F414325

General Info

Members Datasets Scaffolds Average Seq Length
340 251 257 384

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10251253|Ga0105237_102512532
Length 373
Sequence MNMEPKFAGMEVGYDVPALPGMSVDDIQTPCLILDLDALERNIRKIGDYAKAHNMRHRAHGKMHKSVDVLRLQQELGGAVGVCCQKVSEAEVFVRGGIKDVLVSNQVRDPAKIDRLALLPQHGARIIVCVKYGTTLECFIEIDCGAGRCGVTTTSAVVELANAIHAAPGLKFTGIQAYQGAMQHIDKYEDRKAKLDAAIAQVKDAVDALKAEGLDPELVSGGGTGSYYFESNSGVYNELQCGSYAFMDADYGRIRDKEGKRIDQGEWENALFILTSIMSHAKPDKAICDAGLKAQSVDSGLPFIYGRDDVKYIKCSDEHGVIEDPSGVLKINEKLRLVPGHCDPTCNVHDWYVGVRNGKVETLWPVSARGKAY

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
3 2516143018 Ensifer sp. BR816 Isolate Nodule
4 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
5 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
6 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
7 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
8 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
9 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
10 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
11 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
12 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
13 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
14 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
15 2643221674 Devosia sp. Root436 Isolate Unclassified
16 2718217927 Rhizobium sp. N324 Isolate Nodule
17 2718218423 Rhizobium sp. N941 Isolate Nodule
18 2721755809 Rhizobium sp. N541 Isolate Nodule
19 2791355256 Rhizobium sp. M10 Isolate Nodule
20 2791355261 Rhizobium sp. J15 Isolate Nodule
21 2791355262 Rhizobium sp. M1 Isolate Nodule
22 2791355263 Rhizobium chutanense C5 Isolate Nodule
23 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
24 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
25 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified
26 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
27 2838061910 Rhizobium phaseoli L15 Isolate Nodule
28 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
29 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
30 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
31 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
32 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
33 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
34 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
35 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
36 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
37 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
38 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
39 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
40 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
41 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
42 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
43 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
44 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
45 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
46 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
47 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
48 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
49 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
50 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
51 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
52 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
53 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
54 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
55 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
56 2936381700 Rhizobium chutanense C16 Isolate Unclassified
57 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
58 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
59 2939611941 Rhodanobacter soli 1757 Isolate Rhizosphere
60 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
61 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
62 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
63 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
64 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
65 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
66 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
67 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
68 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
69 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
70 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
71 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
72 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
73 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
74 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
78 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
79 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
80 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
81 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
82 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
83 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
84 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
87 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
88 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
89 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
90 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
91 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
92 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
93 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
94 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
97 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
98 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
99 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
100 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
101 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
102 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
103 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
104 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
105 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
106 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
107 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
109 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
110 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
111 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
112 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
118 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
119 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
120 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
132 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
135 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
136 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
139 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
179 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
182 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
183 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
184 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
193 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
199 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
217 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
218 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
219 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
234 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
240 8005275841 Rhizobium sp. N4311 Isolate Nodule
241 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
242 8005382845 Rhizobium sp. R634 Isolate Nodule
243 8005395548 Rhizobium sp. R339 Isolate Nodule
244 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
245 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
246 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
247 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
248 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
249 8018176218 Rhizobium sp. N122 Isolate Nodule
250 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
251 8054563764 Acuticoccus kalidii M5D2P5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 75.29
Metatranscriptomes 0.29
Isolates 24.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.41
Nodule 16.76
Rhizoplane 6.76
Rhizosphere 55
Stem 0
Stem Tuber 0
Unclassified 12.06

