F414241

General Info

Members Datasets Scaffolds Average Seq Length
340 188 680 163

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100127867|Ga0070705_1001278672
Length 188
Sequence LTIPNESVTLRADVRSGRLYLKTYWSMAESSFDVVSSVDLQEVKNAIAQAMKEIVTRFDLKGTGSDVGLQGEEIVLASSDEFKLKAVRDVLETRLVKRNVPLKALTWGTVEKALGGTARQNVSLQKGIPSEKAREVVKLIKGTKLKVQAAIQGDQVRVSGKNRDDLQAVIRLLKETDLGIDMQFTNYR

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
60 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
61 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
96 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
138 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
139 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
140 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
146 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
150 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
167 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
180 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
181 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
187 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.53
Metatranscriptomes 1.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0
Rhizoplane 0
Rhizosphere 92.94
Stem 0
Stem Tuber 0
Unclassified 1.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100127867 3300005440 Bacteria 1652
2 Ga0065715_10996630 3300005293 Bacteria 546
3 Ga0070658_10297303 3300005327 Bacteria 1376
4 Ga0070683_100019941 3300005329 Bacteria 5960
5 Ga0070690_100058932 3300005330 Bacteria 2467
6 Ga0070690_100306728 3300005330 Bacteria 1140
7 Ga0068869_100058699 3300005334 Bacteria 2814
8 Ga0070680_100388979 3300005336 Bacteria 1188
9 Ga0070682_101171550 3300005337 Bacteria 647
10 Ga0068868_100344423 3300005338 Bacteria 1275
11 Ga0070660_100172654 3300005339 Bacteria 1747
12 Ga0070689_100067665 3300005340 Bacteria 2785
13 Ga0070689_100125117 3300005340 Bacteria 2056
14 Ga0070687_100108259 3300005343 Bacteria 1568
15 Ga0070692_10530922 3300005345 Bacteria 767
16 Ga0070669_100665812 3300005353 Bacteria 877
17 Ga0070675_100040754 3300005354 Bacteria 3792
18 Ga0070671_100684651 3300005355 Bacteria 889
19 Ga0070674_100297405 3300005356 Bacteria 1285
20 Ga0070673_100118726 3300005364 Bacteria 2202
21 Ga0070673_100230114 3300005364 Bacteria 1608
22 Ga0070688_100056140 3300005365 Bacteria 2472
23 Ga0070688_100161425 3300005365 Bacteria 1540
24 Ga0070659_100924925 3300005366 Bacteria 763
25 Ga0070667_100072554 3300005367 Bacteria 2934
26 Ga0070703_10196471 3300005406 Bacteria 789
27 Ga0070710_11097144 3300005437 Bacteria 584
28 Ga0070701_10039329 3300005438 Bacteria 2398
29 Ga0070701_10122694 3300005438 Bacteria 1466
30 Ga0070701_10126629 3300005438 Bacteria 1446
31 Ga0070705_100085242 3300005440 Bacteria 1952
32 Ga0070705_100481368 3300005440 Bacteria 938
33 Ga0070705_100573806 3300005440 Bacteria 868
34 Ga0070700_100099469 3300005441 Bacteria 1913
35 Ga0070700_100115672 3300005441 Bacteria 1790
36 Ga0070700_100866850 3300005441 Bacteria 732
37 Ga0070694_100050218 3300005444 Bacteria 2811
38 Ga0070663_100019888 3300005455 Bacteria 4434
39 Ga0070663_100324525 3300005455 Bacteria 1239
40 Ga0070678_100121578 3300005456 Bacteria 2060
41 Ga0070678_100754658 3300005456 Bacteria 880
42 Ga0070681_10268983 3300005458 Bacteria 1616
43 Ga0068867_100133756 3300005459 Bacteria 1930
44 Ga0068867_100154825 3300005459 Bacteria 1803
45 Ga0068867_100317174 3300005459 Bacteria 1290
