F414264

General Info

Members Datasets Scaffolds Average Seq Length
340 179 313 235

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100033530|Ga0068856_1000335306
Length 279
Sequence MPENKSDPEIPNSEITANAPSKSPPVGETLASLRVRSGIHSAIENKSEIENPKSEIKLYQHIFFDLDHTIWDFDRNAEETLYESKIGLPSAALFIETYTRNNHRLWAEYHTGKITKNELRETRFKTTFLELGVPPDRLPLAFEDHYVRLCPTKTNLFPHAHQTLQYLQNKYTLHLITNGFKETSEYKIGNTNIGSYFKHVIISEVVGANKPDKAIFEHALTLSGANKNESLMIGDSLEADVYGALNFGMDAIYFNPFNAPKPDDVPLQVTHLKELMDIL

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2739367663 Pedobacter sp. YR510 Isolate Unclassified
11 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
12 2818991437 Pedobacter terrae 518 Isolate Unclassified
13 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
14 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
15 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
16 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
19 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
20 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
21 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
22 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
23 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
24 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
25 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
26 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
27 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
28 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
29 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
30 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
31 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
32 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
33 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
34 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
35 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
36 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
37 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
38 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
39 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
40 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
41 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
42 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
43 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
44 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
45 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
46 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
47 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
48 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
51 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
54 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
58 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
89 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
90 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
93 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
97 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
143 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
144 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
145 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
154 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
155 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
156 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
159 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
168 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
169 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
170 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
173 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
174 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
175 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
176 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
177 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
178 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
179 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.06
Metatranscriptomes 0
Isolates 7.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10
Nodule 0
Rhizoplane 0.29
Rhizosphere 80.88
Stem 0
Stem Tuber 0
Unclassified 8.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2637238 2162886007 Bacteria 802
2 JGI24736J21556_1010516 3300001904 Bacteria 1511
3 JGI24739J22299_10011148 3300001989 Bacteria 3322
4 JGI24739J22299_10022622 3300001989 Bacteria 2229
5 JGI24737J22298_10000116 3300001990 Bacteria 24197
6 JGI24735J21928_10000015 3300002067 Bacteria 167231
7 JGI24744J21845_10004366 3300002077 Bacteria 2921
8 JGI25162J39368_1000016 3300002737 Bacteria 288734
9 JGI25162J39368_1000866 3300002737 Bacteria 19829
10 JGI25157J39369_1005975 3300002741 Bacteria 1909
11 JGI25164J39214_1001979 3300002772 Bacteria 3689
12 JGI25152J39213_1001261 3300002773 Bacteria 11491
13 JGI25150J39212_1000023 3300002774 Bacteria 130663
14 JGI25151J46595_10000082 3300003187 Bacteria 130832
15 JGI25165J46597_1001674 3300003214 Bacteria 10067
16 JGI25153J46596_10000060 3300003215 Bacteria 131744
17 rootH1_10034433 3300003316 Bacteria 16075
18 rootH1_10142970 3300003316 Bacteria 3249
19 rootH2_10010159 3300003320 Bacteria 33853
20 rootH2_10088336 3300003320 Bacteria 13237
21 rootL2_10103558 3300003322 Bacteria 1657
22 rootL2_10103559 3300003322 Bacteria 1802
23 rootH1_10003399 3300003323 Bacteria 54122
24 rootH1_10093161 3300003323 Bacteria 1873
25 Ga0055530_10005053 3300003791 Bacteria 6477
26 Ga0065714_10002204 3300005288 Bacteria 57902
27 Ga0065714_10004766 3300005288 Bacteria 5077
28 Ga0065714_10068860 3300005288 Bacteria 4506
29 Ga0065714_10115750 3300005288 Bacteria 1412
30 Ga0065704_10071596 3300005289 Bacteria 10546
31 Ga0070658_10000008 3300005327 Bacteria 319912
32 Ga0070658_10198972 3300005327 Bacteria 1690
33 Ga0070676_10001449 3300005328 Bacteria 12010
34 Ga0068868_100008265 3300005338 Bacteria 7452
35 Ga0068868_100125227 3300005338 Bacteria 2099
36 Ga0070660_100003427 3300005339 Bacteria 10909
37 Ga0070660_100052136 3300005339 Bacteria 3153
38 Ga0070660_100077249 3300005339 Bacteria 2609
39 Ga0070671_100011049 3300005355 Bacteria 7247
40 Ga0070674_100086120 3300005356 Bacteria 2256
41 Ga0070673_100003860 3300005364 Bacteria 9410
42 Ga0070659_100000262 3300005366 Bacteria 41533
43 Ga0070681_10048767 3300005458 Bacteria 4230
44 Ga0070679_100025582 3300005530 Bacteria 5794
45 Ga0070679_100161783 3300005530 Bacteria 2213