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1009868 3300002705 Bacteria 2287
2 JGI25162J39368_1000115 3300002737 Bacteria 88006
3 JGI25157J39369_1000132 3300002741 Bacteria 62647
4 JGI25157J39369_1006217 3300002741 Bacteria 1845
5 JGI25164J39214_1000090 3300002772 Bacteria 90565
6 JGI25165J46597_1000194 3300003214 Bacteria 91012
7 rootL2_10019932 3300003322 Bacteria 10891
8 rootH1_10107881 3300003323 Bacteria 4945
9 Ga0055538_1002532 3300003751 Bacteria 2638
10 Ga0055535_1000106 3300003761 Bacteria 90565
11 Ga0055542_1000150 3300003762 Bacteria 88006
12 Ga0055529_1000168 3300003763 Bacteria 90565
13 Ga0055529_1000178 3300003763 Bacteria 86969
14 Ga0055526_1000714 3300003771 Bacteria 25196
15 Ga0055526_1003027 3300003771 Bacteria 10951
16 Ga0055524_1000018 3300003775 Bacteria 234806
17 Ga0068869_100199239 3300005334 Bacteria 1578
18 Ga0070661_100007778 3300005344 Bacteria 7396
19 Ga0070671_100017407 3300005355 Bacteria 5821
20 Ga0070673_100004981 3300005364 Bacteria 8469
21 Ga0070688_100157109 3300005365 Bacteria 1559
22 Ga0070659_100070693 3300005366 Bacteria 2773
23 Ga0070659_100196271 3300005366 Bacteria 1660
24 Ga0070709_10121837 3300005434 Bacteria 1769
25 Ga0070714_100000376 3300005435 Bacteria 33378
26 Ga0070714_100009181 3300005435 Bacteria 7762
27 Ga0070714_100358397 3300005435 Bacteria 1371
28 Ga0070713_100061303 3300005436 Bacteria 3146
29 Ga0070713_100076700 3300005436 Bacteria 2840
30 Ga0070663_100103763 3300005455 Bacteria 2126
31 Ga0070678_100003086 3300005456 Bacteria 9232
32 Ga0070678_100023246 3300005456 Bacteria 4127
33 Ga0070662_100173080 3300005457 Bacteria 1697
34 Ga0070681_10000086 3300005458 Bacteria 70488
35 Ga0068867_100274926 3300005459 Bacteria 1379
36 Ga0070685_10000149 3300005466 Bacteria 45785
37 Ga0070679_100107719 3300005530 Bacteria 2772
38 Ga0068853_100026562 3300005539 Bacteria 4862
39 Ga0068853_100048500 3300005539 Bacteria 3648
40 Ga0068853_100135100 3300005539 Bacteria 2210
41 Ga0070665_100000285 3300005548 Bacteria 80546
42 Ga0068855_100030005 3300005563 Bacteria 6504
43 Ga0068854_100015595 3300005578 Bacteria 5038
44 Ga0068851_10002514 3300005834 Bacteria 8062
45 Ga0068863_100095532 3300005841 Bacteria 2821
46 Ga0068858_100065096 3300005842 Bacteria 3373
47 Ga0068860_100001906 3300005843 Bacteria 22136
48 Ga0097621_100017025 3300006237 Bacteria 5512
49 Ga0068871_100073356 3300006358 Bacteria 2821
50 Ga0068865_100002640 3300006881 Bacteria 10649
51 Ga0079104_1003873 3300006946 Bacteria 6699
52 Ga0105240_10000201 3300009093 Bacteria 121112
53 Ga0105240_10002458 3300009093 Bacteria 29778
54 Ga0105240_10011615 3300009093 Bacteria 12250
55 Ga0105240_10017481 3300009093 Bacteria 9665
56 Ga0105240_10180790 3300009093 Bacteria 2489
57 Ga0105245_10154732 3300009098 Bacteria 2171
58 Ga0105242_10057706 3300009176 Bacteria 3180
59 Ga0105237_10012144 3300009545 Bacteria 9085
60 Ga0105237_10012479 3300009545 Bacteria 8955
61 Ga0105237_10251253 3300009545 Bacteria 1770
62 Ga0105237_10252874 3300009545 Bacteria 1764
63 Ga0105238_10010248 3300009551 Bacteria 9402
64 Ga0105238_10068249 3300009551 Bacteria 3557
65 Ga0105238_10082394 3300009551 Bacteria 3207
66 Ga0105239_10001861 3300010375 Bacteria 27602
67 Ga0105239_10010386 3300010375 Bacteria 10422
68 Ga0105239_10076020 3300010375 Bacteria 3693
69 Ga0105239_10219106 3300010375 Bacteria 2134
70 Ga0157373_10011191 3300013100 Bacteria 6602
71 Ga0157370_10003739 3300013104 Bacteria 17791
72 Ga0157370_10003745 3300013104 Bacteria 17775
73 Ga0157370_10007967 3300013104 Bacteria 11478
74 Ga0157369_10000001 3300013105 Bacteria 554908
75 Ga0157369_10011990 3300013105 Bacteria 9845
76 Ga0157369_10133238 3300013105 Bacteria 2632
77 Ga0157374_10161526 3300013296 Bacteria 2182
78 Ga0163162_10007864 3300013306 Bacteria 10388
79 Ga0163162_10019212 3300013306 Bacteria 6700
80 Ga0157372_10068286 3300013307 Bacteria 3996
81 Ga0157375_10003380 3300013308 Bacteria 13838
82 Ga0163163_10165946 3300014325 Bacteria 2254
83 Ga0182008_10016345 3300014497 Bacteria 3856
84 Ga0157379_10027453 3300014968 Bacteria 5069
85 Ga0157376_10000858 3300014969 Bacteria 19944
86 Ga0157376_10162811 3300014969 Bacteria 2024
87 Ga0182007_10013573 3300015262 Bacteria 3101
88 Ga0163161_10068788 3300017792 Bacteria 2588
89 Ga0209784_100053 3300025224 Bacteria 182075
90 Ga0207427_100061 3300025231 Bacteria 182815
91 Ga0209437_100037 3300025233 Bacteria 459730
92 Ga0209437_103195 3300025233 Bacteria 3001
93 Ga0209258_100138 3300025242 Bacteria 167495
94 Ga0209646_1000351 3300025246 Bacteria 33528
95 Ga0209026_1000051 3300025250 Bacteria 250792
96 Ga0209026_1000104 3300025250 Bacteria 152614
97 Ga0209677_100207 3300025253 Bacteria 46814
98 Ga0209677_100304 3300025253 Bacteria 32357
99 Ga0209148_1000001 3300025254 Bacteria 2545271
100 Ga0209759_1000220 3300025256 Bacteria 87504
101 Ga0209759_1006017 3300025256 Bacteria 4136
102 Ga0209233_1000002 3300025261 Bacteria 2501366
103 Ga0209233_1000217 3300025261 Bacteria 106187
104 Ga0209233_1000683 3300025261 Bacteria 16116
105 Ga0209455_1000079 3300025272 Bacteria 268778
106 Ga0209673_1001764 3300025273 Bacteria 17983
107 Ga0209025_1003376 3300025294 Bacteria 15258
108 Ga0209564_1000059 3300025295 Bacteria 328782
109 Ga0209564_1000730 3300025295 Bacteria 46914
110 Ga0209256_1000032 3300025299 Bacteria 395041
111 Ga0209256_1002416 3300025299 Bacteria 15315
112 Ga0209256_1008411 3300025299 Bacteria 4792
113 Ga0207680_10002699 3300025903 Bacteria 8292
114 Ga0207647_10000060 3300025904 Bacteria 84009
115 Ga0207705_10046183 3300025909 Bacteria 3129
116 Ga0207654_10025512 3300025911 Bacteria 3189
117 Ga0207707_10001438 3300025912 Bacteria 22028
118 Ga0207695_10000040 3300025913 Bacteria 452787
119 Ga0207695_10000118 3300025913 Bacteria 237085
120 Ga0207695_10012423 3300025913 Bacteria 10226
121 Ga0207695_10048963 3300025913 Bacteria 4459
122 Ga0207695_10117081 3300025913 Bacteria 2638
123 Ga0207695_10195000 3300025913 Bacteria 1942
124 Ga0207671_10004845 3300025914 Bacteria 12675
125 Ga0207671_10005161 3300025914 Bacteria 12153
126 Ga0207671_10011779 3300025914 Bacteria 7080
127 Ga0207693_10006480 3300025915 Bacteria 9700
128 Ga0207652_10010722 3300025921 Bacteria 7379