46 Ga0070685_10041803 3300005466 Bacteria 2613
47 Ga0070706_100220778 3300005467 Bacteria 1769
48 Ga0070706_100398630 3300005467 Bacteria 1281
49 Ga0070706_100442032 3300005467 Bacteria 1210
50 Ga0070706_100533243 3300005467 Bacteria 1092
51 Ga0070707_100043806 3300005468 Bacteria 4283
52 Ga0070698_100134601 3300005471 Bacteria 2425
53 Ga0070698_100170065 3300005471 Bacteria 2120
54 Ga0070699_100177777 3300005518 Bacteria 1888
55 Ga0070684_100238851 3300005535 Unclassified 1660
56 Ga0070697_100048143 3300005536 Bacteria 3457
57 Ga0070697_100048619 3300005536 Bacteria 3439
58 Ga0070697_100679721 3300005536 Bacteria 907
59 Ga0070672_100869479 3300005543 Bacteria 795
60 Ga0070686_100069215 3300005544 Bacteria 2304
61 Ga0070686_100277849 3300005544 Bacteria 1234
62 Ga0070686_100439111 3300005544 Bacteria 1001
63 Ga0070695_100043781 3300005545 Bacteria 2848
64 Ga0070695_100548708 3300005545 Bacteria 901
65 Ga0070696_100237957 3300005546 Bacteria 1372
66 Ga0070696_100911171 3300005546 Bacteria 730
67 Ga0070665_101131455 3300005548 Bacteria 794
68 Ga0070704_100109985 3300005549 Bacteria 2095
69 Ga0070704_100166174 3300005549 Bacteria 1750
70 Ga0070704_100170673 3300005549 Bacteria 1730
71 Ga0070704_100274128 3300005549 Bacteria 1395
72 Ga0070704_100416429 3300005549 Bacteria 1150
73 Ga0070704_100528731 3300005549 Bacteria 1027
74 Ga0070704_100739433 3300005549 Bacteria 875
75 Ga0070664_100108762 3300005564 Bacteria 2418
76 Ga0068857_100197592 3300005577 Bacteria 1833
77 Ga0068854_100671051 3300005578 Bacteria 892
78 Ga0070702_100071324 3300005615 Bacteria 2053
79 Ga0070702_100759002 3300005615 Bacteria 746
80 Ga0068859_100053435 3300005617 Bacteria 4063
81 Ga0068859_100096556 3300005617 Bacteria 3008
82 Ga0068864_100098405 3300005618 Bacteria 2591
83 Ga0068866_10449638 3300005718 Bacteria 842
84 Ga0068861_100005301 3300005719 Bacteria 8703
85 Ga0068861_100056553 3300005719 Bacteria 2995
86 Ga0068870_10176898 3300005840 Bacteria 1278
87 Ga0068870_10240350 3300005840 Bacteria 1118
88 Ga0068863_100189115 3300005841 Bacteria 1978
89 Ga0068858_100017283 3300005842 Bacteria 6767
90 Ga0068858_100381801 3300005842 Bacteria 1352
91 Ga0068860_101803241 3300005843 Bacteria 634
92 Ga0068862_100039358 3300005844 Bacteria 4015
93 Ga0068862_100796200 3300005844 Bacteria 923
94 Ga0068862_100826770 3300005844 Bacteria 906
95 Ga0068862_101171270 3300005844 Bacteria 766
96 Ga0070717_10000082 3300006028 Bacteria 77627
97 Ga0075365_10118872 3300006038 Bacteria 1822
98 Ga0075368_10010425 3300006042 Bacteria 3359
99 Ga0075363_100855615 3300006048 Bacteria 555
100 Ga0075364_10360970 3300006051 Bacteria 990
101 Ga0075362_10006989 3300006177 Bacteria 4238
102 Ga0075367_10003806 3300006178 Bacteria 7272
103 Ga0075367_10121493 3300006178 Bacteria 1610
104 Ga0075367_10137055 3300006178 Bacteria 1515
105 Ga0075366_10000098 3300006195 Bacteria 35338
106 Ga0097621_102198110 3300006237 Bacteria 528
107 Ga0075370_10156002 3300006353 Bacteria 1338
108 Ga0075428_100024785 3300006844 Bacteria 6637
109 Ga0075428_100064759 3300006844 Bacteria 4004
110 Ga0075428_100081414 3300006844 Bacteria 3533
111 Ga0075428_100229606 3300006844 Bacteria 2003
112 Ga0075428_100363882 3300006844 Bacteria 1551
113 Ga0075428_101306008 3300006844 Bacteria 763
114 Ga0075430_100722640 3300006846 Bacteria 821
115 Ga0075431_100014496 3300006847 Bacteria 7974
116 Ga0075431_100104136 3300006847 Bacteria 2928