46 Ga0068853_100277951 3300005539 Bacteria 1543
47 Ga0068853_100557572 3300005539 Bacteria 1086
48 Ga0070665_100000061 3300005548 Bacteria 222138
49 Ga0068855_100000074 3300005563 Bacteria 119759
50 Ga0068855_100017943 3300005563 Bacteria 8503
51 Ga0068855_100023953 3300005563 Bacteria 7309
52 Ga0068855_100169238 3300005563 Bacteria 2475
53 Ga0068855_100218090 3300005563 Bacteria 2141
54 Ga0068855_100633528 3300005563 Bacteria 1150
55 Ga0068856_100000385 3300005614 Bacteria 48447
56 Ga0068856_100033530 3300005614 Bacteria 5028
57 Ga0068856_100046164 3300005614 Bacteria 4291
58 Ga0068856_100411166 3300005614 Bacteria 1373
59 Ga0068856_100872425 3300005614 Bacteria 919
60 Ga0068852_100271388 3300005616 Bacteria 1632
61 Ga0068870_10425966 3300005840 Bacteria 869
62 Ga0068858_100126757 3300005842 Bacteria 2391
63 Ga0075366_10000170 3300006195 Bacteria 27881
64 Ga0075366_10005159 3300006195 Bacteria 7067
65 Ga0075366_10171574 3300006195 Bacteria 1316
66 Ga0097621_100000016 3300006237 Bacteria 91785
67 Ga0068865_100000214 3300006881 Bacteria 32364
68 Ga0068865_100414713 3300006881 Bacteria 1106
69 Ga0105244_10002729 3300009036 Bacteria 13178
70 Ga0105240_10000082 3300009093 Bacteria 195184
71 Ga0105240_10001333 3300009093 Bacteria 42441
72 Ga0105240_10039625 3300009093 Bacteria 6031
73 Ga0105240_10125146 3300009093 Bacteria 3090
74 Ga0105240_10158107 3300009093 Bacteria 2694
75 Ga0105240_10310430 3300009093 Bacteria 1801
76 Ga0105240_10312294 3300009093 Bacteria 1794
77 Ga0105240_10565856 3300009093 Bacteria 1256
78 Ga0105245_10270770 3300009098 Bacteria 1656
79 Ga0105241_10000116 3300009174 Bacteria 57591
80 Ga0105241_10056412 3300009174 Bacteria 3011
81 Ga0105241_10090257 3300009174 Bacteria 2416
82 Ga0105241_10291119 3300009174 Bacteria 1398
83 Ga0105242_10080767 3300009176 Bacteria 2718
84 Ga0105237_10000310 3300009545 Bacteria 67887
85 Ga0105237_10002729 3300009545 Bacteria 21530
86 Ga0105237_10003285 3300009545 Bacteria 19310
87 Ga0105237_10003434 3300009545 Bacteria 18811
88 Ga0105237_10009371 3300009545 Bacteria 10489
89 Ga0105237_10029215 3300009545 Bacteria 5608
90 Ga0105237_10225948 3300009545 Bacteria 1872
91 Ga0105237_10544806 3300009545 Bacteria 1167
92 Ga0105238_10158642 3300009551 Bacteria 2238
93 Ga0105238_10173035 3300009551 Bacteria 2136
94 Ga0105238_10446545 3300009551 Bacteria 1290
95 Ga0105239_10000009 3300010375 Bacteria 361182
96 Ga0105239_10000049 3300010375 Bacteria 177578
97 Ga0105239_10003303 3300010375 Bacteria 19863
98 Ga0105239_10008608 3300010375 Bacteria 11568
99 Ga0105239_10008871 3300010375 Bacteria 11379
100 Ga0105239_10028319 3300010375 Bacteria 6163
101 Ga0105246_10009914 3300011119 Bacteria 5877
102 Ga0157373_10000089 3300013100 Bacteria 78449
103 Ga0157373_10019892 3300013100 Bacteria 4884
104 Ga0157373_10025928 3300013100 Bacteria 4236
105 Ga0157373_10035857 3300013100 Bacteria 3560
106 Ga0157373_10064145 3300013100 Bacteria 2600
107 Ga0157371_10000025 3300013102 Bacteria 279746
108 Ga0157371_10003959 3300013102 Bacteria 13144
109 Ga0157371_10005219 3300013102 Bacteria 11043
110 Ga0157371_10010298 3300013102 Bacteria 7295
111 Ga0157371_10013702 3300013102 Bacteria 6149
112 Ga0157371_10101392 3300013102 Bacteria 2042
113 Ga0157371_10113390 3300013102 Bacteria 1925
114 Ga0157370_10004723 3300013104 Bacteria 15530
115 Ga0157370_10041161 3300013104 Bacteria 4460
116 Ga0157370_10043930 3300013104 Bacteria 4298
117 Ga0157370_10056152 3300013104 Bacteria 3748
118 Ga0157370_10076327 3300013104 Bacteria 3157
119 Ga0157370_10234196 3300013104 Bacteria 1699
120 Ga0157369_10000038 3300013105 Bacteria 189078
121 Ga0157369_10004248 3300013105 Bacteria 16965
122 Ga0157369_10044949 3300013105 Bacteria 4805
123 Ga0157369_10182414 3300013105 Bacteria 2208
124 Ga0157369_10254865 3300013105 Bacteria 1831
125 Ga0157374_10522425 3300013296 Bacteria 1193
126 Ga0157378_10006650 3300013297 Bacteria 10102
127 Ga0157378_10082618 3300013297 Bacteria 2905
128 Ga0157378_10636334 3300013297 Bacteria 1081
129 Ga0163162_10000012 3300013306 Bacteria 292674
130 Ga0163162_10000050 3300013306 Bacteria 120151
131 Ga0163162_10002529 3300013306 Bacteria 17304
132 Ga0163162_10010449 3300013306 Bacteria 9025
133 Ga0163162_10273134 3300013306 Bacteria 1822
134 Ga0157372_10000039 3300013307 Bacteria 165839
135 Ga0157372_10001390 3300013307 Bacteria 26087
136 Ga0157375_10014406 3300013308 Bacteria 7053
137 Ga0157375_10015032 3300013308 Bacteria 6923
138 Ga0157375_10087403 3300013308 Bacteria 3170
139 Ga0157375_10152227 3300013308 Bacteria 2449
140 Ga0157375_10632293 3300013308 Bacteria 1228
141 Ga0157375_10977899 3300013308 Bacteria 987
142 Ga0182008_10000020 3300014497 Bacteria 228333
143 Ga0182008_10000052 3300014497 Bacteria 103193
144 Ga0182008_10000053 3300014497 Bacteria 102934
145 Ga0182008_10033524 3300014497 Bacteria 2576
146 Ga0182008_10041675 3300014497 Bacteria 2290
147 Ga0182006_1000276 3300015261 Bacteria 45977
148 Ga0182006_1000555 3300015261 Bacteria 28085
149 Ga0182007_10000024 3300015262 Bacteria 181761
150 Ga0182007_10027559 3300015262 Bacteria 1957
151 Ga0182007_10050065 3300015262 Bacteria 1379
152 Ga0183373_1002 3300015682 Bacteria 990153
153 Ga0163161_10000093 3300017792 Bacteria 90618
154 Ga0163161_10000145 3300017792 Bacteria 64643
155 Ga0163161_10010007 3300017792 Bacteria 6567
156 Ga0163161_10030141 3300017792 Bacteria 3859
157 Ga0163161_10044855 3300017792 Bacteria 3186
158 Ga0207427_100122 3300025231 Bacteria 99064
159 Ga0209437_100048 3300025233 Bacteria 405107
160 Ga0209437_100119 3300025233 Bacteria 206549
161 Ga0207425_1000051 3300025245 Bacteria 166795
162 Ga0209026_1000304 3300025250 Bacteria 53704
163 Ga0209129_1000121 3300025258 Bacteria 135404
164 Ga0209233_1000029 3300025261 Bacteria 641642
165 Ga0209455_1004796 3300025272 Bacteria 4328
166 Ga0209676_1000022 3300025292 Bacteria 605659
167 Ga0209025_1000160 3300025294 Bacteria 166795
168 Ga0209758_1000147 3300025297 Bacteria 166795
169 Ga0209050_1000020 3300025298 Bacteria 605671
170 Ga0207655_1037965 3300025728 Bacteria 2112
171 Ga0207647_10000018 3300025904 Bacteria 124816
172 Ga0207645_10000172 3300025907 Bacteria 51794
173 Ga0207643_10039963 3300025908 Bacteria 2639
174 Ga0207705_10000026 3300025909 Bacteria 256051
175 Ga0207705_10072897 3300025909 Bacteria 2491
176 Ga0207654_10004989 3300025911 Bacteria 6710
177 Ga0207654_10025928 3300025911 Bacteria 3169
178 Ga0207654_10316168 3300025911 Bacteria 1066
179 Ga0207707_10216583 3300025912 Bacteria 1667