129 Ga0207694_10003553 3300025924 Bacteria 12378
130 Ga0207694_10015229 3300025924 Bacteria 5800
131 Ga0207694_10016152 3300025924 Bacteria 5634
132 Ga0207650_10237035 3300025925 Bacteria 1473
133 Ga0207659_10114983 3300025926 Bacteria 2052
134 Ga0207700_10002954 3300025928 Bacteria 9807
135 Ga0207664_10000021 3300025929 Bacteria 216875
136 Ga0207664_10008162 3300025929 Bacteria 7289
137 Ga0207644_10051504 3300025931 Bacteria 2955
138 Ga0207690_10000125 3300025932 Bacteria 63317
139 Ga0207690_10001728 3300025932 Bacteria 13424
140 Ga0207690_10098302 3300025932 Bacteria 2084
141 Ga0207706_10000981 3300025933 Bacteria 29038
142 Ga0207706_10053824 3300025933 Bacteria 3552
143 Ga0207686_10028571 3300025934 Bacteria 3280
144 Ga0207704_10091841 3300025938 Bacteria 1996
145 Ga0207691_10032015 3300025940 Bacteria 4906
146 Ga0207689_10010539 3300025942 Bacteria 7959
147 Ga0207667_10060749 3300025949 Bacteria 3956
148 Ga0207667_10116639 3300025949 Bacteria 2751
149 Ga0207651_10052620 3300025960 Bacteria 2777
150 Ga0207712_10000447 3300025961 Bacteria 35147
151 Ga0207640_10002178 3300025981 Bacteria 10540
152 Ga0207658_10052587 3300025986 Bacteria 3006
153 Ga0207703_10075868 3300026035 Bacteria 2787
154 Ga0207639_10001763 3300026041 Bacteria 14558
155 Ga0207639_10080352 3300026041 Bacteria 2579
156 Ga0207648_10031503 3300026089 Bacteria 4689
157 Ga0207683_10003364 3300026121 Bacteria 13940
158 Ga0207683_10010877 3300026121 Bacteria 7761
159 Ga0209281_1001879 3300027111 Bacteria 10091
160 Ga0268266_10000007 3300028379 Bacteria 1372921
161 Ga0268264_10114389 3300028381 Bacteria 2368
162 Ga0307515_10054008 3300028794 Bacteria 5909
163 Ga0265339_10092012 3300031249 Bacteria 1588
164 Ga0307408_100090787 3300031548 Bacteria 2306
165 Ga0265342_10002909 3300031712 Bacteria 14445
166 Ga0316576_10011559 3300031727 Bacteria 5792
167 Ga0316578_10014965 3300031728 Bacteria 4160
168 Ga0316596_1004516 3300033541 Bacteria 3127
169 Ga0373955_0033688 3300035172 Bacteria 2700
170 Ga0373924_0104249 3300035410 Bacteria 1222
171 Ga0373937_0078582 3300036401 Bacteria 3049
172 Ga0395899_0222952 3300037312 Bacteria 1305
173 Ga0395900_0198893 3300037418 Bacteria 2029
174 Ga0395898_0002716 3300037466 Bacteria 20410
175 Ga0395898_0092234 3300037466 Bacteria 2913
176 Ga0395901_0005107 3300038443 Bacteria 13256
177 Ga0400483_028678 3300039062 Bacteria 7412
178 Ga0400483_045211 3300039062 Bacteria 2648
179 Ga0400483_186557 3300039062 Bacteria 2266
180 Ga0400483_227308 3300039062 Bacteria 2940
181 Ga0451807_0147967 3300041486 Bacteria 1247
182 Ga0451576_0002518 3300045051 Bacteria 27166
183 Ga0495653_0046610 3300046463 Bacteria 3356
184 Ga0495580_0040266 3300046472 Bacteria 3340
185 Ga0495628_0031301 3300046516 Bacteria 4304
186 Ga0495649_0042885 3300046694 Bacteria 2471
187 Ga0496100_0069572 3300048903 Bacteria 2344
188 Ga0496100_0175649 3300048903 Bacteria 1546
189 Ga0496101_0094814 3300048904 Bacteria 2225
190 Ga0496101_0131633 3300048904 Bacteria 1900
191 Ga0496102_0066313 3300048905 Bacteria 3308
192 Ga0496103_0075478 3300048906 Bacteria 2114
193 Ga0496104_0000177 3300048907 Bacteria 56749
194 Ga0496105_0000109 3300048908 Bacteria 56407
195 Ga0496106_0010239 3300048909 Bacteria 6932
196 Ga0496106_0018844 3300048909 Bacteria 5113
197 Ga0496107_0187908 3300048910 Bacteria 1535
198 Ga0496108_0010394 3300048911 Bacteria 7559
199 Ga0496109_0011061 3300048912 Bacteria 7736
200 Ga0496109_0016299 3300048912 Bacteria 6495
201 Ga0496110_0038076 3300048913 Bacteria 4183
202 Ga0496110_0049380 3300048913 Bacteria 3691
203 Ga0496110_0096865 3300048913 Bacteria 2644
204 Ga0496111_0074918 3300048914 Bacteria 2466
205 Ga0496111_0182481 3300048914 Bacteria 1560
206 Ga0496112_0008172 3300048915 Bacteria 9351
207 Ga0496115_0000033 3300048918 Bacteria 136223
208 Ga0496115_0012075 3300048918 Bacteria 6495
209 Ga0496116_0023495 3300048919 Bacteria 4588
210 Ga0496118_0022981 3300048921 Bacteria 5430
211 Ga0496118_0041717 3300048921 Bacteria 3628
212 Ga0496119_0008758 3300048922 Bacteria 8820
213 Ga0496120_0027067 3300048923 Bacteria 3532
214 Ga0496121_0009855 3300048924 Bacteria 10901
215 Ga0496122_0114935 3300048925 Bacteria 1754
216 Ga0496123_0028654 3300048926 Bacteria 4116
217 Ga0496125_0005122 3300048928 Bacteria 14750
218 Ga0496126_0000340 3300048929 Bacteria 98226
219 Ga0501031_0015916 3300049568 Bacteria 4883
220 Ga0501032_0007827 3300049569 Bacteria 7787
221 Ga0501032_0011753 3300049569 Bacteria 6276
222 Ga0501033_0002889 3300049570 Bacteria 14376
223 Ga0501033_0007578 3300049570 Bacteria 8444
224 Ga0501033_0013275 3300049570 Bacteria 6276
225 Ga0501033_0034047 3300049570 Bacteria 3822
226 Ga0501034_0000364 3300049571 Bacteria 77230
227 Ga0501034_0004358 3300049571 Bacteria 15776
228 Ga0501034_0019018 3300049571 Bacteria 7036
229 Ga0501037_0033432 3300049573 Bacteria 3798
230 Ga0501037_0224241 3300049573 Bacteria 1321
231 Ga0501038_0005804 3300049574 Bacteria 11436
232 Ga0501038_0030903 3300049574 Bacteria 4734
233 Ga0501038_0192489 3300049574 Bacteria 1640
234 Ga0501039_0024421 3300049575 Bacteria 4643
235 Ga0501039_0039255 3300049575 Bacteria 3656
236 Ga0501040_0002784 3300049576 Bacteria 11281
237 Ga0501043_0001694 3300049579 Bacteria 19128
238 Ga0501043_0018597 3300049579 Bacteria 5452
239 Ga0501043_0166452 3300049579 Bacteria 1721
240 Ga0501046_0036260 3300049580 Bacteria 3970
241 Ga0501046_0036727 3300049580 Bacteria 3941
242 Ga0501047_0019462 3300049581 Bacteria 6512
243 Ga0501047_0040629 3300049581 Bacteria 4497
244 Ga0501047_0186347 3300049581 Bacteria 1940
245 Ga0501070_0007773 3300049586 Bacteria 9088
246 Ga0501070_0020050 3300049586 Bacteria 5606
247 Ga0501070_0160584 3300049586 Bacteria 1853
248 Ga0501035_0008605 3300049822 Bacteria 9496
249 Ga0501035_0017536 3300049822 Bacteria 6606
250 Ga0501035_0030258 3300049822 Bacteria 4936
251 Ga0501035_0050260 3300049822 Bacteria 3736
252 Ga0501044_0003435 3300049823 Bacteria 17851
253 Ga0501044_0011296 3300049823 Bacteria 9678
254 Ga0501044_0015926 3300049823 Bacteria 8090
255 Ga0501045_0002447 3300049824 Bacteria 12620
256 Ga0500618_000460 3300053125 Bacteria 26451
257 Ga0500616_0000674 3300053153 Bacteria 40062

