclassified 988
268 Ga0439460_0052258 3300042461 Bacteria 1228
269 Ga0453683_0014810 3300044673 Bacteria 5061
270 Ga0451576_0018126 3300045051 Bacteria 7724
271 Ga0451576_0046644 3300045051 Bacteria 4562
272 Ga0451576_0100841 3300045051 Bacteria 3002
273 Ga0495592_0109838 3300046454 Unclassified 1953
274 Ga0495603_0303675 3300046455 Unclassified 917
275 Ga0495629_0151998 3300046459 Unclassified 1609
276 Ga0495629_0244344 3300046459 Bacteria 1236
277 Ga0495580_0013605 3300046472 Bacteria 6205
278 Ga0495580_0037024 3300046472 Unclassified 3503
279 Ga0495580_0677482 3300046472 Unclassified 676
280 Ga0495639_0510788 3300046475 Unclassified 614
281 Ga0495662_0155185 3300046476 Bacteria 1128
282 Ga0495608_0447097 3300046511 Unclassified 787
283 Ga0495628_0137170 3300046516 Bacteria 1869
284 Ga0495666_0112026 3300046526 Bacteria 1281
285 Ga0495666_0228431 3300046526 Bacteria 851
286 Ga0495642_0346299 3300046528 Unclassified 653
287 Ga0495652_0358341 3300046529 Bacteria 1043
288 Ga0495587_0002762 3300046536 Bacteria 11718
289 Ga0495645_0005393 3300046543 Bacteria 8769
290 Ga0495667_0050763 3300046559 Unclassified 2738
291 Ga0495634_0426496 3300046642 Bacteria 785
292 Ga0495635_0110016 3300046663 Bacteria 1882
293 Ga0495623_0324175 3300046679 Unclassified 845
294 Ga0495647_0019028 3300046681 Unclassified 2452
295 Ga0495658_0065160 3300046683 Unclassified 2101
296 Ga0495613_0242497 3300046689 Bacteria 1260
297 Ga0495636_0021246 3300047318 Bacteria 2621
298 Ga0495636_0135670 3300047318 Unclassified 1096
299 Ga0495636_0218484 3300047318 Unclassified 874
300 Ga0495680_0456515 3300047322 Unclassified 874
301 Ga0495684_0413519 3300047471 Unclassified 944
302 Ga0496103_0633911 3300048906 Unclassified 680
303 Ga0496104_0023613 3300048907 Bacteria 5655
304 Ga0496108_0007760 3300048911 Bacteria 8693
305 Ga0496110_0482823 3300048913 Bacteria 1129
306 Ga0496111_0093282 3300048914 Unclassified 2207
307 Ga0496111_0699093 3300048914 Bacteria 738
308 Ga0496112_0002380 3300048915 Bacteria 15122
309 Ga0496114_0838553 3300048917 Unclassified 799
310 Ga0496115_0307761 3300048918 Unclassified 1298
311 Ga0501041_0436233 3300049577 Unclassified 831
312 Ga0501068_0005797 3300049584 Bacteria 6776
313 Ga0501081_0026714 3300049743 Bacteria 3895
314 nmdc:mga05p37_133219_c1 3300050507 Bacteria 3049
315 nmdc:mga05p37_265398_c1 3300050507 Unclassified 2053
316 nmdc:mga05p37_56374_c1 3300050507 Bacteria 4838
317 nmdc:mga05p37_740_c1 3300050507 Bacteria 36197
318 nmdc:mga05p37_81654_c2 3300050507 Unclassified 1086
319 nmdc:mga05p37_95467_c1 3300050507 Bacteria 3663
320 nmdc:mga09592_28713_c1 3300050508 Bacteria 4623
321 nmdc:mga09592_44463_c1 3300050508 Bacteria 3739
322 nmdc:mga0qj67_6594_c1 3300050509 Bacteria 8530
323 nmdc:mga0qj67_761616_c1 3300050509 Unclassified 768
324 nmdc:mga06r32_111571_c1 3300050510 Bacteria 2691
325 nmdc:mga06r32_195676_c1 3300050510 Bacteria 2009
326 nmdc:mga08y16_364252_c1 3300050511 Bacteria 1484
327 nmdc:mga08y16_520_c1 3300050511 Bacteria 35521
328 nmdc:mga08y16_6106_c1 3300050511 Bacteria 12635
329 nmdc:mga08y16_800015_c1 3300050511 Bacteria 936
330 nmdc:mga08y16_88234_c1 3300050511 Bacteria 3232
331 nmdc:mga0n895_138453_c1 3300050512 Bacteria 2461
332 nmdc:mga0n895_16771_c1 3300050512 Bacteria 6731
333 nmdc:mga0n895_2851_c1 3300050512 Bacteria 13697
334 nmdc:mga0rr50_8022_c1 3300050513 Bacteria 6549
335 nmdc:mga0rr50_835095_c1 3300050513 Bacteria 786
336 nmdc:mga08x19_84429_c1 3300050514 Bacteria 2089
337 nmdc:mga0a205_123426_c1 3300050515 Unclassified 2490
338 nmdc:mga0a205_124541_c1 3300050515 Unclassified 2477
339 Ga0495619_0347190 3300053085 Unclassified 1027
340 Ga0501084_0425563 3300054114 Unclassified 1122
341 Ga0265760_10010164
342 Ga0065712_10004815
343 Ga0065715_10115317
344 Ga0065715_10195961
345 Ga0065707_10177800
346 Ga0065707_10277912
347 Ga0070676_10028077
348 Ga0070690_100557627
349 Ga0070690_100744012