180 Ga0207695_10000053 3300025913 Bacteria 396740
181 Ga0207695_10006832 3300025913 Bacteria 14694
182 Ga0207695_10085426 3300025913 Bacteria 3184
183 Ga0207695_10133422 3300025913 Bacteria 2438
184 Ga0207695_10156606 3300025913 Bacteria 2213
185 Ga0207695_10225457 3300025913 Bacteria 1780
186 Ga0207671_10000366 3300025914 Bacteria 64454
187 Ga0207671_10000925 3300025914 Bacteria 36841
188 Ga0207671_10001993 3300025914 Bacteria 22502
189 Ga0207671_10007835 3300025914 Bacteria 9180
190 Ga0207671_10012842 3300025914 Bacteria 6709
191 Ga0207671_10062514 3300025914 Bacteria 2765
192 Ga0207671_10361695 3300025914 Bacteria 1152
193 Ga0207657_10037592 3300025919 Bacteria 4320
194 Ga0207657_10058404 3300025919 Bacteria 3320
195 Ga0207652_10044645 3300025921 Bacteria 3776
196 Ga0207652_10059778 3300025921 Bacteria 3286
197 Ga0207694_10018140 3300025924 Bacteria 5320
198 Ga0207694_10105659 3300025924 Bacteria 2236
199 Ga0207644_10007855 3300025931 Bacteria 6970
200 Ga0207690_10001178 3300025932 Bacteria 16550
201 Ga0207669_10366387 3300025937 Bacteria 1118
202 Ga0207704_10000354 3300025938 Bacteria 21443
203 Ga0207704_10281182 3300025938 Bacteria 1265
204 Ga0207667_10000014 3300025949 Bacteria 421261
205 Ga0207667_10000274 3300025949 Bacteria 71328
206 Ga0207667_10008386 3300025949 Bacteria 12280
207 Ga0207667_10081323 3300025949 Bacteria 3356
208 Ga0207667_10151939 3300025949 Bacteria 2383
209 Ga0207640_10283815 3300025981 Bacteria 1302
210 Ga0207677_10095852 3300026023 Bacteria 2169
211 Ga0207677_10103870 3300026023 Bacteria 2099
212 Ga0207702_10000586 3300026078 Bacteria 40370
213 Ga0207702_10036427 3300026078 Bacteria 4115
214 Ga0207702_10037437 3300026078 Bacteria 4061
215 Ga0207702_10192155 3300026078 Bacteria 1887
216 Ga0207702_10355158 3300026078 Bacteria 1403
217 Ga0207648_10000658 3300026089 Bacteria 38677
218 Ga0207698_10139536 3300026142 Bacteria 2086
219 Ga0207698_10463217 3300026142 Unclassified 1226
220 Ga0268266_10000053 3300028379 Bacteria 295181
221 Ga0307515_10000316 3300028794 Bacteria 119243
222 Ga0307515_10001308 3300028794 Bacteria 56577
223 Ga0307515_10164591 3300028794 Bacteria 2243
224 Ga0316181_1276095 3300030744 Bacteria 1786
225 Ga0307405_10000011 3300031731 Bacteria 241071
226 Ga0307407_10000018 3300031903 Bacteria 135979
227 Ga0307412_10000001 3300031911 Bacteria 822691
228 Ga0307409_100229006 3300031995 Bacteria 1683
229 Ga0307416_100000050 3300032002 Bacteria 116313
230 Ga0307414_10000980 3300032004 Bacteria 14558
231 Ga0307414_10002018 3300032004 Bacteria 10550
232 Ga0307414_10002147 3300032004 Bacteria 10297
233 Ga0307414_10091685 3300032004 Bacteria 2259
234 Ga0307411_10404091 3300032005 Bacteria 1130
235 Ga0395899_0000027 3300037312 Bacteria 337387
236 Ga0395899_0000282 3300037312 Bacteria 66053
237 Ga0395899_0001270 3300037312 Bacteria 21938
238 Ga0395900_0002423 3300037418 Bacteria 20558
239 Ga0395900_0009107 3300037418 Bacteria 10169
240 Ga0395898_0014682 3300037466 Bacteria 8043
241 Ga0395905_0000993 3300037471 Bacteria 36305
242 Ga0395905_0001272 3300037471 Bacteria 31128
243 Ga0395901_0000644 3300038443 Bacteria 40364
244 Ga0395901_0005293 3300038443 Bacteria 13041
245 Ga0439448_0083966 3300042005 Bacteria 1071
246 Ga0466966_0199733 3300044684 Bacteria 1210
247 Ga0466959_0186441 3300045049 Bacteria 1449
248 Ga0495650_0000144 3300046471 Bacteria 165957
249 Ga0495650_0064590 3300046471 Bacteria 1455
250 Ga0495605_0219450 3300046474 Bacteria 822
251 Ga0495585_0000091 3300046492 Bacteria 95620
252 Ga0495585_0000658 3300046492 Bacteria 31746
253 Ga0495583_0227772 3300046506 Bacteria 752
254 Ga0495606_0000919 3300046507 Bacteria 43453
255 Ga0495606_0013016 3300046507 Bacteria 6614
256 Ga0495606_0021189 3300046507 Bacteria 4764
257 Ga0495606_0021269 3300046507 Bacteria 4755
258 Ga0495606_0060821 3300046507 Bacteria 2418
259 Ga0495610_0000037 3300046512 Bacteria 186354
260 Ga0495610_0000574 3300046512 Bacteria 36619
261 Ga0495610_0008174 3300046512 Bacteria 6824
262 Ga0495616_0011104 3300046513 Bacteria 5175
263 Ga0495616_0011972 3300046513 Bacteria 4939
264 Ga0495628_0346181 3300046516 Bacteria 1093
265 Ga0495631_0120043 3300046518 Bacteria 1131
266 Ga0495632_0038573 3300046519 Bacteria 2418
267 Ga0495648_0018526 3300046524 Bacteria 4925
268 Ga0495648_0048395 3300046524 Bacteria 2617
269 Ga0495652_0398694 3300046529 Bacteria 975
270 Ga0495654_0050503 3300046530 Bacteria 2032
271 Ga0495609_0014382 3300046538 Bacteria 3721
272 Ga0495609_0082021 3300046538 Bacteria 1409
273 Ga0495633_0000026 3300046558 Bacteria 204722
274 Ga0495633_0007299 3300046558 Bacteria 6381
275 Ga0495633_0088382 3300046558 Bacteria 1441
276 Ga0495668_0000054 3300046616 Bacteria 203960
277 Ga0495668_0081772 3300046616 Bacteria 1772
278 Ga0495625_0000059 3300046660 Bacteria 180330
279 Ga0495625_0001227 3300046660 Bacteria 32490
280 Ga0495625_0003592 3300046660 Bacteria 15260
281 Ga0495625_0032221 3300046660 Bacteria 3890
282 Ga0495625_0116599 3300046660 Bacteria 1821
283 Ga0495625_0140575 3300046660 Bacteria 1629
284 Ga0495661_0003215 3300046665 Bacteria 12199
285 Ga0495661_0041449 3300046665 Bacteria 2848
286 Ga0495661_0052128 3300046665 Bacteria 2466
287 Ga0495661_0076061 3300046665 Bacteria 1949
288 Ga0495658_0228031 3300046683 Bacteria 1167
289 Ga0495671_0102572 3300046692 Bacteria 1398
290 Ga0495687_001100 3300047443 Bacteria 26388
291 Ga0495687_042827 3300047443 Bacteria 1975
292 Ga0495686_0002591 3300047472 Bacteria 16802
293 Ga0495686_0048542 3300047472 Bacteria 2676
294 Ga0495686_0214089 3300047472 Bacteria 1099
295 Ga0495686_0382361 3300047472 Bacteria 759
296 Ga0496122_0000876 3300048925 Bacteria 56653
297 Ga0496123_0000777 3300048926 Bacteria 51679
298 Ga0495678_008057 3300049459 Bacteria 5372
299 Ga0495678_068679 3300049459 Bacteria 1306
300 Ga0495682_0030456 3300049460 Bacteria 1996
301 Ga0501249_004504 3300049679 Bacteria 2830
302 Ga0501241_007237 3300049758 Bacteria 2033
303 nmdc:mga0k408_1202_c1 3300050493 Bacteria 14176
304 nmdc:mga0k408_138116_c1 3300050493 Bacteria 1449
305 nmdc:mga0k408_82_c1 3300050493 Bacteria 45008
306 Ga0500651_0000058 3300053093 Bacteria 72493
307 Ga0500608_001755 3300053122 Bacteria 7747
308 Ga0500618_000018 3300053125 Bacteria 163272
309 Ga0500642_0127809 3300053130 Bacteria 1190
310 Ga0500616_0148437 3300053153 Bacteria 1088
311 Ga0500619_152739 3300053154 Bacteria 785
312 Ga0500624_000264 3300053157 Bacteria 18308
313 Ga0500634_0107602 3300053161 Bacteria 1383