117 Ga0075431_100594935 3300006847 Bacteria 1091
118 Ga0075433_10025015 3300006852 Bacteria 5045
119 Ga0075433_10135678 3300006852 Bacteria 2187
120 Ga0075433_10217513 3300006852 Bacteria 1697
121 Ga0075433_10325723 3300006852 Bacteria 1359
122 Ga0075434_100320041 3300006871 Bacteria 1572
123 Ga0075434_100402229 3300006871 Bacteria 1390
124 Ga0075434_100443271 3300006871 Bacteria 1320
125 Ga0075434_101153077 3300006871 Bacteria 788
126 Ga0075429_100060880 3300006880 Bacteria 3288
127 Ga0075429_100065675 3300006880 Bacteria 3159
128 Ga0075429_100134560 3300006880 Bacteria 2163
129 Ga0075429_100485480 3300006880 Bacteria 1082
130 Ga0068865_100131792 3300006881 Bacteria 1874
131 Ga0068865_101143773 3300006881 Bacteria 687
132 Ga0075436_100012717 3300006914 Bacteria 5769
133 Ga0097620_100053436 3300006931 Bacteria 4063
134 Ga0097620_100096555 3300006931 Bacteria 3008
135 Ga0075435_100015832 3300007076 Bacteria 5676
136 Ga0075435_100454419 3300007076 Bacteria 1105
137 Ga0111539_10000913 3300009094 Bacteria 38603
138 Ga0111539_10070730 3300009094 Bacteria 4119
139 Ga0111539_10093083 3300009094 Bacteria 3541
140 Ga0111539_10168681 3300009094 Bacteria 2558
141 Ga0105245_10886186 3300009098 Bacteria 933
142 Ga0114129_10010351 3300009147 Bacteria 13300
143 Ga0114129_10011985 3300009147 Bacteria 12331
144 Ga0114129_10037621 3300009147 Bacteria 6832
145 Ga0114129_10118139 3300009147 Bacteria 3653
146 Ga0114129_10134195 3300009147 Bacteria 3398
147 Ga0114129_10178645 3300009147 Bacteria 2890
148 Ga0114129_10320604 3300009147 Bacteria 2060
149 Ga0114129_10490522 3300009147 Bacteria 1606
150 Ga0114129_10607577 3300009147 Bacteria 1416
151 Ga0114129_10896739 3300009147 Bacteria 1124
152 Ga0105243_10254917 3300009148 Bacteria 1568
153 Ga0105243_10617846 3300009148 Bacteria 1046
154 Ga0105242_10002139 3300009176 Bacteria 15595
155 Ga0105242_10753530 3300009176 Bacteria 959
156 Ga0105248_10150187 3300009177 Bacteria 2628
157 Ga0105238_10552178 3300009551 Bacteria 1156
158 Ga0105249_10022016 3300009553 Bacteria 5708
159 Ga0099796_10325420 3300010159 Unclassified 657
160 Ga0105239_10774773 3300010375 Bacteria 1098
161 Ga0157378_10327215 3300013297 Bacteria 1490
162 Ga0163162_10562746 3300013306 Bacteria 1268
163 Ga0157375_10157539 3300013308 Bacteria 2410
164 Ga0157375_10724802 3300013308 Bacteria 1147
165 Ga0163163_10019528 3300014325 Bacteria 6366
166 Ga0163163_10282652 3300014325 Bacteria 1711
167 Ga0157380_10011162 3300014326 Bacteria 6483
168 Ga0157380_10231931 3300014326 Bacteria 1659
169 Ga0157380_10255244 3300014326 Bacteria 1589
170 Ga0157380_11393990 3300014326 Bacteria 751
171 Ga0157377_10045194 3300014745 Bacteria 2459
172 Ga0157379_10065237 3300014968 Bacteria 3255
173 Ga0157379_10423269 3300014968 Bacteria 1226
174 Ga0206356_11855830 3300020070 Bacteria 1317
175 Ga0206355_1021107 3300020076 Bacteria 572
176 Ga0206351_10125882 3300020077 Bacteria 583
177 Ga0206350_10566547 3300020080 Bacteria 1064
178 Ga0224712_10050037 3300022467 Bacteria 1621
179 Ga0207653_10023787 3300025885 Bacteria 1953
180 Ga0207653_10077020 3300025885 Bacteria 1148
181 Ga0207645_10049944 3300025907 Bacteria 2671
182 Ga0207643_10077397 3300025908 Bacteria 1923
183 Ga0207643_10099139 3300025908 Bacteria 1707
184 Ga0207684_10113068 3300025910 Bacteria 2324
185 Ga0207684_10544056 3300025910 Bacteria 994
186 Ga0207707_10714691 3300025912 Bacteria 840
187 Ga0207662_10022420 3300025918 Bacteria 3621
188 Ga0207657_10186397 3300025919 Bacteria 1675