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035410 Ga0373924_0104249 Ga0373924_0104249_45_1145 357
2 3300048906 Ga0496103_0075478 Ga0496103_0075478_31_1131 357
3 3300048904 Ga0496101_0131633 Ga0496101_0131633_676_1833 360
4 3300009545 Ga0105237_10251253 Ga0105237_102512532 362
5 3300025914 Ga0207671_10004845 Ga0207671_100048455 362
6 3300048919 Ga0496116_0023495 Ga0496116_0023495_2811_3974 362
7 3300048922 Ga0496119_0008758 Ga0496119_0008758_2076_3239 362
8 3300048923 Ga0496120_0027067 Ga0496120_0027067_1265_2428 362
9 3300048924 Ga0496121_0009855 Ga0496121_0009855_6976_8139 362
10 3300005344 Ga0070661_100007778 Ga0070661_1000077789 364
11 3300041486 Ga0451807_0147967 Ga0451807_0147967_28_1188 367
12 3300009551 Ga0105238_10068249 Ga0105238_100682493 369
13 3300014969 Ga0157376_10162811 Ga0157376_101628112 369
14 3300025904 Ga0207647_10000060 Ga0207647_1000006029 369
15 3300025924 Ga0207694_10015229 Ga0207694_100152293 369
16 3300049823 Ga0501044_0015926 Ga0501044_0015926_153_1316 369
17 3300025911 Ga0207654_10025512 Ga0207654_100255122 370
18 3300005539 Ga0068853_100135100 Ga0068853_1001351001 371
19 3300005548 Ga0070665_100000285 Ga0070665_100000285151 371
20 3300005578 Ga0068854_100015595 Ga0068854_1000155954 371
21 3300005834 Ga0068851_10002514 Ga0068851_100025143 371
22 3300005842 Ga0068858_100065096 Ga0068858_1000650963 371
23 3300009093 Ga0105240_10017481 Ga0105240_100174813 371
24 3300025903 Ga0207680_10002699 Ga0207680_100026997 371
25 3300025913 Ga0207695_10048963 Ga0207695_100489632 371
26 3300025913 Ga0207695_10195000 Ga0207695_101950002 371
27 3300025933 Ga0207706_10000981 Ga0207706_100009819 371
28 3300025949 Ga0207667_10116639 Ga0207667_101166392 371
29 3300025961 Ga0207712_10000447 Ga0207712_1000044735 371
30 3300025981 Ga0207640_10002178 Ga0207640_100021783 371
31 3300025986 Ga0207658_10052587 Ga0207658_100525873 371
32 3300026035 Ga0207703_10075868 Ga0207703_100758683 371
33 3300026041 Ga0207639_10001763 Ga0207639_100017638 371
34 3300028379 Ga0268266_10000007 Ga0268266_100000071185 371
35 3300049570 Ga0501033_0007578 Ga0501033_0007578_6575_7738 371
36 3300049574 Ga0501038_0192489 Ga0501038_0192489_180_1343 371
37 3300049822 Ga0501035_0008605 Ga0501035_0008605_4960_6123 371
38 iso_pu_bacteria 2643221674 2644413910 371
39 3300005365 Ga0070688_100157109 Ga0070688_1001571091 372
40 3300005466 Ga0070685_10000149 Ga0070685_1000014921 372
41 3300005539 Ga0068853_100048500 Ga0068853_1000485002 372
42 3300009093 Ga0105240_10002458 Ga0105240_1000245821 372
43 3300009545 Ga0105237_10012144 Ga0105237_100121444 372
44 3300009551 Ga0105238_10082394 Ga0105238_100823945 372
45 3300010375 Ga0105239_10076020 Ga0105239_100760204 372
46 3300013104 Ga0157370_10003739 Ga0157370_100037399 372
47 3300013306 Ga0163162_10019212 Ga0163162_100192126 372
48 3300025913 Ga0207695_10000040 Ga0207695_1000004047 372
49 3300025914 Ga0207671_10011779 Ga0207671_100117795 372
50 3300025924 Ga0207694_10016152 Ga0207694_100161523 372
51 3300037312 Ga0395899_0222952 Ga0395899_0222952_11_1162 372
52 3300037418 Ga0395900_0198893 Ga0395900_0198893_503_1654 372
53 3300038443 Ga0395901_0005107 Ga0395901_0005107_2144_3295 372
54 3300049571 Ga0501034_0000364 Ga0501034_0000364_42139_43302 372
55 iso_pu_bacteria 2508501122 2509112154 372
56 iso_pu_bacteria 2509276021 2509392649 372
57 iso_pu_bacteria 2516143018 2516207631 372
58 iso_pu_bacteria 2524023207 2524453835 372
59 iso_pu_bacteria 2582581308 2585280856 372
60 iso_pu_bacteria 2582581315 2585324339 372
61 iso_pu_bacteria 2582581316 2585335499 372
62 iso_pu_bacteria 2585427527 2585530560 372
63 iso_pu_bacteria 2585427530 2585554735 372
64 iso_pu_bacteria 2615840626 2616310761 372
65 iso_pu_bacteria 2643221562 2643830213 372
66 iso_pu_bacteria 2643221564 2643838136 372
67 iso_pu_bacteria 2643221623 2644130958 372
68 iso_pu_bacteria 2643221623 2644131916 372
69 iso_pu_bacteria 2643221627 2644155419 372
70 iso_pu_bacteria 2718217927 2719389263 372
71 iso_pu_bacteria 2718218423 2721402028 372
72 iso_pu_bacteria 2721755809 2724035861 372
73 iso_pu_bacteria 2791355256 2793298992 372
74 iso_pu_bacteria 2791355261 2793331232 372
75 iso_pu_bacteria 2791355262 2793338443 372
76 iso_pu_bacteria 2791355263 2793340886 372
77 iso_pu_bacteria 2818991448 2819607852 372
78 iso_pu_bacteria 2818991453 2819641138 372
79 iso_pu_bacteria 2828305725 2828310011 372
80 iso_pu_bacteria 2834578030 2834579454 372
81 iso_pu_bacteria 2838061910 2838068425 372
82 iso_pu_bacteria 2838668709 2838674853 372
83 iso_pu_bacteria 2838701080 2838707169 372
84 iso_pu_bacteria 2838729681 2838733505 372
85 iso_pu_bacteria 2838742623 2838746175 372
86 iso_pu_bacteria 2841851746 2841858087 372
87 iso_pu_bacteria 2841864319 2841866444 372
88 iso_pu_bacteria 2842146304 2842151800 372
89 iso_pu_bacteria 2842229732 2842234293 372
90 iso_pu_bacteria 2842243621 2842247815 372
