F413847

General Info

Members Datasets Scaffolds Average Seq Length
339 179 678 289

Family's Representative Sequence

Representative Sequence 3300005618|Ga0068864_100010678|Ga0068864_1000106784
Length 333
Sequence MVHNQQTRQQIDGHLCRLSHQCGWPRWPAVFLTNSRMRQLLATVVVGLAVVASGSPGTAQSPASSGVQNRKDSLKFAAIGDNGTGDKPQFEIGAQMSAWRRKFPFDMVIMLGDNIYGGQTPRDFVDKFENPYKPLLDAGVLFYAALGNHDSQTSRFYKLWNMNGERYYTYSKKNVRFFVLDSDYVDPKQLQWIENELKNARDDWKIVYFHHPIYSSGGRHGSEVDLRVTLEPLFVKYGVNVVYSGHDHIYERLKPQKGIYYFVSGSGGQLRGGDLKKSALTEAGYDMDQTFMLNEIDKDELFFQVITRTGKTIDAGVITRQPKPKPAETPSQH

Samples

Sample ID Description Type Environment
1 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
116 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
122 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
126 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
127 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
128 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
134 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
135 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
138 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
139 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
144 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
145 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
151 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
152 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
158 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
159 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
160 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
161 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
162 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
163 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
177 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
178 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
179 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.77
Rhizosphere 98.23
Stem 0
Stem Tuber 0
Unclassified 21.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068864_100010678 3300005618 Bacteria 7589
2 Ga0065715_10186575 3300005293 Bacteria 1441
3 Ga0065715_10287650 3300005293 Unclassified 1067
4 Ga0065707_10084781 3300005295 Bacteria 6787
5 Ga0065707_10087018 3300005295 Bacteria 5203
6 Ga0070676_10031987 3300005328 Unclassified 3011
7 Ga0070690_100023672 3300005330 Unclassified 3769
8 Ga0070677_10074007 3300005333 Bacteria 1440
9 Ga0070666_10014810 3300005335 Bacteria 4971
10 Ga0070682_100084622 3300005337 Bacteria 2061
11 Ga0068868_100051034 3300005338 Bacteria 3251
12 Ga0070689_100012267 3300005340 Bacteria 6167
13 Ga0070687_100001688 3300005343 Bacteria 7919
14 Ga0070661_100474566 3300005344 Bacteria 998
15 Ga0070692_10018535 3300005345 Unclassified 3349
16 Ga0070668_100052275 3300005347 Bacteria 3149
17 Ga0070669_100001227 3300005353 Bacteria 18614
18 Ga0070669_100421504 3300005353 Unclassified 1095
19 Ga0070675_100000214 3300005354 Bacteria 37364