189 Ga0207646_10003769 3300025922 Bacteria 16896
190 Ga0207646_10019172 3300025922 Bacteria 6360
191 Ga0207681_10204279 3300025923 Bacteria 1519
192 Ga0207681_10243531 3300025923 Bacteria 1401
193 Ga0207694_10583446 3300025924 Bacteria 940
194 Ga0207659_10107135 3300025926 Bacteria 2117
195 Ga0207706_10247459 3300025933 Bacteria 1558
196 Ga0207706_10297220 3300025933 Bacteria 1407
197 Ga0207709_10117066 3300025935 Bacteria 1793
198 Ga0207709_10158150 3300025935 Bacteria 1577
199 Ga0207670_10075242 3300025936 Bacteria 2347
200 Ga0207670_10429529 3300025936 Bacteria 1061
201 Ga0207669_10480370 3300025937 Bacteria 990
202 Ga0207704_10396865 3300025938 Bacteria 1087
203 Ga0207691_10044443 3300025940 Bacteria 4090
204 Ga0207691_10728119 3300025940 Bacteria 836
205 Ga0207711_10143954 3300025941 Bacteria 2146
206 Ga0207711_10645581 3300025941 Bacteria 987
207 Ga0207689_10089388 3300025942 Bacteria 2530
208 Ga0207661_10051652 3300025944 Bacteria 3281
209 Ga0207679_10636481 3300025945 Bacteria 964
210 Ga0207651_10374350 3300025960 Bacteria 1205
211 Ga0207651_10713458 3300025960 Bacteria 884
212 Ga0207712_10028106 3300025961 Bacteria 3760
213 Ga0207712_10115757 3300025961 Bacteria 2019
214 Ga0207668_10742683 3300025972 Bacteria 865
215 Ga0207658_10119830 3300025986 Bacteria 2096
216 Ga0207677_10247932 3300026023 Bacteria 1445
217 Ga0207678_10013271 3300026067 Bacteria 7228
218 Ga0207678_10490470 3300026067 Bacteria 1070
219 Ga0207708_10074688 3300026075 Bacteria 2598
220 Ga0207708_10100604 3300026075 Bacteria 2237
221 Ga0207708_10128187 3300026075 Bacteria 1982
222 Ga0207708_10678448 3300026075 Bacteria 879
223 Ga0207641_10036902 3300026088 Bacteria 4080
224 Ga0207641_10485581 3300026088 Unclassified 1198
225 Ga0207648_10030077 3300026089 Bacteria 4815
226 Ga0207648_10191970 3300026089 Bacteria 1810
227 Ga0207648_10349188 3300026089 Bacteria 1333
228 Ga0207676_10588499 3300026095 Bacteria 1067
229 Ga0207674_10132001 3300026116 Bacteria 2460
230 Ga0207675_100022317 3300026118 Bacteria 5894
231 Ga0207675_100114711 3300026118 Bacteria 2545
232 Ga0207675_100129416 3300026118 Bacteria 2393
233 Ga0207683_10243029 3300026121 Bacteria 1642
234 Ga0207683_10339857 3300026121 Bacteria 1377
235 Ga0209813_10075255 3300027866 Bacteria 1106
236 Ga0207428_10000076 3300027907 Bacteria 137126
237 Ga0207428_10059413 3300027907 Bacteria 3032
238 Ga0207428_10371654 3300027907 Bacteria 1050
239 Ga0268266_11180747 3300028379 Bacteria 740
240 Ga0268264_11437913 3300028381 Bacteria 700
241 Ga0316576_10053638 3300031727 Bacteria 2938
242 Ga0316576_10436071 3300031727 Bacteria 969
243 Ga0316577_10377039 3300031733 Bacteria 806
244 Ga0316580_10099811 3300032139 Bacteria 889
245 Ga0373948_0058745 3300034817 Bacteria 841
246 Ga0316574_0002529 3300035398 Bacteria 9194
247 Ga0316574_0126957 3300035398 Bacteria 1640
248 Ga0316574_0340106 3300035398 Bacteria 951
249 Ga0373931_0882767 3300035691 Bacteria 600
250 Ga0316582_0153993 3300036647 Bacteria 1555
251 Ga0453684_0022043 3300044712 Bacteria 9476
252 Ga0453684_0577009 3300044712 Bacteria 1236
253 Ga0453684_0695391 3300044712 Bacteria 1105
254 Ga0466960_0195945 3300044901 Bacteria 1101
255 Ga0495638_0113648 3300046460 Bacteria 1606
256 Ga0495656_0148574 3300046615 Bacteria 1130
257 Ga0495649_0239283 3300046694 Bacteria 935
258 Ga0495677_0123248 3300047445 Bacteria 989
259 Ga0501031_0019070 3300049568 Bacteria 4466
260 Ga0501032_0653230 3300049569 Bacteria 668