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10010449 Ga0163162_100104494 214
2 3300005539 Ga0068853_100557572 Ga0068853_1005575722 221
3 3300005548 Ga0070665_100000061 Ga0070665_100000061157 221
4 3300013306 Ga0163162_10000012 Ga0163162_10000012207 221
5 3300028379 Ga0268266_10000053 Ga0268266_1000005347 221
6 3300046660 Ga0495625_0140575 Ga0495625_0140575_443_1156 221
7 3300005614 Ga0068856_100033530 Ga0068856_1000335306 222
8 3300026078 Ga0207702_10036427 Ga0207702_100364275 222
9 3300013104 Ga0157370_10041161 Ga0157370_100411615 223
10 3300047472 Ga0495686_0214089 Ga0495686_0214089_180_950 223
11 iso_pu_bacteria 2585427687 2586210189 225
12 iso_pu_bacteria 2738541283 2738756078 225
13 iso_pu_bacteria 2738541284 2738763298 225
14 iso_pu_bacteria 2738541302 2738852458 225
15 iso_pu_bacteria 2738543023 2739304160 225
16 iso_pu_bacteria 2739367651 2739591433 225
17 iso_pu_bacteria 2739367663 2739645622 225
18 iso_pu_bacteria 2775506987 2776616095 225
19 iso_pu_bacteria 2818991437 2819549585 225
20 iso_pu_bacteria 2842722452 2842727339 225
21 iso_pu_bacteria 2842909656 2842913736 225
22 iso_pu_bacteria 2849281842 2849285429 225
23 iso_pu_bacteria 2904445276 2904447282 225
24 iso_pu_bacteria 2919186247 2919190622 225
25 iso_pu_bacteria 2939664404 2939669168 225
26 iso_pu_bacteria 2945997725 2945998340 225
27 iso_pu_bacteria 2954016120 2954020805 225
28 3300001989 JGI24739J22299_10022622 JGI24739J22299_100226223 227
29 3300001990 JGI24737J22298_10000116 JGI24737J22298_1000011615 227
30 3300002067 JGI24735J21928_10000015 JGI24735J21928_1000001516 227
31 3300002077 JGI24744J21845_10004366 JGI24744J21845_100043664 227
32 3300003320 rootH2_10088336 rootH2_1008833610 227
33 3300003323 rootH1_10093161 rootH1_100931612 227
34 3300005328 Ga0070676_10001449 Ga0070676_1000144910 227
35 3300005338 Ga0068868_100008265 Ga0068868_1000082651 227
36 3300005339 Ga0070660_100003427 Ga0070660_10000342710 227
37 3300005355 Ga0070671_100011049 Ga0070671_1000110493 227
38 3300005364 Ga0070673_100003860 Ga0070673_1000038605 227
39 3300005563 Ga0068855_100000074 Ga0068855_1000000746 227
40 3300005563 Ga0068855_100017943 Ga0068855_1000179437 227
41 3300005614 Ga0068856_100046164 Ga0068856_1000461645 227
42 3300005614 Ga0068856_100411166 Ga0068856_1004111661 227
43 3300005616 Ga0068852_100271388 Ga0068852_1002713883 227
44 3300005840 Ga0068870_10425966 Ga0068870_104259661 227
45 3300006237 Ga0097621_100000016 Ga0097621_10000001669 227
46 3300006881 Ga0068865_100000214 Ga0068865_10000021412 227
47 3300006881 Ga0068865_100414713 Ga0068865_1004147131 227
48 3300009093 Ga0105240_10001333 Ga0105240_1000133314 227
49 3300009098 Ga0105245_10270770 Ga0105245_102707701 227
50 3300009174 Ga0105241_10056412 Ga0105241_100564121 227
51 3300009174 Ga0105241_10291119 Ga0105241_102911192 227
52 3300009545 Ga0105237_10003285 Ga0105237_1000328518 227
53 3300009551 Ga0105238_10446545 Ga0105238_104465452 227
54 3300010375 Ga0105239_10000009 Ga0105239_1000000914 227
55 3300013308 Ga0157375_10015032 Ga0157375_100150326 227
56 3300025907 Ga0207645_10000172 Ga0207645_1000017223 227
57 3300025908 Ga0207643_10039963 Ga0207643_100399631 227
58 3300025911 Ga0207654_10025928 Ga0207654_100259283 227
59 3300025911 Ga0207654_10316168 Ga0207654_103161682 227
60 3300025914 Ga0207671_10062514 Ga0207671_100625142 227
61 3300025914 Ga0207671_10361695 Ga0207671_103616951 227
62 3300025919 Ga0207657_10037592 Ga0207657_100375925 227
63 3300025924 Ga0207694_10018140 Ga0207694_100181403 227
64 3300025931 Ga0207644_10007855 Ga0207644_100078553 227
65 3300025938 Ga0207704_10000354 Ga0207704_1000035420 227
66 3300025938 Ga0207704_10281182 Ga0207704_102811821 227
67 3300025949 Ga0207667_10000014 Ga0207667_10000014100 227
68 3300025949 Ga0207667_10008386 Ga0207667_100083865 227
69 3300026023 Ga0207677_10095852 Ga0207677_100958522 227
70 3300026078 Ga0207702_10037437 Ga0207702_100374375 227
71 3300026078 Ga0207702_10355158 Ga0207702_103551583 227
72 3300026089 Ga0207648_10000658 Ga0207648_1000065826 227
73 3300026142 Ga0207698_10139536 Ga0207698_101395362 227
74 3300026142 Ga0207698_10463217 Ga0207698_104632172 227
75 3300037312 Ga0395899_0001270 Ga0395899_0001270_8030_8722 227
76 3300037418 Ga0395900_0002423 Ga0395900_0002423_3150_3842 227
77 3300037466 Ga0395898_0014682 Ga0395898_0014682_1564_2256 227
78 3300037471 Ga0395905_0001272 Ga0395905_0001272_18833_19525 227
79 3300038443 Ga0395901_0000644 Ga0395901_0000644_20883_21575 227
80 3300047443 Ga0495687_001100 Ga0495687_001100_13592_14284 227
81 3300047472 Ga0495686_0048542 Ga0495686_0048542_1388_2080 227
82 3300047472 Ga0495686_0382361 Ga0495686_0382361_15_731 227
83 iso_pu_bacteria 2599185184 2599481993 227
84 iso_pu_bacteria 2852623160 2852625521 227
85 iso_pu_bacteria 2884933994 2884934524 227
86 iso_pu_bacteria 2919437846 2919440532 227
87 iso_pu_bacteria 2928078545 2928082101 227
88 iso_pu_bacteria 2928147474 2928149321 227
89 iso_pu_bacteria 2932082852 2932087943 227
90 iso_pu_bacteria 2977232053 2977234204 227