91 iso_pu_bacteria 2842250916 2842257007 372
92 iso_pu_bacteria 2842257432 2842259410 372
93 iso_pu_bacteria 2842264693 2842268424 372
94 iso_pu_bacteria 2842395702 2842402056 372
95 iso_pu_bacteria 2842428310 2842432396 372
96 iso_pu_bacteria 2842434925 2842438700 372
97 iso_pu_bacteria 2842441272 2842445463 372
98 iso_pu_bacteria 2842469257 2842473315 372
99 iso_pu_bacteria 2844454524 2844459737 372
100 iso_pu_bacteria 2847670302 2847670580 372
101 iso_pu_bacteria 2848992105 2848998623 372
102 iso_pu_bacteria 2855872281 2855876026 372
103 iso_pu_bacteria 2876392853 2876394298 372
104 iso_pu_bacteria 2898795034 2898796572 372
105 iso_pu_bacteria 2904659560 2904661015 372
106 iso_pu_bacteria 2919679072 2919679347 372
107 iso_pu_bacteria 2921257292 2921262212 372
108 iso_pu_bacteria 2926754445 2926759995 372
109 iso_pu_bacteria 2936381700 2936384331 372
110 iso_pu_bacteria 2937023124 2937027221 372
111 iso_pu_bacteria 2937843397 2937846923 372
112 iso_pu_bacteria 2957382221 2957385532 372
113 iso_pu_bacteria 2957395598 2957398968 372
114 iso_pu_bacteria 2957402308 2957405029 372
115 iso_pu_bacteria 2961114664 2961116089 372
116 iso_pu_bacteria 2964615318 2964620573 372
117 iso_pu_bacteria 2967755722 2967759946 372
118 iso_pu_bacteria 2968110612 2968112072 372
119 iso_pu_bacteria 2970102677 2970107325 372
120 iso_pu_bacteria 2996310559 2996314839 372
121 iso_pu_bacteria 3005416602 3005421261 372
122 iso_pu_bacteria 643692032 643823805 372
123 iso_pu_bacteria 8005275841 8005277604 372
124 iso_pu_bacteria 8005314921 8005319004 372
125 iso_pu_bacteria 8005382845 8005382852 372
126 iso_pu_bacteria 8005395548 8005398457 372
127 iso_pu_bacteria 8005430974 8005436523 372
128 iso_pu_bacteria 8005484373 8005489698 372
129 iso_pu_bacteria 8005619151 8005621056 372
130 iso_pu_bacteria 8005626139 8005629705 372
131 iso_pu_bacteria 8005645114 8005650575 372
132 iso_pu_bacteria 8018176218 8018182136 372
133 iso_pu_bacteria 8023680758 8023683423 372
134 3300002741 JGI25157J39369_1006217 JGI25157J39369_10062172 373
135 3300005436 Ga0070713_100076700 Ga0070713_1000767002 373
136 3300025250 Ga0209026_1000051 Ga0209026_100005124 373
137 3300025256 Ga0209759_1006017 Ga0209759_10060173 373
138 3300025928 Ga0207700_10002954 Ga0207700_100029548 373
139 iso_pu_bacteria 2871451962 2871456398 373
140 3300025233 Ga0209437_103195 Ga0209437_1031953 374
141 3300025253 Ga0209677_100304 Ga0209677_10030414 374
142 3300025261 Ga0209233_1000217 Ga0209233_100021749 374
143 3300025294 Ga0209025_1003376 Ga0209025_100337612 374
144 3300035172 Ga0373955_0033688 Ga0373955_0033688_1165_2328 374
145 3300036401 Ga0373937_0078582 Ga0373937_0078582_553_1716 374
146 3300046472 Ga0495580_0040266 Ga0495580_0040266_1099_2262 374
147 3300048903 Ga0496100_0069572 Ga0496100_0069572_1048_2205 374
148 3300048921 Ga0496118_0041717 Ga0496118_0041717_2373_3530 374
149 3300049581 Ga0501047_0040629 Ga0501047_0040629_2088_3251 374
150 3300049822 Ga0501035_0050260 Ga0501035_0050260_1543_2706 374
151 3300005435 Ga0070714_100009181 Ga0070714_1000091813 375
152 3300005458 Ga0070681_10000086 Ga0070681_1000008651 375
153 3300009098 Ga0105245_10154732 Ga0105245_101547322 375
154 3300013104 Ga0157370_10003745 Ga0157370_100037455 375
155 3300015262 Ga0182007_10013573 Ga0182007_100135732 375
156 3300025912 Ga0207707_10001438 Ga0207707_100014383 375
157 3300025929 Ga0207664_10008162 Ga0207664_100081622 375
158 3300048913 Ga0496110_0096865 Ga0496110_0096865_481_1641 375
159 iso_pu_bacteria 8054563764 8054564069 375
160 3300002705 JGI25156J39149_1009868 JGI25156J39149_10098682 376
161 3300002737 JGI25162J39368_1000115 JGI25162J39368_100011527 376
162 3300002741 JGI25157J39369_1000132 JGI25157J39369_100013226 376
163 3300002772 JGI25164J39214_1000090 JGI25164J39214_100009048 376
164 3300003214 JGI25165J46597_1000194 JGI25165J46597_100019432 376
165 3300003322 rootL2_10019932 rootL2_100199328 376
166 3300003323 rootH1_10107881 rootH1_101078812 376
167 3300003751 Ga0055538_1002532 Ga0055538_10025322 376
168 3300003761 Ga0055535_1000106 Ga0055535_100010648 376
169 3300003762 Ga0055542_1000150 Ga0055542_100015027 376
170 3300003763 Ga0055529_1000168 Ga0055529_100016832 376
171 3300003763 Ga0055529_1000178 Ga0055529_100017849 376
172 3300003771 Ga0055526_1000714 Ga0055526_10007145 376
173 3300003771 Ga0055526_1003027 Ga0055526_10030279 376
174 3300003775 Ga0055524_1000018 Ga0055524_100001832 376
175 3300005334 Ga0068869_100199239 Ga0068869_1001992392 376
176 3300005355 Ga0070671_100017407 Ga0070671_1000174075 376
177 3300005364 Ga0070673_100004981 Ga0070673_1000049812 376
178 3300005366 Ga0070659_100070693 Ga0070659_1000706932 376
179 3300005366 Ga0070659_100196271 Ga0070659_1001962712 376
180 3300005434 Ga0070709_10121837 Ga0070709_101218372 376
181 3300005435 Ga0070714_100000376 Ga0070714_10000037615 376