261 Ga0501033_0823557 3300049570 Bacteria 627
262 Ga0501036_0026734 3300049572 Bacteria 4875
263 Ga0501039_0044038 3300049575 Bacteria 3447
264 Ga0501040_0345897 3300049576 Bacteria 1065
265 Ga0501041_0076662 3300049577 Bacteria 2057
266 Ga0501041_0521749 3300049577 Bacteria 756
267 Ga0501042_0065696 3300049578 Bacteria 2592
268 Ga0501042_0512481 3300049578 Bacteria 871
269 Ga0501048_0024762 3300049582 Bacteria 4378
270 Ga0501068_0743698 3300049584 Bacteria 642
271 Ga0501071_0015837 3300049587 Bacteria 5179
272 Ga0501071_0596458 3300049587 Bacteria 849
273 Ga0501072_0079243 3300049588 Bacteria 2601
274 Ga0501072_0489648 3300049588 Bacteria 973
275 Ga0501072_1064763 3300049588 Bacteria 630
276 Ga0501073_0107125 3300049589 Bacteria 1939
277 Ga0501075_0028495 3300049591 Bacteria 4122
278 Ga0501075_0232049 3300049591 Bacteria 1407
279 Ga0501076_0017756 3300049592 Bacteria 5409
280 Ga0501079_0103922 3300049741 Bacteria 2204
281 Ga0501079_0123260 3300049741 Bacteria 2016
282 Ga0501079_0156109 3300049741 Bacteria 1779
283 Ga0501079_0696922 3300049741 Bacteria 799
284 Ga0501080_0058297 3300049742 Bacteria 3595
285 Ga0501081_0037849 3300049743 Bacteria 3293
286 Ga0501035_0284448 3300049822 Bacteria 1397
287 Ga0501045_0477466 3300049824 Bacteria 926
288 nmdc:mga03n38_69507_c1 3300050490 Bacteria 1626
289 nmdc:mga03n38_73192_c1 3300050490 Bacteria 1590
290 nmdc:mga00v17_172062_c1 3300050491 Bacteria 1397
291 nmdc:mga00v17_548332_c1 3300050491 Bacteria 748
292 nmdc:mga0yw44_543460_c1 3300050492 Bacteria 789
293 nmdc:mga0k408_1227_c1 3300050493 Bacteria 14045
294 nmdc:mga0k408_468109_c1 3300050493 Bacteria 748
295 nmdc:mga06z11_1031_c1 3300050494 Bacteria 10147
296 nmdc:mga06z11_32346_c1 3300050494 Bacteria 2550
297 nmdc:mga06z11_78578_c1 3300050494 Bacteria 1764
298 nmdc:mga04h51_157655_c1 3300050495 Bacteria 871
299 nmdc:mga05p37_13807_c1 3300050507 Bacteria 9677
300 nmdc:mga05p37_208535_c1 3300050507 Bacteria 2363
301 nmdc:mga05p37_284127_c1 3300050507 Bacteria 1972
302 nmdc:mga05p37_392235_c1 3300050507 Bacteria 1623
303 nmdc:mga05p37_395884_c1 3300050507 Bacteria 1614
304 nmdc:mga05p37_420951_c1 3300050507 Bacteria 1554
305 nmdc:mga05p37_530917_c1 3300050507 Bacteria 1344
306 nmdc:mga05p37_5548_c1 3300050507 Bacteria 3618
307 nmdc:mga05p37_708388_c1 3300050507 Bacteria 1117
308 nmdc:mga05p37_76811_c1 3300050507 Bacteria 4111
309 nmdc:mga09592_103039_c1 3300050508 Bacteria 2445
310 nmdc:mga09592_32259_c1 3300050508 Bacteria 4367
311 nmdc:mga09592_323102_c1 3300050508 Bacteria 1337
312 nmdc:mga09592_323907_c1 3300050508 Bacteria 1335
313 nmdc:mga0qj67_337505_c1 3300050509 Bacteria 928
314 nmdc:mga0qj67_484940_c1 3300050509 Bacteria 994
315 nmdc:mga06r32_500303_c1 3300050510 Bacteria 1192
316 nmdc:mga06r32_509142_c1 3300050510 Bacteria 1180
317 nmdc:mga06r32_698982_c1 3300050510 Bacteria 980
318 nmdc:mga06r32_74116_c1 3300050510 Bacteria 3299
319 nmdc:mga08y16_160101_c1 3300050511 Bacteria 2339
320 nmdc:mga08y16_379_c1 3300050511 Bacteria 40536
321 nmdc:mga08y16_657332_c1 3300050511 Bacteria 1052
322 nmdc:mga08y16_75153_c1 3300050511 Bacteria 3522
323 nmdc:mga0n895_1070795_c1 3300050512 Bacteria 785
324 nmdc:mga0n895_146947_c1 3300050512 Bacteria 2387
325 nmdc:mga0n895_312698_c1 3300050512 Bacteria 1592
326 nmdc:mga0n895_316331_c1 3300050512 Bacteria 1582
327 nmdc:mga0rr50_1151_c1 3300050513 Bacteria 14387
328 nmdc:mga0rr50_215158_c1 3300050513 Bacteria 1585