91 3300003316 rootH1_10142970 rootH1_101429702 228
92 3300005614 Ga0068856_100872425 Ga0068856_1008724251 228
93 3300025981 Ga0207640_10283815 Ga0207640_102838151 228
94 3300046506 Ga0495583_0227772 Ga0495583_0227772_50_742 228
95 iso_pu_bacteria 2739367656 2739615251 228
96 iso_pu_bacteria 2857627736 2857628246 228
97 2162886007 SwRhRL2b_contig_2637238 SwRhRL2b_0412.00004930 229
98 3300001904 JGI24736J21556_1010516 JGI24736J21556_10105162 229
99 3300001989 JGI24739J22299_10011148 JGI24739J22299_100111485 229
100 3300002737 JGI25162J39368_1000016 JGI25162J39368_1000016183 229
101 3300002737 JGI25162J39368_1000866 JGI25162J39368_100086610 229
102 3300002741 JGI25157J39369_1005975 JGI25157J39369_10059752 229
103 3300002772 JGI25164J39214_1001979 JGI25164J39214_10019793 229
104 3300002773 JGI25152J39213_1001261 JGI25152J39213_10012617 229
105 3300002774 JGI25150J39212_1000023 JGI25150J39212_100002337 229
106 3300003187 JGI25151J46595_10000082 JGI25151J46595_1000008237 229
107 3300003214 JGI25165J46597_1001674 JGI25165J46597_10016742 229
108 3300003215 JGI25153J46596_10000060 JGI25153J46596_1000006038 229
109 3300003316 rootH1_10034433 rootH1_1003443312 229
110 3300003320 rootH2_10010159 rootH2_1001015913 229
111 3300003322 rootL2_10103558 rootL2_101035582 229
112 3300003322 rootL2_10103559 rootL2_101035592 229
113 3300003323 rootH1_10003399 rootH1_1000339921 229
114 3300003791 Ga0055530_10005053 Ga0055530_100050534 229
115 3300005288 Ga0065714_10002204 Ga0065714_1000220436 229
116 3300005288 Ga0065714_10004766 Ga0065714_100047666 229
117 3300005288 Ga0065714_10068860 Ga0065714_100688602 229
118 3300005288 Ga0065714_10115750 Ga0065714_101157502 229
119 3300005289 Ga0065704_10071596 Ga0065704_1007159610 229
120 3300005327 Ga0070658_10000008 Ga0070658_10000008249 229
121 3300005327 Ga0070658_10198972 Ga0070658_101989722 229
122 3300005338 Ga0068868_100125227 Ga0068868_1001252271 229
123 3300005339 Ga0070660_100052136 Ga0070660_1000521362 229
124 3300005339 Ga0070660_100077249 Ga0070660_1000772493 229
125 3300005356 Ga0070674_100086120 Ga0070674_1000861202 229
126 3300005366 Ga0070659_100000262 Ga0070659_10000026213 229
127 3300005458 Ga0070681_10048767 Ga0070681_100487672 229
128 3300005530 Ga0070679_100025582 Ga0070679_1000255829 229
129 3300005530 Ga0070679_100161783 Ga0070679_1001617832 229
130 3300005539 Ga0068853_100277951 Ga0068853_1002779512 229
131 3300005563 Ga0068855_100023953 Ga0068855_1000239532 229
132 3300005563 Ga0068855_100169238 Ga0068855_1001692384 229
133 3300005563 Ga0068855_100218090 Ga0068855_1002180903 229
134 3300005563 Ga0068855_100633528 Ga0068855_1006335282 229
135 3300005614 Ga0068856_100000385 Ga0068856_10000038528 229
136 3300005842 Ga0068858_100126757 Ga0068858_1001267572 229
137 3300006195 Ga0075366_10000170 Ga0075366_100001709 229
138 3300006195 Ga0075366_10005159 Ga0075366_100051592 229
139 3300006195 Ga0075366_10171574 Ga0075366_101715742 229
140 3300009036 Ga0105244_10002729 Ga0105244_100027294 229
141 3300009093 Ga0105240_10000082 Ga0105240_1000008255 229
142 3300009093 Ga0105240_10039625 Ga0105240_100396255 229
143 3300009093 Ga0105240_10125146 Ga0105240_101251463 229
144 3300009093 Ga0105240_10158107 Ga0105240_101581073 229
145 3300009093 Ga0105240_10310430 Ga0105240_103104301 229
146 3300009093 Ga0105240_10312294 Ga0105240_103122943 229
147 3300009093 Ga0105240_10565856 Ga0105240_105658562 229
148 3300009174 Ga0105241_10000116 Ga0105241_1000011648 229
149 3300009174 Ga0105241_10090257 Ga0105241_100902572 229
150 3300009176 Ga0105242_10080767 Ga0105242_100807673 229
151 3300009545 Ga0105237_10000310 Ga0105237_1000031026 229
152 3300009545 Ga0105237_10002729 Ga0105237_1000272920 229
153 3300009545 Ga0105237_10003434 Ga0105237_1000343418 229
154 3300009545 Ga0105237_10009371 Ga0105237_1000937110 229
155 3300009545 Ga0105237_10029215 Ga0105237_100292155 229
156 3300009545 Ga0105237_10225948 Ga0105237_102259482 229
157 3300009545 Ga0105237_10544806 Ga0105237_105448062 229
158 3300009551 Ga0105238_10158642 Ga0105238_101586421 229
159 3300009551 Ga0105238_10173035 Ga0105238_101730352 229
160 3300010375 Ga0105239_10000049 Ga0105239_10000049105 229
161 3300010375 Ga0105239_10003303 Ga0105239_1000330325 229
162 3300010375 Ga0105239_10008608 Ga0105239_100086087 229
163 3300010375 Ga0105239_10008871 Ga0105239_100088714 229
164 3300010375 Ga0105239_10028319 Ga0105239_100283192 229
165 3300011119 Ga0105246_10009914 Ga0105246_100099143 229
166 3300013100 Ga0157373_10000089 Ga0157373_1000008926 229
167 3300013100 Ga0157373_10019892 Ga0157373_100198925 229
168 3300013100 Ga0157373_10025928 Ga0157373_100259284 229
169 3300013100 Ga0157373_10035857 Ga0157373_100358573 229
170 3300013100 Ga0157373_10064145 Ga0157373_100641453 229
171 3300013102 Ga0157371_10000025 Ga0157371_10000025237 229
172 3300013102 Ga0157371_10003959 Ga0157371_100039595 229
173 3300013102 Ga0157371_10005219 Ga0157371_1000521910 229
174 3300013102 Ga0157371_10010298 Ga0157371_100102983 229
175 3300013102 Ga0157371_10013702 Ga0157371_100137026 229