182 3300005435 Ga0070714_100358397 Ga0070714_1003583971 376
183 3300005436 Ga0070713_100061303 Ga0070713_1000613033 376
184 3300005455 Ga0070663_100103763 Ga0070663_1001037632 376
185 3300005456 Ga0070678_100003086 Ga0070678_1000030865 376
186 3300005456 Ga0070678_100023246 Ga0070678_1000232463 376
187 3300005457 Ga0070662_100173080 Ga0070662_1001730802 376
188 3300005459 Ga0068867_100274926 Ga0068867_1002749261 376
189 3300005530 Ga0070679_100107719 Ga0070679_1001077192 376
190 3300005539 Ga0068853_100026562 Ga0068853_1000265622 376
191 3300005563 Ga0068855_100030005 Ga0068855_1000300053 376
192 3300005841 Ga0068863_100095532 Ga0068863_1000955322 376
193 3300005843 Ga0068860_100001906 Ga0068860_10000190626 376
194 3300006237 Ga0097621_100017025 Ga0097621_1000170254 376
195 3300006358 Ga0068871_100073356 Ga0068871_1000733563 376
196 3300006881 Ga0068865_100002640 Ga0068865_1000026408 376
197 3300006946 Ga0079104_1003873 Ga0079104_10038735 376
198 3300009093 Ga0105240_10000201 Ga0105240_1000020185 376
199 3300009093 Ga0105240_10011615 Ga0105240_100116153 376
200 3300009093 Ga0105240_10180790 Ga0105240_101807903 376
201 3300009176 Ga0105242_10057706 Ga0105242_100577061 376
202 3300009545 Ga0105237_10012479 Ga0105237_100124793 376
203 3300009545 Ga0105237_10252874 Ga0105237_102528742 376
204 3300009551 Ga0105238_10010248 Ga0105238_100102483 376
205 3300010375 Ga0105239_10001861 Ga0105239_100018613 376
206 3300010375 Ga0105239_10010386 Ga0105239_1001038610 376
207 3300010375 Ga0105239_10219106 Ga0105239_102191062 376
208 3300013100 Ga0157373_10011191 Ga0157373_100111914 376
209 3300013104 Ga0157370_10007967 Ga0157370_100079677 376
210 3300013105 Ga0157369_10000001 Ga0157369_10000001444 376
211 3300013105 Ga0157369_10011990 Ga0157369_100119906 376
212 3300013105 Ga0157369_10133238 Ga0157369_101332384 376
213 3300013296 Ga0157374_10161526 Ga0157374_101615262 376
214 3300013306 Ga0163162_10007864 Ga0163162_100078641 376
215 3300013307 Ga0157372_10068286 Ga0157372_100682863 376
216 3300013308 Ga0157375_10003380 Ga0157375_1000338010 376
217 3300014325 Ga0163163_10165946 Ga0163163_101659462 376
218 3300014497 Ga0182008_10016345 Ga0182008_100163452 376
219 3300014968 Ga0157379_10027453 Ga0157379_100274535 376
220 3300014969 Ga0157376_10000858 Ga0157376_100008582 376
221 3300017792 Ga0163161_10068788 Ga0163161_100687883 376
222 3300025224 Ga0209784_100053 Ga0209784_10005389 376
223 3300025231 Ga0207427_100061 Ga0207427_10006168 376
224 3300025233 Ga0209437_100037 Ga0209437_100037227 376
225 3300025242 Ga0209258_100138 Ga0209258_100138106 376
226 3300025246 Ga0209646_1000351 Ga0209646_100035115 376
227 3300025250 Ga0209026_1000104 Ga0209026_100010468 376
228 3300025253 Ga0209677_100207 Ga0209677_10020718 376
229 3300025254 Ga0209148_1000001 Ga0209148_1000001283 376
230 3300025256 Ga0209759_1000220 Ga0209759_100022046 376
231 3300025261 Ga0209233_1000002 Ga0209233_10000021948 376
232 3300025261 Ga0209233_1000683 Ga0209233_10006838 376
233 3300025272 Ga0209455_1000079 Ga0209455_100007968 376
234 3300025273 Ga0209673_1001764 Ga0209673_10017648 376
235 3300025295 Ga0209564_1000059 Ga0209564_1000059152 376
236 3300025295 Ga0209564_1000730 Ga0209564_100073036 376
237 3300025299 Ga0209256_1000032 Ga0209256_100003235 376
238 3300025299 Ga0209256_1002416 Ga0209256_100241610 376
239 3300025299 Ga0209256_1008411 Ga0209256_10084114 376
240 3300025909 Ga0207705_10046183 Ga0207705_100461833 376
241 3300025913 Ga0207695_10000118 Ga0207695_10000118203 376
242 3300025913 Ga0207695_10012423 Ga0207695_100124236 376
243 3300025913 Ga0207695_10117081 Ga0207695_101170812 376
244 3300025914 Ga0207671_10005161 Ga0207671_100051614 376
245 3300025915 Ga0207693_10006480 Ga0207693_100064805 376
246 3300025921 Ga0207652_10010722 Ga0207652_100107224 376
247 3300025924 Ga0207694_10003553 Ga0207694_1000355312 376
248 3300025925 Ga0207650_10237035 Ga0207650_102370351 376
249 3300025926 Ga0207659_10114983 Ga0207659_101149832 376
250 3300025929 Ga0207664_10000021 Ga0207664_1000002121 376
251 3300025931 Ga0207644_10051504 Ga0207644_100515042 376
252 3300025932 Ga0207690_10000125 Ga0207690_1000012558 376
253 3300025932 Ga0207690_10001728 Ga0207690_100017282 376
254 3300025932 Ga0207690_10098302 Ga0207690_100983022 376
255 3300025933 Ga0207706_10053824 Ga0207706_100538244 376
256 3300025934 Ga0207686_10028571 Ga0207686_100285712 376
257 3300025938 Ga0207704_10091841 Ga0207704_100918412 376
258 3300025940 Ga0207691_10032015 Ga0207691_100320152 376
259 3300025942 Ga0207689_10010539 Ga0207689_100105395 376
260 3300025949 Ga0207667_10060749 Ga0207667_100607492 376
261 3300025960 Ga0207651_10052620 Ga0207651_100526201 376
262 3300026041 Ga0207639_10080352 Ga0207639_100803522 376
263 3300026089 Ga0207648_10031503 Ga0207648_100315033 376
264 3300026121 Ga0207683_10003364 Ga0207683_100033647 376
265 3300026121 Ga0207683_10010877 Ga0207683_100108772 376