329 nmdc:mga0rr50_52359_c1 3300050513 Bacteria 3033
330 nmdc:mga08x19_1942_c1 3300050514 Bacteria 12647
331 nmdc:mga08x19_416185_c1 3300050514 Bacteria 944
332 nmdc:mga0a205_28032_c1 3300050515 Bacteria 5381
333 nmdc:mga0a205_382464_c1 3300050515 Bacteria 1273
334 nmdc:mga0a205_59392_c1 3300050515 Bacteria 3694
335 Ga0495601_0311999 3300053077 Unclassified 1024
336 Ga0500569_181341 3300053109 Unclassified 715
337 Ga0500645_015586 3300053730 Bacteria 2406
338 Ga0501082_0161853 3300060353 Bacteria 1945
339 Ga0501082_0223498 3300060353 Bacteria 1638
340 Ga0501082_1038521 3300060353 Bacteria 717
341 Ga0070705_100127867
342 Ga0065715_10996630
343 Ga0070658_10297303
344 Ga0070683_100019941
345 Ga0070690_100058932
346 Ga0070690_100306728
347 Ga0068869_100058699
348 Ga0070680_100388979
349 Ga0070682_101171550
350 Ga0068868_100344423
351 Ga0070660_100172654
352 Ga0070689_100067665
353 Ga0070689_100125117
354 Ga0070687_100108259
355 Ga0070692_10530922
356 Ga0070669_100665812
357 Ga0070675_100040754
358 Ga0070671_100684651
359 Ga0070674_100297405
360 Ga0070673_100118726
361 Ga0070673_100230114
362 Ga0070688_100056140
363 Ga0070688_100161425
364 Ga0070659_100924925
365 Ga0070667_100072554
366 Ga0070703_10196471
367 Ga0070710_11097144
368 Ga0070701_10039329
369 Ga0070701_10122694
370 Ga0070701_10126629
371 Ga0070705_100085242
372 Ga0070705_100481368
373 Ga0070705_100573806
374 Ga0070700_100099469
375 Ga0070700_100115672
376 Ga0070700_100866850
377 Ga0070694_100050218
378 Ga0070663_100019888
379 Ga0070663_100324525
380 Ga0070678_100121578
381 Ga0070678_100754658
382 Ga0070681_10268983
383 Ga0068867_100133756
384 Ga0068867_100154825
385 Ga0068867_100317174
386 Ga0070685_10041803
387 Ga0070706_100220778
388 Ga0070706_100398630
389 Ga0070706_100442032
390 Ga0070706_100533243
391 Ga0070707_100043806
392 Ga0070698_100134601
393 Ga0070698_100170065
394 Ga0070699_100177777
395 Ga0070684_100238851
396 Ga0070697_100048143
397 Ga0070697_100048619
398 Ga0070697_100679721
399 Ga0070672_100869479
400 Ga0070686_100069215
401 Ga0070686_100277849
402 Ga0070686_100439111
403 Ga0070695_100043781
404 Ga0070695_100548708
405 Ga0070696_100237957
406 Ga0070696_100911171
407 Ga0070665_101131455
408 Ga0070704_100109985
409 Ga0070704_100166174
410 Ga0070704_100170673
411 Ga0070704_100274128
412 Ga0070704_100416429
413 Ga0070704_100528731
414 Ga0070704_100739433
415 Ga0070664_100108762
416 Ga0068857_100197592
417 Ga0068854_100671051
418 Ga0070702_100071324
419 Ga0070702_100759002
420 Ga0068859_100053435
421 Ga0068859_100096556
422 Ga0068864_100098405
423 Ga0068866_10449638
424 Ga0068861_100005301
425 Ga0068861_100056553
426 Ga0068870_10176898
427 Ga0068870_10240350
428 Ga0068863_100189115
429 Ga0068858_100017283
430 Ga0068858_100381801
431 Ga0068860_101803241
432 Ga0068862_100039358
433 Ga0068862_100796200
434 Ga0068862_100826770
435 Ga0068862_101171270
436 Ga0070717_10000082
437 Ga0075365_10118872
438 Ga0075368_10010425
439 Ga0075363_100855615
440 Ga0075364_10360970
441 Ga0075362_10006989
442 Ga0075367_10003806
443 Ga0075367_10121493
444 Ga0075367_10137055
445 Ga0075366_10000098
446 Ga0097621_102198110
447 Ga0075370_10156002
448 Ga0075428_100024785
449 Ga0075428_100064759
450 Ga0075428_100081414
451 Ga0075428_100229606
452 Ga0075428_100363882
453 Ga0075428_101306008
454 Ga0075430_100722640
455 Ga0075431_100014496
456 Ga0075431_100104136
457 Ga0075431_100594935
458 Ga0075433_10025015
459 Ga0075433_10135678