20 Ga0070675_100003034 3300005354 Bacteria 12678
21 Ga0070675_100019759 3300005354 Bacteria 5371
22 Ga0070688_100001655 3300005365 Bacteria 11149
23 Ga0070688_100106651 3300005365 Bacteria 1856
24 Ga0070667_100316466 3300005367 Unclassified 1408
25 Ga0070703_10039966 3300005406 Bacteria 1456
26 Ga0070701_10001444 3300005438 Bacteria 8800
27 Ga0070701_10006102 3300005438 Bacteria 5044
28 Ga0070705_100000092 3300005440 Bacteria 50020
29 Ga0070705_100025673 3300005440 Bacteria 3197
30 Ga0070705_100084613 3300005440 Bacteria 1958
31 Ga0070705_100188974 3300005440 Unclassified 1402
32 Ga0070705_100328814 3300005440 Bacteria 1106
33 Ga0070700_100019515 3300005441 Unclassified 3913
34 Ga0070700_100142930 3300005441 Bacteria 1628
35 Ga0070700_100365037 3300005441 Unclassified 1075
36 Ga0070694_100005343 3300005444 Bacteria 7766
37 Ga0070694_100020111 3300005444 Unclassified 4252
38 Ga0070694_100182141 3300005444 Unclassified 1554
39 Ga0070694_100253526 3300005444 Unclassified 1332
40 Ga0070708_100004312 3300005445 Bacteria 11178
41 Ga0070708_100508309 3300005445 Bacteria 1137
42 Ga0070678_100454709 3300005456 Unclassified 1122
43 Ga0070662_100012443 3300005457 Bacteria 5643
44 Ga0068867_100012440 3300005459 Bacteria 6021
45 Ga0068867_100440583 3300005459 Unclassified 1108
46 Ga0070706_100011040 3300005467 Bacteria 8390
47 Ga0070706_100095991 3300005467 Bacteria 2752
48 Ga0070707_100008055 3300005468 Bacteria 9784
49 Ga0070707_100052334 3300005468 Bacteria 3915
50 Ga0070698_100067715 3300005471 Unclassified 3590
51 Ga0070698_100722342 3300005471 Unclassified 939
52 Ga0070699_100004143 3300005518 Bacteria 12811
53 Ga0070699_100006930 3300005518 Bacteria 9853
54 Ga0070699_100019055 3300005518 Bacteria 5902
55 Ga0070684_100264632 3300005535 Bacteria 1573
56 Ga0070684_100363951 3300005535 Bacteria 1331
57 Ga0070697_100014440 3300005536 Bacteria 6202
58 Ga0070697_100040577 3300005536 Bacteria 3767
59 Ga0070672_100011439 3300005543 Bacteria 6189
60 Ga0070686_100126145 3300005544 Bacteria 1764
61 Ga0070695_100000002 3300005545 Bacteria 128335
62 Ga0070695_100028932 3300005545 Unclassified 3440
63 Ga0070696_100000869 3300005546 Bacteria 19520
64 Ga0070696_100007267 3300005546 Bacteria 7392
65 Ga0070696_100032169 3300005546 Bacteria 3598
66 Ga0070665_100013463 3300005548 Bacteria 8228
67 Ga0070665_100033087 3300005548 Bacteria 5202
68 Ga0070704_100000393 3300005549 Bacteria 20048
69 Ga0070704_100041702 3300005549 Bacteria 3170
70 Ga0070704_100192732 3300005549 Unclassified 1639
71 Ga0070664_100283704 3300005564 Bacteria 1494
72 Ga0068857_100003320 3300005577 Bacteria 13379
73 Ga0070702_100173371 3300005615 Unclassified 1405
74 Ga0068859_100000417 3300005617 Bacteria 42484
75 Ga0068859_100006930 3300005617 Bacteria 11508
76 Ga0068859_100170121 3300005617 Bacteria 2260
77 Ga0068864_100002486 3300005618 Bacteria 15225
78 Ga0068861_100016546 3300005719 Bacteria 5221
79 Ga0068861_100406735 3300005719 Archaea 1209
80 Ga0068851_10165775 3300005834 Unclassified 1216