176 3300013102 Ga0157371_10101392 Ga0157371_101013923 229
177 3300013102 Ga0157371_10113390 Ga0157371_101133901 229
178 3300013104 Ga0157370_10004723 Ga0157370_100047234 229
179 3300013104 Ga0157370_10043930 Ga0157370_100439304 229
180 3300013104 Ga0157370_10056152 Ga0157370_100561522 229
181 3300013104 Ga0157370_10076327 Ga0157370_100763274 229
182 3300013104 Ga0157370_10234196 Ga0157370_102341962 229
183 3300013105 Ga0157369_10000038 Ga0157369_1000003824 229
184 3300013105 Ga0157369_10004248 Ga0157369_100042485 229
185 3300013105 Ga0157369_10044949 Ga0157369_100449494 229
186 3300013105 Ga0157369_10182414 Ga0157369_101824142 229
187 3300013105 Ga0157369_10254865 Ga0157369_102548652 229
188 3300013296 Ga0157374_10522425 Ga0157374_105224251 229
189 3300013297 Ga0157378_10006650 Ga0157378_1000665010 229
190 3300013297 Ga0157378_10082618 Ga0157378_100826183 229
191 3300013297 Ga0157378_10636334 Ga0157378_106363342 229
192 3300013306 Ga0163162_10000050 Ga0163162_100000501 229
193 3300013306 Ga0163162_10002529 Ga0163162_1000252917 229
194 3300013306 Ga0163162_10273134 Ga0163162_102731342 229
195 3300013307 Ga0157372_10000039 Ga0157372_1000003968 229
196 3300013307 Ga0157372_10001390 Ga0157372_1000139021 229
197 3300013308 Ga0157375_10014406 Ga0157375_100144068 229
198 3300013308 Ga0157375_10087403 Ga0157375_100874032 229
199 3300013308 Ga0157375_10152227 Ga0157375_101522272 229
200 3300013308 Ga0157375_10632293 Ga0157375_106322932 229
201 3300013308 Ga0157375_10977899 Ga0157375_109778992 229
202 3300014497 Ga0182008_10000020 Ga0182008_10000020142 229
203 3300014497 Ga0182008_10000052 Ga0182008_1000005269 229
204 3300014497 Ga0182008_10000053 Ga0182008_1000005388 229
205 3300014497 Ga0182008_10033524 Ga0182008_100335242 229
206 3300014497 Ga0182008_10041675 Ga0182008_100416752 229
207 3300015261 Ga0182006_1000276 Ga0182006_100027622 229
208 3300015261 Ga0182006_1000555 Ga0182006_100055521 229
209 3300015262 Ga0182007_10000024 Ga0182007_1000002463 229
210 3300015262 Ga0182007_10027559 Ga0182007_100275592 229
211 3300015262 Ga0182007_10050065 Ga0182007_100500652 229
212 3300015682 Ga0183373_1002 Ga0183373_100266 229
213 3300017792 Ga0163161_10000093 Ga0163161_1000009364 229
214 3300017792 Ga0163161_10000145 Ga0163161_1000014545 229
215 3300017792 Ga0163161_10010007 Ga0163161_100100074 229
216 3300017792 Ga0163161_10030141 Ga0163161_100301413 229
217 3300017792 Ga0163161_10044855 Ga0163161_100448554 229
218 3300025231 Ga0207427_100122 Ga0207427_10012281 229
219 3300025233 Ga0209437_100048 Ga0209437_100048215 229
220 3300025233 Ga0209437_100119 Ga0209437_100119100 229
221 3300025245 Ga0207425_1000051 Ga0207425_100005170 229
222 3300025250 Ga0209026_1000304 Ga0209026_100030420 229
223 3300025258 Ga0209129_1000121 Ga0209129_100012137 229
224 3300025261 Ga0209233_1000029 Ga0209233_1000029161 229
225 3300025272 Ga0209455_1004796 Ga0209455_10047962 229
226 3300025292 Ga0209676_1000022 Ga0209676_100002260 229
227 3300025294 Ga0209025_1000160 Ga0209025_100016090 229
228 3300025297 Ga0209758_1000147 Ga0209758_100014790 229
229 3300025298 Ga0209050_1000020 Ga0209050_1000020480 229
230 3300025728 Ga0207655_1037965 Ga0207655_10379652 229
231 3300025904 Ga0207647_10000018 Ga0207647_1000001852 229
232 3300025909 Ga0207705_10000026 Ga0207705_10000026250 229
233 3300025909 Ga0207705_10072897 Ga0207705_100728973 229
234 3300025911 Ga0207654_10004989 Ga0207654_100049893 229
235 3300025912 Ga0207707_10216583 Ga0207707_102165832 229
236 3300025913 Ga0207695_10000053 Ga0207695_10000053296 229
237 3300025913 Ga0207695_10006832 Ga0207695_1000683216 229
238 3300025913 Ga0207695_10085426 Ga0207695_100854263 229
239 3300025913 Ga0207695_10133422 Ga0207695_101334221 229
240 3300025913 Ga0207695_10156606 Ga0207695_101566063 229
241 3300025913 Ga0207695_10225457 Ga0207695_102254572 229
242 3300025914 Ga0207671_10000366 Ga0207671_1000036639 229
243 3300025914 Ga0207671_10000925 Ga0207671_1000092519 229
244 3300025914 Ga0207671_10001993 Ga0207671_100019933 229
245 3300025914 Ga0207671_10007835 Ga0207671_1000783511 229
246 3300025914 Ga0207671_10012842 Ga0207671_100128426 229
247 3300025919 Ga0207657_10058404 Ga0207657_100584043 229
248 3300025921 Ga0207652_10044645 Ga0207652_100446453 229
249 3300025921 Ga0207652_10059778 Ga0207652_100597785 229
250 3300025924 Ga0207694_10105659 Ga0207694_101056592 229
251 3300025932 Ga0207690_10001178 Ga0207690_100011785 229
252 3300025937 Ga0207669_10366387 Ga0207669_103663872 229
253 3300025949 Ga0207667_10000274 Ga0207667_1000027444 229
254 3300025949 Ga0207667_10081323 Ga0207667_100813235 229
255 3300025949 Ga0207667_10151939 Ga0207667_101519392 229
256 3300026023 Ga0207677_10103870 Ga0207677_101038701 229
257 3300026078 Ga0207702_10000586 Ga0207702_1000058623 229
258 3300026078 Ga0207702_10192155 Ga0207702_101921552 229
259 3300028794 Ga0307515_10000316 Ga0307515_1000031689 229
260 3300028794 Ga0307515_10001308 Ga0307515_1000130825 229
261 3300028794 Ga0307515_10164591 Ga0307515_101645913 229
262 3300030744 Ga0316181_1276095 Ga0316181_12760953 229