266 3300027111 Ga0209281_1001879 Ga0209281_10018795 376
267 3300028381 Ga0268264_10114389 Ga0268264_101143891 376
268 3300028794 Ga0307515_10054008 Ga0307515_100540082 376
269 3300031249 Ga0265339_10092012 Ga0265339_100920121 376
270 3300031548 Ga0307408_100090787 Ga0307408_1000907872 376
271 3300031712 Ga0265342_10002909 Ga0265342_100029098 376
272 3300031727 Ga0316576_10011559 Ga0316576_100115593 376
273 3300031728 Ga0316578_10014965 Ga0316578_100149653 376
274 3300033541 Ga0316596_1004516 Ga0316596_10045163 376
275 3300037466 Ga0395898_0002716 Ga0395898_0002716_14251_15414 376
276 3300037466 Ga0395898_0092234 Ga0395898_0092234_1119_2282 376
277 3300039062 Ga0400483_028678 Ga0400483_028678_81_1244 376
278 3300039062 Ga0400483_045211 Ga0400483_045211_1231_2424 376
279 3300039062 Ga0400483_186557 Ga0400483_186557_744_1937 376
280 3300039062 Ga0400483_227308 Ga0400483_227308_1735_2898 376
281 3300045051 Ga0451576_0002518 Ga0451576_0002518_12102_13265 376
282 3300046463 Ga0495653_0046610 Ga0495653_0046610_2041_3204 376
283 3300046516 Ga0495628_0031301 Ga0495628_0031301_834_1997 376
284 3300046694 Ga0495649_0042885 Ga0495649_0042885_119_1285 376
285 3300048903 Ga0496100_0175649 Ga0496100_0175649_145_1326 376
286 3300048904 Ga0496101_0094814 Ga0496101_0094814_1005_2186 376
287 3300048905 Ga0496102_0066313 Ga0496102_0066313_1057_2223 376
288 3300048907 Ga0496104_0000177 Ga0496104_0000177_54348_55511 376
289 3300048908 Ga0496105_0000109 Ga0496105_0000109_614_1777 376
290 3300048909 Ga0496106_0010239 Ga0496106_0010239_1611_2792 376
291 3300048909 Ga0496106_0018844 Ga0496106_0018844_3078_4244 376
292 3300048910 Ga0496107_0187908 Ga0496107_0187908_89_1258 376
293 3300048911 Ga0496108_0010394 Ga0496108_0010394_1778_2959 376
294 3300048912 Ga0496109_0011061 Ga0496109_0011061_1811_2992 376
295 3300048912 Ga0496109_0016299 Ga0496109_0016299_5299_6462 376
296 3300048913 Ga0496110_0038076 Ga0496110_0038076_518_1699 376
297 3300048913 Ga0496110_0049380 Ga0496110_0049380_1531_2697 376
298 3300048914 Ga0496111_0074918 Ga0496111_0074918_92_1258 376
299 3300048914 Ga0496111_0182481 Ga0496111_0182481_228_1409 376
300 3300048915 Ga0496112_0008172 Ga0496112_0008172_2700_3881 376
301 3300048918 Ga0496115_0000033 Ga0496115_0000033_78064_79260 376
302 3300048918 Ga0496115_0012075 Ga0496115_0012075_4452_5618 376
303 3300048921 Ga0496118_0022981 Ga0496118_0022981_1146_2309 376
304 3300048925 Ga0496122_0114935 Ga0496122_0114935_292_1455 376
305 3300048926 Ga0496123_0028654 Ga0496123_0028654_1268_2431 376
306 3300048928 Ga0496125_0005122 Ga0496125_0005122_3896_5059 376
307 3300048929 Ga0496126_0000340 Ga0496126_0000340_78751_79947 376
308 3300049568 Ga0501031_0015916 Ga0501031_0015916_1783_2946 376
309 3300049569 Ga0501032_0007827 Ga0501032_0007827_1931_3094 376
310 3300049569 Ga0501032_0011753 Ga0501032_0011753_2571_3734 376
311 3300049570 Ga0501033_0002889 Ga0501033_0002889_7343_8506 376
312 3300049570 Ga0501033_0013275 Ga0501033_0013275_2543_3706 376
313 3300049570 Ga0501033_0034047 Ga0501033_0034047_369_1550 376
314 3300049571 Ga0501034_0004358 Ga0501034_0004358_6027_7190 376
315 3300049571 Ga0501034_0019018 Ga0501034_0019018_2543_3706 376
316 3300049573 Ga0501037_0033432 Ga0501037_0033432_2430_3593 376
317 3300049573 Ga0501037_0224241 Ga0501037_0224241_11_1174 376
318 3300049574 Ga0501038_0005804 Ga0501038_0005804_1676_2839 376
319 3300049574 Ga0501038_0030903 Ga0501038_0030903_1789_2952 376
320 3300049575 Ga0501039_0024421 Ga0501039_0024421_1083_2246 376
321 3300049575 Ga0501039_0039255 Ga0501039_0039255_881_2062 376
322 3300049576 Ga0501040_0002784 Ga0501040_0002784_5972_7135 376
323 3300049579 Ga0501043_0001694 Ga0501043_0001694_8833_9996 376
324 3300049579 Ga0501043_0018597 Ga0501043_0018597_1747_2910 376
325 3300049579 Ga0501043_0166452 Ga0501043_0166452_498_1679 376
326 3300049580 Ga0501046_0036260 Ga0501046_0036260_1175_2338 376
327 3300049580 Ga0501046_0036727 Ga0501046_0036727_2737_3918 376
328 3300049581 Ga0501047_0019462 Ga0501047_0019462_3695_4858 376
329 3300049581 Ga0501047_0186347 Ga0501047_0186347_28_1209 376
330 3300049586 Ga0501070_0007773 Ga0501070_0007773_4078_5241 376
331 3300049586 Ga0501070_0020050 Ga0501070_0020050_3495_4658 376
332 3300049586 Ga0501070_0160584 Ga0501070_0160584_495_1676 376
333 3300049822 Ga0501035_0017536 Ga0501035_0017536_4299_5462 376
334 3300049822 Ga0501035_0030258 Ga0501035_0030258_1747_2910 376
335 3300049823 Ga0501044_0003435 Ga0501044_0003435_10306_11469 376
336 3300049823 Ga0501044_0011296 Ga0501044_0011296_5973_7136 376
337 3300049824 Ga0501045_0002447 Ga0501045_0002447_9900_11063 376
338 3300053125 Ga0500618_000460 Ga0500618_000460_13788_14951 376
339 3300053153 Ga0500616_0000674 Ga0500616_0000674_18702_19865 376
340 iso_pu_bacteria 2939611941 2939614708 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14031