81 Ga0068870_10003408 3300005840 Bacteria 6738
82 Ga0068858_100009625 3300005842 Bacteria 9212
83 Ga0068858_100015933 3300005842 Bacteria 7062
84 Ga0068858_100202164 3300005842 Bacteria 1879
85 Ga0068858_100375554 3300005842 Bacteria 1364
86 Ga0068860_100048929 3300005843 Unclassified 4029
87 Ga0068862_100000845 3300005844 Bacteria 30146
88 Ga0068862_100096595 3300005844 Bacteria 2579
89 Ga0097621_100023444 3300006237 Bacteria 4807
90 Ga0068871_100383623 3300006358 Bacteria 1249
91 Ga0075428_100004501 3300006844 Bacteria 15389
92 Ga0075428_100004695 3300006844 Bacteria 15129
93 Ga0075428_100022064 3300006844 Bacteria 7048
94 Ga0075430_100006581 3300006846 Bacteria 9792
95 Ga0075430_100089434 3300006846 Bacteria 2576
96 Ga0075431_100020653 3300006847 Bacteria 6730
97 Ga0075431_100133463 3300006847 Unclassified 2560
98 Ga0075431_100287501 3300006847 Unclassified 1664
99 Ga0075433_10000105 3300006852 Bacteria 41103
100 Ga0075433_10024355 3300006852 Bacteria 5107
101 Ga0075433_10039662 3300006852 Bacteria 4073
102 Ga0075433_10152096 3300006852 Bacteria 2058
103 Ga0075433_10307334 3300006852 Bacteria 1404
104 Ga0075434_100001010 3300006871 Bacteria 22875
105 Ga0075434_100008260 3300006871 Bacteria 9669
106 Ga0075434_100011958 3300006871 Bacteria 8209
107 Ga0075434_100021669 3300006871 Bacteria 6249
108 Ga0075434_100086143 3300006871 Bacteria 3141
109 Ga0075434_100099945 3300006871 Bacteria 2906
110 Ga0075434_100123227 3300006871 Bacteria 2608
111 Ga0075429_100006383 3300006880 Bacteria 10202
112 Ga0075429_100017353 3300006880 Bacteria 6223
113 Ga0075429_100031527 3300006880 Unclassified 4608
114 Ga0068865_100004651 3300006881 Bacteria 8292
115 Ga0075436_100001647 3300006914 Bacteria 15264
116 Ga0075436_100020662 3300006914 Bacteria 4518
117 Ga0075436_100023157 3300006914 Bacteria 4266
118 Ga0075436_100024059 3300006914 Bacteria 4187
119 Ga0075436_100049287 3300006914 Bacteria 2906
120 Ga0097620_100000417 3300006931 Bacteria 42484
121 Ga0097620_100006930 3300006931 Bacteria 11508
122 Ga0097620_100170126 3300006931 Bacteria 2260
123 Ga0075435_100000117 3300007076 Bacteria 44257
124 Ga0075435_100003023 3300007076 Bacteria 11324
125 Ga0075435_100008650 3300007076 Bacteria 7318
126 Ga0075435_100013405 3300007076 Bacteria 6097
127 Ga0075435_100013527 3300007076 Bacteria 6073
128 Ga0075435_100016092 3300007076 Bacteria 5634
129 Ga0075435_100041398 3300007076 Bacteria 3682
130 Ga0111539_10001289 3300009094 Bacteria 33478
131 Ga0111539_10012038 3300009094 Bacteria 10850
132 Ga0111539_10279914 3300009094 Unclassified 1941
133 Ga0111539_10697665 3300009094 Unclassified 1181
134 Ga0105245_10185465 3300009098 Unclassified 1990
135 Ga0105247_10006806 3300009101 Bacteria 7050
136 Ga0114129_10001203 3300009147 Bacteria 34346
137 Ga0114129_10002377 3300009147 Bacteria 26132
138 Ga0114129_10005305 3300009147 Bacteria 18188
139 Ga0114129_10020297 3300009147 Bacteria 9453
140 Ga0114129_10027367 3300009147 Bacteria 8073