263 3300031731 Ga0307405_10000011 Ga0307405_1000001157 229
264 3300031903 Ga0307407_10000018 Ga0307407_1000001825 229
265 3300031911 Ga0307412_10000001 Ga0307412_10000001253 229
266 3300031995 Ga0307409_100229006 Ga0307409_1002290063 229
267 3300032002 Ga0307416_100000050 Ga0307416_10000005087 229
268 3300032004 Ga0307414_10000980 Ga0307414_100009807 229
269 3300032004 Ga0307414_10002018 Ga0307414_100020185 229
270 3300032004 Ga0307414_10002147 Ga0307414_100021473 229
271 3300032004 Ga0307414_10091685 Ga0307414_100916851 229
272 3300032005 Ga0307411_10404091 Ga0307411_104040911 229
273 3300037312 Ga0395899_0000027 Ga0395899_0000027_166289_166996 229
274 3300037312 Ga0395899_0000282 Ga0395899_0000282_62205_62930 229
275 3300037418 Ga0395900_0009107 Ga0395900_0009107_2912_3619 229
276 3300037471 Ga0395905_0000993 Ga0395905_0000993_24930_25637 229
277 3300038443 Ga0395901_0005293 Ga0395901_0005293_7170_7877 229
278 3300042005 Ga0439448_0083966 Ga0439448_0083966_271_1002 229
279 3300044684 Ga0466966_0199733 Ga0466966_0199733_459_1193 229
280 3300045049 Ga0466959_0186441 Ga0466959_0186441_319_1038 229
281 3300046471 Ga0495650_0000144 Ga0495650_0000144_114922_115656 229
282 3300046471 Ga0495650_0064590 Ga0495650_0064590_344_1054 229
283 3300046474 Ga0495605_0219450 Ga0495605_0219450_64_771 229
284 3300046492 Ga0495585_0000091 Ga0495585_0000091_52789_53619 229
285 3300046492 Ga0495585_0000658 Ga0495585_0000658_18390_19133 229
286 3300046507 Ga0495606_0000919 Ga0495606_0000919_39058_39792 229
287 3300046507 Ga0495606_0013016 Ga0495606_0013016_3501_4193 229
288 3300046507 Ga0495606_0021189 Ga0495606_0021189_371_1066 229
289 3300046507 Ga0495606_0021269 Ga0495606_0021269_1277_1966 229
290 3300046507 Ga0495606_0060821 Ga0495606_0060821_655_1383 229
291 3300046512 Ga0495610_0000037 Ga0495610_0000037_22772_23461 229
292 3300046512 Ga0495610_0000574 Ga0495610_0000574_5267_5956 229
293 3300046512 Ga0495610_0008174 Ga0495610_0008174_771_1505 229
294 3300046513 Ga0495616_0011104 Ga0495616_0011104_1602_2297 229
295 3300046513 Ga0495616_0011972 Ga0495616_0011972_3387_4082 229
296 3300046516 Ga0495628_0346181 Ga0495628_0346181_94_837 229
297 3300046518 Ga0495631_0120043 Ga0495631_0120043_59_787 229
298 3300046519 Ga0495632_0038573 Ga0495632_0038573_671_1366 229
299 3300046524 Ga0495648_0018526 Ga0495648_0018526_3076_3771 229
300 3300046524 Ga0495648_0048395 Ga0495648_0048395_352_1095 229
301 3300046529 Ga0495652_0398694 Ga0495652_0398694_95_826 229
302 3300046530 Ga0495654_0050503 Ga0495654_0050503_909_1652 229
303 3300046538 Ga0495609_0014382 Ga0495609_0014382_1077_1805 229
304 3300046538 Ga0495609_0082021 Ga0495609_0082021_435_1169 229
305 3300046558 Ga0495633_0000026 Ga0495633_0000026_142392_143114 229
306 3300046558 Ga0495633_0007299 Ga0495633_0007299_2763_3497 229
307 3300046558 Ga0495633_0088382 Ga0495633_0088382_540_1229 229
308 3300046616 Ga0495668_0000054 Ga0495668_0000054_112351_113079 229
309 3300046616 Ga0495668_0081772 Ga0495668_0081772_998_1732 229
310 3300046660 Ga0495625_0000059 Ga0495625_0000059_61109_61804 229
311 3300046660 Ga0495625_0001227 Ga0495625_0001227_12514_13242 229
312 3300046660 Ga0495625_0003592 Ga0495625_0003592_4465_5208 229
313 3300046660 Ga0495625_0032221 Ga0495625_0032221_1718_2413 229
314 3300046660 Ga0495625_0116599 Ga0495625_0116599_414_1109 229
315 3300046665 Ga0495661_0003215 Ga0495661_0003215_2961_3677 229
316 3300046665 Ga0495661_0041449 Ga0495661_0041449_1046_1774 229
317 3300046665 Ga0495661_0052128 Ga0495661_0052128_747_1481 229
318 3300046665 Ga0495661_0076061 Ga0495661_0076061_59_793 229
319 3300046683 Ga0495658_0228031 Ga0495658_0228031_99_842 229
320 3300046692 Ga0495671_0102572 Ga0495671_0102572_643_1377 229
321 3300047443 Ga0495687_042827 Ga0495687_042827_30_725 229
322 3300047472 Ga0495686_0002591 Ga0495686_0002591_11658_12368 229
323 3300048925 Ga0496122_0000876 Ga0496122_0000876_36707_37396 229
324 3300048926 Ga0496123_0000777 Ga0496123_0000777_46243_46932 229
325 3300049459 Ga0495678_008057 Ga0495678_008057_1364_2059 229
326 3300049459 Ga0495678_068679 Ga0495678_068679_445_1146 229
327 3300049460 Ga0495682_0030456 Ga0495682_0030456_976_1719 229
328 3300049679 Ga0501249_004504 Ga0501249_004504_18_707 229
329 3300049758 Ga0501241_007237 Ga0501241_007237_1017_1706 229
330 3300050493 nmdc:mga0k408_1202_c1 nmdc:mga0k408_1202_c1_11851_12555 229
331 3300050493 nmdc:mga0k408_138116_c1 nmdc:mga0k408_138116_c1_448_1143 229
332 3300050493 nmdc:mga0k408_82_c1 nmdc:mga0k408_82_c1_2811_3539 229
333 3300053093 Ga0500651_0000058 Ga0500651_0000058_71624_72313 229
334 3300053122 Ga0500608_001755 Ga0500608_001755_6806_7501 229
335 3300053125 Ga0500618_000018 Ga0500618_000018_108985_109686 229
336 3300053130 Ga0500642_0127809 Ga0500642_0127809_442_1137 229
337 3300053153 Ga0500616_0148437 Ga0500616_0148437_333_1028 229
338 3300053154 Ga0500619_152739 Ga0500619_152739_15_743 229
339 3300053157 Ga0500624_000264 Ga0500624_000264_10960_11652 229
340 3300053161 Ga0500634_0107602 Ga0500634_0107602_192_881 229