460 Ga0075433_10217513
461 Ga0075433_10325723
462 Ga0075434_100320041
463 Ga0075434_100402229
464 Ga0075434_100443271
465 Ga0075434_101153077
466 Ga0075429_100060880
467 Ga0075429_100065675
468 Ga0075429_100134560
469 Ga0075429_100485480
470 Ga0068865_100131792
471 Ga0068865_101143773
472 Ga0075436_100012717
473 Ga0097620_100053436
474 Ga0097620_100096555
475 Ga0075435_100015832
476 Ga0075435_100454419
477 Ga0111539_10000913
478 Ga0111539_10070730
479 Ga0111539_10093083
480 Ga0111539_10168681
481 Ga0105245_10886186
482 Ga0114129_10010351
483 Ga0114129_10011985
484 Ga0114129_10037621
485 Ga0114129_10118139
486 Ga0114129_10134195
487 Ga0114129_10178645
488 Ga0114129_10320604
489 Ga0114129_10490522
490 Ga0114129_10607577
491 Ga0114129_10896739
492 Ga0105243_10254917
493 Ga0105243_10617846
494 Ga0105242_10002139
495 Ga0105242_10753530
496 Ga0105248_10150187
497 Ga0105238_10552178
498 Ga0105249_10022016
499 Ga0099796_10325420
500 Ga0105239_10774773
501 Ga0157378_10327215
502 Ga0163162_10562746
503 Ga0157375_10157539
504 Ga0157375_10724802
505 Ga0163163_10019528
506 Ga0163163_10282652
507 Ga0157380_10011162
508 Ga0157380_10231931
509 Ga0157380_10255244
510 Ga0157380_11393990
511 Ga0157377_10045194
512 Ga0157379_10065237
513 Ga0157379_10423269
514 Ga0206356_11855830
515 Ga0206355_1021107
516 Ga0206351_10125882
517 Ga0206350_10566547
518 Ga0224712_10050037
519 Ga0207653_10023787
520 Ga0207653_10077020
521 Ga0207645_10049944
522 Ga0207643_10077397
523 Ga0207643_10099139
524 Ga0207684_10113068
525 Ga0207684_10544056
526 Ga0207707_10714691
527 Ga0207662_10022420
528 Ga0207657_10186397
529 Ga0207646_10003769
530 Ga0207646_10019172
531 Ga0207681_10204279
532 Ga0207681_10243531
533 Ga0207694_10583446
534 Ga0207659_10107135
535 Ga0207706_10247459
536 Ga0207706_10297220
537 Ga0207709_10117066
538 Ga0207709_10158150
539 Ga0207670_10075242
540 Ga0207670_10429529
541 Ga0207669_10480370
542 Ga0207704_10396865
543 Ga0207691_10044443
544 Ga0207691_10728119
545 Ga0207711_10143954
546 Ga0207711_10645581
547 Ga0207689_10089388
548 Ga0207661_10051652
549 Ga0207679_10636481
550 Ga0207651_10374350
551 Ga0207651_10713458
552 Ga0207712_10028106
553 Ga0207712_10115757
554 Ga0207668_10742683
555 Ga0207658_10119830
556 Ga0207677_10247932
557 Ga0207678_10013271
558 Ga0207678_10490470
559 Ga0207708_10074688
560 Ga0207708_10100604
561 Ga0207708_10128187
562 Ga0207708_10678448
563 Ga0207641_10036902
564 Ga0207641_10485581
565 Ga0207648_10030077
566 Ga0207648_10191970
567 Ga0207648_10349188
568 Ga0207676_10588499
569 Ga0207674_10132001
570 Ga0207675_100022317
571 Ga0207675_100114711
572 Ga0207675_100129416
573 Ga0207683_10243029
574 Ga0207683_10339857
575 Ga0209813_10075255
576 Ga0207428_10000076
577 Ga0207428_10059413
578 Ga0207428_10371654
579 Ga0268266_11180747
580 Ga0268264_11437913
581 Ga0316576_10053638
582 Ga0316576_10436071
583 Ga0316577_10377039
584 Ga0316580_10099811
585 Ga0373948_0058745
586 Ga0316574_0002529
587 Ga0316574_0126957
588 Ga0316574_0340106
589 Ga0373931_0882767
590 Ga0316582_0153993
591 Ga0453684_0022043
592 Ga0453684_0577009
593 Ga0453684_0695391
594 Ga0466960_0195945
595 Ga0495638_0113648
596 Ga0495656_0148574
597 Ga0495649_0239283
598 Ga0495677_0123248
599 Ga0501031_0019070
600 Ga0501032_0653230
601 Ga0501033_0823557
602 Ga0501036_0026734
603 Ga0501039_0044038
604 Ga0501040_0345897
605 Ga0501041_0076662
606 Ga0501041_0521749
607 Ga0501042_0065696
608 Ga0501042_0512481
609 Ga0501048_0024762