141 Ga0114129_10032411 3300009147 Bacteria 7385
142 Ga0114129_10052746 3300009147 Bacteria 5707
143 Ga0114129_10058940 3300009147 Bacteria 5369
144 Ga0114129_10103625 3300009147 Bacteria 3934
145 Ga0114129_10307378 3300009147 Bacteria 2111
146 Ga0105243_10249483 3300009148 Unclassified 1584
147 Ga0105241_10113338 3300009174 Bacteria 2173
148 Ga0105242_10007607 3300009176 Bacteria 8339
149 Ga0105248_10014548 3300009177 Bacteria 8661
150 Ga0105248_10093516 3300009177 Bacteria 3386
151 Ga0105248_10123728 3300009177 Bacteria 2917
152 Ga0105248_10222554 3300009177 Bacteria 2125
153 Ga0105238_10254670 3300009551 Unclassified 1734
154 Ga0105249_10005611 3300009553 Bacteria 10853
155 Ga0105249_10038132 3300009553 Bacteria 4360
156 Ga0105239_10246695 3300010375 Bacteria 2005
157 Ga0157374_10542164 3300013296 Unclassified 1170
158 Ga0157378_10008447 3300013297 Bacteria 8972
159 Ga0157378_10144333 3300013297 Unclassified 2213
160 Ga0163162_10026590 3300013306 Bacteria 5721
161 Ga0157375_10002647 3300013308 Bacteria 15507
162 Ga0163163_10000005 3300014325 Bacteria 369548
163 Ga0163163_10032446 3300014325 Bacteria 5044
164 Ga0163163_10059125 3300014325 Bacteria 3790
165 Ga0157380_10064787 3300014326 Bacteria 2935
166 Ga0157380_10080936 3300014326 Bacteria 2655
167 Ga0157379_10054156 3300014968 Bacteria 3585
168 Ga0157379_10336797 3300014968 Bacteria 1379
169 Ga0157376_10005821 3300014969 Bacteria 8644
170 Ga0157376_10323254 3300014969 Bacteria 1467
171 Ga0207653_10048625 3300025885 Bacteria 1406
172 Ga0207682_10028888 3300025893 Bacteria 2215
173 Ga0207710_10023283 3300025900 Unclassified 2661
174 Ga0207645_10032277 3300025907 Unclassified 3366
175 Ga0207643_10004557 3300025908 Bacteria 7444
176 Ga0207684_10010285 3300025910 Bacteria 8236
177 Ga0207707_10148535 3300025912 Unclassified 2049
178 Ga0207662_10015809 3300025918 Unclassified 4251
179 Ga0207646_10044298 3300025922 Bacteria 3994
180 Ga0207646_10450056 3300025922 Bacteria 1162
181 Ga0207681_10000492 3300025923 Bacteria 27628
182 Ga0207659_10001169 3300025926 Bacteria 15653
183 Ga0207659_10004540 3300025926 Bacteria 8400
184 Ga0207706_10014535 3300025933 Bacteria 7134
185 Ga0207709_10163610 3300025935 Unclassified 1554
186 Ga0207670_10096847 3300025936 Bacteria 2099
187 Ga0207669_10453213 3300025937 Unclassified 1017
188 Ga0207691_10049540 3300025940 Unclassified 3849
189 Ga0207691_10133682 3300025940 Unclassified 2190
190 Ga0207711_10010416 3300025941 Bacteria 7719
191 Ga0207712_10009477 3300025961 Bacteria 6160
192 Ga0207668_10112238 3300025972 Bacteria 2047
193 Ga0207658_10265295 3300025986 Unclassified 1465
194 Ga0207677_10034312 3300026023 Bacteria 3284
195 Ga0207677_10464709 3300026023 Bacteria 1087
196 Ga0207703_10006150 3300026035 Bacteria 9607
197 Ga0207703_10045189 3300026035 Bacteria 3542
198 Ga0207703_10290072 3300026035 Bacteria 1489
199 Ga0207703_10306984 3300026035 Bacteria 1449
200 Ga0207708_10007730 3300026075 Bacteria 7962
201 Ga0207708_10238458 3300026075 Bacteria 1462