D-ser_dehydrat

Putative serine dehydratase domain

270

355

0.89

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

34

250

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qkb-assembly1.cif.gz_B crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans 0.9266 5 376
7dib-assembly1.cif.gz_B crystal structure of d-threonine aldolase from filomicrobium marinum 0.9228 15 373
4v15-assembly1.cif.gz_B crystal structure of d-threonine aldolase from alcaligenes xylosoxidans 0.9198 15 373
6qkb-assembly1.cif.gz_B crystal structure of the beta-hydroxyaspartate aldolase of paracoccus denitrificans 0.9148 5 376
7dib-assembly1.cif.gz_A crystal structure of d-threonine aldolase from filomicrobium marinum 0.9137 14 376
ID Description Score Start End Superfamily
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9512 35 249 3.20.20.10
4v15B02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.914 35 249 3.20.20.10
af_P9WLY5_1_166_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8813 73 238 3.20.20.10
3wqcB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.866 35 243 3.20.20.10
af_Q54XE5_21_258_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8588 36 249 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A7S0MTP3-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9711 101 233 GO:0008721
GO:0036088
AF-A0A7K1INX4-F1-model_v4 deleted 0.9684 87 203
AF-A0A4V1SRG0-F1-model_v4 DSD1 family PLP-dependent enzyme 0.9576 23 243 GO:0008721
GO:0036088
AF-A0A7S0MTP3-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9569 101 233 GO:0008721
GO:0036088
AF-A0A124IPM7-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9552 76 222 GO:0008721
GO:0036088

Feature Viewer

pLDDT pTM Quality
86.5 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map