350 Ga0070670_100037488
351 Ga0070670_100042712
352 Ga0070677_10000863
353 Ga0068869_100417256
354 Ga0070689_100649018
355 Ga0070691_10000329
356 Ga0070661_100388251
357 Ga0070692_10530189
358 Ga0070668_100013477
359 Ga0070668_100213077
360 Ga0070668_101049643
361 Ga0070669_100016272
362 Ga0070669_100112143
363 Ga0070669_100222531
364 Ga0070669_100611159
365 Ga0070675_100088416
366 Ga0070674_100000584
367 Ga0070674_100505253
368 Ga0070703_10165339
369 Ga0070709_10031954
370 Ga0070709_10732017
371 Ga0070701_10042910
372 Ga0070701_10351486
373 Ga0070701_10578180
374 Ga0070705_100054035
375 Ga0070705_100125719
376 Ga0070705_100214558
377 Ga0070700_100023670
378 Ga0070694_100013687
379 Ga0070678_100012862
380 Ga0070678_100485564
381 Ga0070662_100183099
382 Ga0068867_100034469
383 Ga0068867_100114198
384 Ga0068867_100343315
385 Ga0070706_100238320
386 Ga0070707_100135497
387 Ga0070698_100540225
388 Ga0070699_100059171
389 Ga0070699_100278638
390 Ga0070699_100422608
391 Ga0070699_100425955
392 Ga0070684_100093330
393 Ga0070697_100214126
394 Ga0068853_100692167
395 Ga0070672_100392698
396 Ga0070686_100364848
397 Ga0070686_100498379
398 Ga0070695_100005267
399 Ga0070695_100005467
400 Ga0070696_100003174
401 Ga0070696_100144227
402 Ga0070665_100570830
403 Ga0070665_101231743
404 Ga0070704_100033822
405 Ga0070704_100907295
406 Ga0070664_100005812
407 Ga0070664_101260846
408 Ga0068857_100045676
409 Ga0070702_100002195
410 Ga0070702_100294842
411 Ga0068852_101310106
412 Ga0068859_100710122
413 Ga0068859_100918359
414 Ga0068864_100026897
415 Ga0068864_100483567
416 Ga0068861_100000857
417 Ga0068861_100111107
418 Ga0068861_100288358
419 Ga0068861_100625070
420 Ga0068861_100951989
421 Ga0068863_100013274
422 Ga0068863_100045780
423 Ga0068863_100696674
424 Ga0068863_101826973
425 Ga0068858_100019149
426 Ga0068858_100180146
427 Ga0068858_100700433
428 Ga0068860_100550744
429 Ga0068862_100007130
430 Ga0068862_100016428
431 Ga0068862_100067473
432 Ga0070717_10775473
433 Ga0075432_10100422
434 Ga0070716_101060201
435 Ga0097621_100074388
436 Ga0068871_100995392
437 Ga0075428_100013696
438 Ga0075428_100016288
439 Ga0075428_100032336
440 Ga0075428_100033926
441 Ga0075428_100040381
442 Ga0075428_100258174
443 Ga0075428_100416681
444 Ga0075428_100485763
445 Ga0075428_100577108
446 Ga0075430_100004414
447 Ga0075430_100123658
448 Ga0075430_100454757
449 Ga0075431_100034586
450 Ga0075431_100095181
451 Ga0075431_100180654
452 Ga0075431_100323120
453 Ga0075433_10627675
454 Ga0075433_10644932
455 Ga0075433_10667918
456 Ga0075433_10687154
457 Ga0075434_100018673
458 Ga0075434_100056276
459 Ga0075434_100176084
460 Ga0075429_100048097
461 Ga0075429_100960084
462 Ga0075429_101090050
463 Ga0068865_100312907
464 Ga0075436_100534487
465 Ga0097620_100710092
466 Ga0097620_100918404
467 Ga0075435_100012425
468 Ga0075435_100802218
469 Ga0075435_100969613
470 Ga0111539_10003927
471 Ga0111539_10071371
472 Ga0111539_10071740
473 Ga0111539_10117942
474 Ga0111539_10336899
475 Ga0111539_10370901
476 Ga0111539_10878261
477 Ga0111539_11295414
478 Ga0105245_10689524
479 Ga0105247_10010240
480 Ga0114129_10016424
481 Ga0114129_10023709
482 Ga0114129_10295056
483 Ga0114129_10302051
484 Ga0114129_10455806
485 Ga0105243_10041053
486 Ga0105243_10141146
487 Ga0105243_10400812
488 Ga0105241_10245183
489 Ga0105241_10266050
490 Ga0105242_10423192
491 Ga0105242_10939515
492 Ga0105248_10006048
493 Ga0105249_10151393
494 Ga0105249_10261619
495 Ga0105249_10300577
496 Ga0105249_10453614
497 Ga0105246_10043680
498 Ga0105246_11327263
499 Ga0157369_10886058
500 Ga0157374_10024494
501 Ga0157378_10376185
502 Ga0157372_10181098
503 Ga0157375_10074884
504 Ga0163163_10035542
505 Ga0163163_10040464
506 Ga0163163_10078892
507 Ga0163163_10387170
508 Ga0163163_11454370
509 Ga0157380_10014411
510 Ga0157380_10295011
511 Ga0157380_10392465
512 Ga0157377_10228909
513 Ga0157379_10049613