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13242

Hydrolase_like

HAD-hyrolase-like

207

255

0.96

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

59

248

0.75

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

62

254

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.9265 2 228
3qnm-assembly1.cif.gz_A haloalkane dehalogenase family member from bacteroides thetaiotaomicron of unknown function 0.915 2 228
3i76-assembly1.cif.gz_A the crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement 0.9096 2 228
8i8b-assembly1.cif.gz_J outer shell and inner layer structures of autographa californica multiple nucleopolyhedrovirus (acmnpv) 0.8972 107 152
3i76-assembly1.cif.gz_A the crystal structure of the orthorhombic form of the putative had-hydrolase yfnb from bacillus subtilis bound to magnesium reveals interdomain movement 0.8865 2 228
ID Description Score Start End Superfamily
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.933 105 205 3.40.50.1000
3cnhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9306 110 203 3.40.50.1000
3i76A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9299 107 228 3.40.50.1000
af_Q7T012_106_236_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9292 105 225 3.40.50.1000
2no5A01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.922 106 225 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A4V2MRF0-F1-model_v4 Noncanonical pyrimidine nucleotidase, YjjG family 0.9975 1 229 GO:0008253
AF-A0A6M1Q7G1-F1-model_v4 deleted 0.9961 94 229
AF-A0A7X6BSP4-F1-model_v4 deleted 0.9849 2 229
AF-A0A7T9NJJ7-F1-model_v4 deleted 0.9836 2 229
AF-A0A6M1Q7G1-F1-model_v4 deleted 0.9817 94 229

Feature Viewer

pLDDT pTM Quality
96.8 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map