202 Ga0207708_10362155 3300026075 Unclassified 1192
203 Ga0207648_10000879 3300026089 Bacteria 33866
204 Ga0207676_10008523 3300026095 Bacteria 7292
205 Ga0207676_10053934 3300026095 Unclassified 3148
206 Ga0207676_10102015 3300026095 Bacteria 2381
207 Ga0207674_10014788 3300026116 Bacteria 8607
208 Ga0207675_100026150 3300026118 Bacteria 5434
209 Ga0207675_100499568 3300026118 Archaea 1211
210 Ga0207683_10185194 3300026121 Unclassified 1889
211 Ga0207428_10001148 3300027907 Bacteria 28675
212 Ga0207428_10012103 3300027907 Bacteria 7591
213 Ga0268266_10001999 3300028379 Bacteria 22797
214 Ga0268266_10014978 3300028379 Bacteria 6656
215 Ga0268266_10491409 3300028379 Bacteria 1171
216 Ga0268265_10000293 3300028380 Bacteria 56326
217 Ga0268265_10096410 3300028380 Bacteria 2377
218 Ga0268264_10053339 3300028381 Unclassified 3373
219 Ga0307408_100012291 3300031548 Archaea 5669
220 Ga0307408_100072767 3300031548 Unclassified 2545
221 Ga0307405_10396257 3300031731 Unclassified 1079
222 Ga0307406_10092971 3300031901 Unclassified 2035
223 Ga0307406_10102400 3300031901 Bacteria 1953
224 Ga0307412_10072074 3300031911 Unclassified 2360
225 Ga0307409_100303725 3300031995 Unclassified 1486
226 Ga0307416_100070448 3300032002 Unclassified 2899
227 Ga0307416_100153643 3300032002 Unclassified 2115
228 Ga0307411_10015477 3300032005 Bacteria 4286
229 Ga0373949_0016740 3300035090 Bacteria 1646
230 Ga0373957_0135719 3300035120 Bacteria 1004
231 Ga0373924_0114486 3300035410 Bacteria 1168
232 Ga0373937_0075783 3300036401 Bacteria 3106
233 Ga0373925_0186684 3300037068 Unclassified 1644
234 Ga0373925_0334189 3300037068 Bacteria 1228
235 Ga0439443_011417 3300042003 Unclassified 1301
236 Ga0439435_0036695 3300042436 Unclassified 1355
237 Ga0439464_0000198 3300042439 Bacteria 10606
238 Ga0451576_0013970 3300045051 Bacteria 8955
239 Ga0451576_0019279 3300045051 Bacteria 7447
240 Ga0451576_0042281 3300045051 Bacteria 4812
241 Ga0495603_0033663 3300046455 Unclassified 3083
242 Ga0495642_0002110 3300046528 Bacteria 8219
243 Ga0495640_0079580 3300046533 Bacteria 2182
244 Ga0495635_0043623 3300046663 Bacteria 3095
245 Ga0495659_0002917 3300046664 Bacteria 5494
246 Ga0495659_0011477 3300046664 Bacteria 2854
247 Ga0495659_0044189 3300046664 Bacteria 1601
248 Ga0495658_0039194 3300046683 Bacteria 2628
249 Ga0495669_0020197 3300046684 Bacteria 2881
250 Ga0495636_0017569 3300047318 Bacteria 2864
251 Ga0495685_019806 3300047447 Unclassified 2312
252 Ga0495684_0101430 3300047471 Bacteria 2176
253 Ga0496106_0150092 3300048909 Bacteria 1838
254 Ga0496108_0030917 3300048911 Bacteria 4438
255 Ga0496109_0449136 3300048912 Unclassified 1218
256 Ga0496112_0001527 3300048915 Bacteria 17840
257 Ga0496114_0019162 3300048917 Bacteria 5545
258 Ga0496114_0163364 3300048917 Unclassified 1938
259 Ga0501298_031219 3300049521 Unclassified 1046
260 Ga0501299_012744 3300049522 Bacteria 1440
261 Ga0501031_0190816 3300049568 Bacteria 1338
262 Ga0501033_0059747 3300049570 Bacteria 2815