514 Ga0157379_11151595
515 Ga0163161_11203608
516 Ga0207682_10006675
517 Ga0207692_10319803
518 Ga0207642_10009914
519 Ga0207710_10003339
520 Ga0207710_10277848
521 Ga0207688_10190390
522 Ga0207699_10033652
523 Ga0207645_10050054
524 Ga0207645_10204801
525 Ga0207684_10646415
526 Ga0207671_10032867
527 Ga0207662_10152199
528 Ga0207649_10598846
529 Ga0207646_10231424
530 Ga0207681_10020351
531 Ga0207681_10036789
532 Ga0207681_10099626
533 Ga0207650_10030216
534 Ga0207659_10024712
535 Ga0207706_10070082
536 Ga0207670_10751655
537 Ga0207669_10523374
538 Ga0207669_10774935
539 Ga0207704_10340648
540 Ga0207665_10319218
541 Ga0207691_10450529
542 Ga0207691_11135374
543 Ga0207711_10020579
544 Ga0207679_10024900
545 Ga0207712_10030841
546 Ga0207712_10552281
547 Ga0207668_10243257
548 Ga0207658_10528265
549 Ga0207703_10105426
550 Ga0207703_10188166
551 Ga0207708_10004708
552 Ga0207708_10033656
553 Ga0207708_10137508
554 Ga0207708_10232404
555 Ga0207641_10020736
556 Ga0207641_10037027
557 Ga0207641_10043569
558 Ga0207641_10097763
559 Ga0207648_10006984
560 Ga0207648_10181745
561 Ga0207676_10026327
562 Ga0207676_10106254
563 Ga0207674_10008477
564 Ga0207675_100001111
565 Ga0207675_100014817
566 Ga0207675_100202875
567 Ga0207675_100725419
568 Ga0207683_10063118
569 Ga0207428_10044619
570 Ga0207428_10092419
571 Ga0207428_10292854
572 Ga0268265_10031633
573 Ga0268265_10055887
574 Ga0268265_10326823
575 Ga0268264_10462818
576 Ga0265334_10013992
577 Ga0265760_10053529
578 Ga0265760_10071552
579 Ga0373958_0023171
580 Ga0373959_0019384
581 Ga0373928_0006113
582 Ga0373934_0110909
583 Ga0373940_0004468
584 Ga0373949_0001434
585 Ga0373951_0021592
586 Ga0373952_0001053
587 Ga0373932_0000885
588 Ga0373939_0000945
589 Ga0373939_0086933
590 Ga0373941_0011060
591 Ga0373941_0055958
592 Ga0373945_0225402
593 Ga0373956_0228417
594 Ga0373960_0022846
595 Ga0373960_0048731
596 Ga0373943_0101444
597 Ga0373946_0107043
598 Ga0373961_0002759
599 Ga0373962_0193652
600 Ga0373935_0385296
601 Ga0373935_0561005
602 Ga0373947_0142802
603 Ga0373947_0737360
604 Ga0373925_0042353
605 Ga0373925_0243167
606 Ga0373925_0303611
607 Ga0436365_0630442
608 Ga0439460_0052258
609 Ga0453683_0014810
610 Ga0451576_0018126
611 Ga0451576_0046644
612 Ga0451576_0100841
613 Ga0495592_0109838
614 Ga0495603_0303675
615 Ga0495629_0151998
616 Ga0495629_0244344
617 Ga0495580_0013605
618 Ga0495580_0037024
619 Ga0495580_0677482
620 Ga0495639_0510788
621 Ga0495662_0155185
622 Ga0495608_0447097
623 Ga0495628_0137170
624 Ga0495666_0112026
625 Ga0495666_0228431
626 Ga0495642_0346299
627 Ga0495652_0358341
628 Ga0495587_0002762
629 Ga0495645_0005393
630 Ga0495667_0050763
631 Ga0495634_0426496
632 Ga0495635_0110016
633 Ga0495623_0324175
634 Ga0495647_0019028
635 Ga0495658_0065160
636 Ga0495613_0242497
637 Ga0495636_0021246
638 Ga0495636_0135670
639 Ga0495636_0218484
640 Ga0495680_0456515
641 Ga0495684_0413519
642 Ga0496103_0633911
643 Ga0496104_0023613
644 Ga0496108_0007760
645 Ga0496110_0482823
646 Ga0496111_0093282
647 Ga0496111_0699093
648 Ga0496112_0002380
649 Ga0496114_0838553
650 Ga0496115_0307761
651 Ga0501041_0436233
652 Ga0501068_0005797
653 Ga0501081_0026714
654 nmdc:mga05p37_133219_c1
655 nmdc:mga05p37_265398_c1
656 nmdc:mga05p37_56374_c1
657 nmdc:mga05p37_740_c1
658 nmdc:mga05p37_81654_c2
659 nmdc:mga05p37_95467_c1
660 nmdc:mga09592_28713_c1
661 nmdc:mga09592_44463_c1
662 nmdc:mga0qj67_6594_c1
663 nmdc:mga0qj67_761616_c1
664 nmdc:mga06r32_111571_c1
665 nmdc:mga06r32_195676_c1
666 nmdc:mga08y16_364252_c1
667 nmdc:mga08y16_520_c1
668 nmdc:mga08y16_6106_c1
669 nmdc:mga08y16_800015_c1
670 nmdc:mga08y16_88234_c1
671 nmdc:mga0n895_138453_c1
672 nmdc:mga0n895_16771_c1
673 nmdc:mga0n895_2851_c1
674 nmdc:mga0rr50_8022_c1
675 nmdc:mga0rr50_835095_c1
676 nmdc:mga08x19_84429_c1
677 nmdc:mga0a205_123426_c1
678 nmdc:mga0a205_124541_c1
679 Ga0495619_0347190
680 Ga0501084_0425563