610 Ga0501068_0743698
611 Ga0501071_0015837
612 Ga0501071_0596458
613 Ga0501072_0079243
614 Ga0501072_0489648
615 Ga0501072_1064763
616 Ga0501073_0107125
617 Ga0501075_0028495
618 Ga0501075_0232049
619 Ga0501076_0017756
620 Ga0501079_0103922
621 Ga0501079_0123260
622 Ga0501079_0156109
623 Ga0501079_0696922
624 Ga0501080_0058297
625 Ga0501081_0037849
626 Ga0501035_0284448
627 Ga0501045_0477466
628 nmdc:mga03n38_69507_c1
629 nmdc:mga03n38_73192_c1
630 nmdc:mga00v17_172062_c1
631 nmdc:mga00v17_548332_c1
632 nmdc:mga0yw44_543460_c1
633 nmdc:mga0k408_1227_c1
634 nmdc:mga0k408_468109_c1
635 nmdc:mga06z11_1031_c1
636 nmdc:mga06z11_32346_c1
637 nmdc:mga06z11_78578_c1
638 nmdc:mga04h51_157655_c1
639 nmdc:mga05p37_13807_c1
640 nmdc:mga05p37_208535_c1
641 nmdc:mga05p37_284127_c1
642 nmdc:mga05p37_392235_c1
643 nmdc:mga05p37_395884_c1
644 nmdc:mga05p37_420951_c1
645 nmdc:mga05p37_530917_c1
646 nmdc:mga05p37_5548_c1
647 nmdc:mga05p37_708388_c1
648 nmdc:mga05p37_76811_c1
649 nmdc:mga09592_103039_c1
650 nmdc:mga09592_32259_c1
651 nmdc:mga09592_323102_c1
652 nmdc:mga09592_323907_c1
653 nmdc:mga0qj67_337505_c1
654 nmdc:mga0qj67_484940_c1
655 nmdc:mga06r32_500303_c1
656 nmdc:mga06r32_509142_c1
657 nmdc:mga06r32_698982_c1
658 nmdc:mga06r32_74116_c1
659 nmdc:mga08y16_160101_c1
660 nmdc:mga08y16_379_c1
661 nmdc:mga08y16_657332_c1
662 nmdc:mga08y16_75153_c1
663 nmdc:mga0n895_1070795_c1
664 nmdc:mga0n895_146947_c1
665 nmdc:mga0n895_312698_c1
666 nmdc:mga0n895_316331_c1
667 nmdc:mga0rr50_1151_c1
668 nmdc:mga0rr50_215158_c1
669 nmdc:mga0rr50_52359_c1
670 nmdc:mga08x19_1942_c1
671 nmdc:mga08x19_416185_c1
672 nmdc:mga0a205_28032_c1
673 nmdc:mga0a205_382464_c1
674 nmdc:mga0a205_59392_c1
675 Ga0495601_0311999
676 Ga0500569_181341
677 Ga0500645_015586
678 Ga0501082_0161853
679 Ga0501082_0223498
680 Ga0501082_1038521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04461

DUF520

Protein of unknown function (DUF520)

30

188

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9342 4 162
5b7w-assembly2.cif.gz_B crystal structure of the yajq-family protein xc_3703 from xanthomonas campestris pv.campestris 0.9177 4 162
1in0-assembly2.cif.gz_B yajq protein (hi1034) 0.8998 5 162
2dnq-assembly1.cif.gz_A solution structure of rna binding domain 1 in rna-binding protein 30 0.6835 102 159
2n2u-assembly1.cif.gz_A solution nmr structure of de novo designed ferredoxin fold protein sfr3, northeast structural genomics consortium (nesg) target or358 0.6789 103 162
ID Description Score Start End Superfamily
1in0B01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9837 101 162 3.30.70.860
af_P9WFK9_11_96_3.30.70.990 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.94 11 95 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9393 11 100 3.30.70.990
1in0A02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9328 11 98 3.30.70.990
5b7wB02 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;YajQ-like, domain 2 0.9294 11 100 3.30.70.990
ID Description Score Start End GO Terms
AF-A0A537XNU2-F1-model_v4 DUF520 family protein 1 101 162 GO:0000166
GO:0005829
AF-A0A534X1I0-F1-model_v4 UPF0234 protein E6J71_12830 0.9911 4 162 GO:0000166
GO:0005829
AF-A0A1Z8TXT2-F1-model_v4 Uncharacterized protein 0.9901 99 162 GO:0000166
GO:0005829
AF-A0A7M3MJD5-F1-model_v4 UPF0234 protein DPQ33_03570 0.9871 4 162 GO:0000166
GO:0005829
AF-A0A538QQL7-F1-model_v4 Nucleotide-binding protein 0.987 9 122 GO:0000166
GO:0005829

Map