263 Ga0501036_0002735 3300049572 Bacteria 13943
264 Ga0501036_0304506 3300049572 Unclassified 1333
265 Ga0501039_0033167 3300049575 Unclassified 3983
266 Ga0501040_0000468 3300049576 Bacteria 24032
267 Ga0501041_0002714 3300049577 Bacteria 10098
268 Ga0501042_0000459 3300049578 Bacteria 20995
269 Ga0501043_0096762 3300049579 Bacteria 2320
270 Ga0501046_0002826 3300049580 Bacteria 16171
271 Ga0501047_0083186 3300049581 Bacteria 3076
272 Ga0501048_0008550 3300049582 Bacteria 7736
273 Ga0501071_0002504 3300049587 Bacteria 11175
274 Ga0501072_0024710 3300049588 Unclassified 4677
275 Ga0501075_0001512 3300049591 Bacteria 15168
276 Ga0501075_0055691 3300049591 Bacteria 2976
277 Ga0501076_0000509 3300049592 Bacteria 24637
278 Ga0501217_053769 3300049661 Unclassified 1059
279 Ga0501079_0005010 3300049741 Bacteria 9821
280 Ga0501079_0091648 3300049741 Bacteria 2355
281 Ga0501080_0168081 3300049742 Bacteria 2024
282 Ga0501083_0264364 3300049744 Unclassified 1119
283 Ga0501044_0003028 3300049823 Bacteria 19022
284 Ga0501045_0003445 3300049824 Bacteria 10826
285 Ga0501045_0037738 3300049824 Bacteria 3513
286 Ga0501045_0110407 3300049824 Bacteria 2039
287 nmdc:mga05p37_10650_c1 3300050507 Bacteria 10910
288 nmdc:mga05p37_13203_c1 3300050507 Bacteria 9887
289 nmdc:mga05p37_134389_c1 3300050507 Bacteria 3035
290 nmdc:mga05p37_158786_c1 3300050507 Unclassified 2762
291 nmdc:mga05p37_1622_c1 3300050507 Bacteria 11969
292 nmdc:mga05p37_18204_c1 3300050507 Bacteria 8486
293 nmdc:mga05p37_275014_c1 3300050507 Bacteria 2011
294 nmdc:mga05p37_353583_c1 3300050507 Unclassified 1729
295 nmdc:mga05p37_4187_c1 3300050507 Bacteria 16861
296 nmdc:mga09592_100542_c1 3300050508 Bacteria 2476
297 nmdc:mga09592_2752_c1 3300050508 Bacteria 14211
298 nmdc:mga0qj67_10174_c1 3300050509 Bacteria 7023
299 nmdc:mga06r32_113930_c1 3300050510 Bacteria 2662
300 nmdc:mga06r32_237776_c1 3300050510 Unclassified 1393
301 nmdc:mga06r32_4367_c1 3300050510 Bacteria 12644
302 nmdc:mga06r32_793198_c1 3300050510 Bacteria 908
303 nmdc:mga08y16_102212_c1 3300050511 Bacteria 2984
304 nmdc:mga08y16_17258_c1 3300050511 Bacteria 7599
305 nmdc:mga0n895_101398_c1 3300050512 Bacteria 2888
306 nmdc:mga0n895_10566_c1 3300050512 Bacteria 8168
307 nmdc:mga0n895_137_c1 3300050512 Bacteria 43956
308 nmdc:mga0n895_259700_c1 3300050512 Bacteria 1763
309 nmdc:mga0n895_3387_c1 3300050512 Bacteria 12827
310 nmdc:mga0n895_44480_c1 3300050512 Bacteria 4330
311 nmdc:mga0n895_56438_c1 3300050512 Bacteria 3869
312 nmdc:mga0n895_85057_c1 3300050512 Bacteria 3157
313 nmdc:mga0rr50_123212_c1 3300050513 Bacteria 2066
314 nmdc:mga0rr50_18863_c1 3300050513 Bacteria 4643
315 nmdc:mga0rr50_193657_c1 3300050513 Bacteria 1667
316 nmdc:mga0rr50_22_c1 3300050513 Bacteria 123539
317 nmdc:mga0rr50_2457_c1 3300050513 Bacteria 10461
318 nmdc:mga0rr50_25545_c1 3300050513 Unclassified 4108
319 nmdc:mga0rr50_2912_c1 3300050513 Bacteria 9767
320 nmdc:mga0rr50_31800_c1 3300050513 Unclassified 3753