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04191

PEMT

Phospholipid methyltransferase

108

209

0.95

PF04140

ICMT

Isoprenylcysteine carboxyl methyltransferase (ICMT) family

111

204

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.9515 1 185
4a2n-assembly1.cif.gz_B crystal structure of ma-icmt 0.9135 1 185
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.6761 35 192
5vg9-assembly1.cif.gz_A structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase) without a monobody 0.6689 34 192
5v7p-assembly1.cif.gz_A atomic structure of the eukaryotic intramembrane ras methyltransferase icmt (isoprenylcysteine carboxyl methyltransferase), in complex with a monobody 0.5409 35 192
ID Description Score Start End Superfamily
4a2nB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9515 1 185 1.20.120.1630
4a2nB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9135 1 185 1.20.120.1630
af_P71912_2_135_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7832 66 191 1.20.120.1630
af_Q2G1E3_21_189_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7426 2 170 1.20.120.1630
af_O06539_1_164_1.20.120.1630 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.7416 3 168 1.20.120.1630
ID Description Score Start End GO Terms
AF-A0A845GKP4-F1-model_v4 DUF1295 domain-containing protein 0.9769 5 184 GO:0004671
GO:0016020
AF-A0A8B2UEX9-F1-model_v4 deleted 0.9742 6 184
AF-A0A7C4J618-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9692 5 184 GO:0004671
GO:0016020
GO:0032259
AF-A0A3D6B8A2-F1-model_v4 Isoprenylcysteine carboxylmethyltransferase family protein 0.9683 1 184 GO:0004671
GO:0016020
GO:0032259
AF-A0A2S8H9I4-F1-model_v4 deleted 0.9666 6 190

Map