321 nmdc:mga0rr50_492561_c1 3300050513 Unclassified 1042
322 nmdc:mga08x19_16582_c1 3300050514 Bacteria 4495
323 nmdc:mga08x19_18435_c1 3300050514 Bacteria 4277
324 nmdc:mga08x19_4793_c1 3300050514 Bacteria 8018
325 nmdc:mga08x19_5222_c1 3300050514 Bacteria 7683
326 nmdc:mga08x19_55288_c1 3300050514 Bacteria 2558
327 nmdc:mga08x19_60081_c1 3300050514 Unclassified 2462
328 nmdc:mga0a205_11887_c1 3300050515 Bacteria 8035
329 nmdc:mga0a205_24160_c1 3300050515 Bacteria 5773
330 nmdc:mga0a205_49171_c1 3300050515 Bacteria 2500
331 nmdc:mga0a205_560_c1 3300050515 Bacteria 29509
332 nmdc:mga0a205_61421_c1 3300050515 Bacteria 3630
333 nmdc:mga0a205_8641_c1 3300050515 Bacteria 9267
334 Ga0495595_0023174 3300053084 Bacteria 2731
335 Ga0501084_0035667 3300054114 Unclassified 4158
336 Ga0501084_0444373 3300054114 Bacteria 1096
337 Ga0501082_0000463 3300060353 Bacteria 35880
338 Ga0501082_0027235 3300060353 Bacteria 4922
339 Ga0530510_0001827 3300061734 Bacteria 14525
340 Ga0068864_100010678
341 Ga0065715_10186575
342 Ga0065715_10287650
343 Ga0065707_10084781
344 Ga0065707_10087018
345 Ga0070676_10031987
346 Ga0070690_100023672
347 Ga0070677_10074007
348 Ga0070666_10014810
349 Ga0070682_100084622
350 Ga0068868_100051034
351 Ga0070689_100012267
352 Ga0070687_100001688
353 Ga0070661_100474566
354 Ga0070692_10018535
355 Ga0070668_100052275
356 Ga0070669_100001227
357 Ga0070669_100421504
358 Ga0070675_100000214
359 Ga0070675_100003034
360 Ga0070675_100019759
361 Ga0070688_100001655
362 Ga0070688_100106651
363 Ga0070667_100316466
364 Ga0070703_10039966
365 Ga0070701_10001444
366 Ga0070701_10006102
367 Ga0070705_100000092
368 Ga0070705_100025673
369 Ga0070705_100084613
370 Ga0070705_100188974
371 Ga0070705_100328814
372 Ga0070700_100019515
373 Ga0070700_100142930
374 Ga0070700_100365037
375 Ga0070694_100005343
376 Ga0070694_100020111
377 Ga0070694_100182141
378 Ga0070694_100253526
379 Ga0070708_100004312
380 Ga0070708_100508309
381 Ga0070678_100454709
382 Ga0070662_100012443
383 Ga0068867_100012440
384 Ga0068867_100440583
385 Ga0070706_100011040
386 Ga0070706_100095991
387 Ga0070707_100008055
388 Ga0070707_100052334
389 Ga0070698_100067715
390 Ga0070698_100722342
391 Ga0070699_100004143
392 Ga0070699_100006930
393 Ga0070699_100019055
394 Ga0070684_100264632
395 Ga0070684_100363951
396 Ga0070697_100014440
397 Ga0070697_100040577
398 Ga0070672_100011439
399 Ga0070686_100126145
400 Ga0070695_100000002
401 Ga0070695_100028932
402 Ga0070696_100000869
403 Ga0070696_100007267
404 Ga0070696_100032169
405 Ga0070665_100013463
406 Ga0070665_100033087
407 Ga0070704_100000393
408 Ga0070704_100041702
409 Ga0070704_100192732
410 Ga0070664_100283704
411 Ga0068857_100003320
412 Ga0070702_100173371
413 Ga0068859_100000417
414 Ga0068859_100006930
415 Ga0068859_100170121
416 Ga0068864_100002486
417 Ga0068861_100016546
418 Ga0068861_100406735
419 Ga0068851_10165775
420 Ga0068870_10003408
421 Ga0068858_100009625
422 Ga0068858_100015933
423 Ga0068858_100202164
424 Ga0068858_100375554
425 Ga0068860_100048929
426 Ga0068862_100000845
427 Ga0068862_100096595
428 Ga0097621_100023444
429 Ga0068871_100383623
430 Ga0075428_100004501
431 Ga0075428_100004695
432 Ga0075428_100022064
433 Ga0075430_100006581
434 Ga0075430_100089434
435 Ga0075431_100020653
436 Ga0075431_100133463
437 Ga0075431_100287501
438 Ga0075433_10000105
439 Ga0075433_10024355
440 Ga0075433_10039662
441 Ga0075433_10152096
442 Ga0075433_10307334
443 Ga0075434_100001010
444 Ga0075434_100008260
445 Ga0075434_100011958
446 Ga0075434_100021669
447 Ga0075434_100086143
448 Ga0075434_100099945
449 Ga0075434_100123227
450 Ga0075429_100006383
451 Ga0075429_100017353
452 Ga0075429_100031527
453 Ga0068865_100004651
454 Ga0075436_100001647
455 Ga0075436_100020662
456 Ga0075436_100023157
457 Ga0075436_100024059
458 Ga0075436_100049287
459 Ga0097620_100000417
460 Ga0097620_100006930
461 Ga0097620_100170126
462 Ga0075435_100000117
463 Ga0075435_100003023
464 Ga0075435_100008650
465 Ga0075435_100013405
466 Ga0075435_100013527
467 Ga0075435_100016092
468 Ga0075435_100041398
469 Ga0111539_10001289
470 Ga0111539_10012038
471 Ga0111539_10279914
472 Ga0111539_10697665
473 Ga0105245_10185465
474 Ga0105247_10006806
475 Ga0114129_10001203
476 Ga0114129_10002377
477 Ga0114129_10005305
478 Ga0114129_10020297
479 Ga0114129_10027367
480 Ga0114129_10032411
481 Ga0114129_10052746
482 Ga0114129_10058940
483 Ga0114129_10103625
484 Ga0114129_10307378
485 Ga0105243_10249483
486 Ga0105241_10113338
487 Ga0105242_10007607
488 Ga0105248_10014548
489 Ga0105248_10093516
490 Ga0105248_10123728
491 Ga0105248_10222554
492 Ga0105238_10254670
493 Ga0105249_10005611
494 Ga0105249_10038132
495 Ga0105239_10246695
496 Ga0157374_10542164
497 Ga0157378_10008447
498 Ga0157378_10144333
499 Ga0163162_10026590
500 Ga0157375_10002647
501 Ga0163163_10000005
502 Ga0163163_10032446
503 Ga0163163_10059125
504 Ga0157380_10064787
505 Ga0157380_10080936
506 Ga0157379_10054156
507 Ga0157379_10336797
508 Ga0157376_10005821
509 Ga0157376_10323254
510 Ga0207653_10048625
511 Ga0207682_10028888
512 Ga0207710_10023283
513 Ga0207645_10032277
514 Ga0207643_10004557
515 Ga0207684_10010285
516 Ga0207707_10148535
517 Ga0207662_10015809
518 Ga0207646_10044298
519 Ga0207646_10450056
520 Ga0207681_10000492
521 Ga0207659_10001169
522 Ga0207659_10004540
523 Ga0207706_10014535
524 Ga0207709_10163610
525 Ga0207670_10096847
526 Ga0207669_10453213
527 Ga0207691_10049540
528 Ga0207691_10133682
529 Ga0207711_10010416
530 Ga0207712_10009477
531 Ga0207668_10112238
532 Ga0207658_10265295
533 Ga0207677_10034312
534 Ga0207677_10464709
535 Ga0207703_10006150
536 Ga0207703_10045189
537 Ga0207703_10290072
538 Ga0207703_10306984
539 Ga0207708_10007730
540 Ga0207708_10238458
541 Ga0207708_10362155
542 Ga0207648_10000879
543 Ga0207676_10008523
544 Ga0207676_10053934
545 Ga0207676_10102015
546 Ga0207674_10014788
547 Ga0207675_100026150
548 Ga0207675_100499568
549 Ga0207683_10185194
550 Ga0207428_10001148
551 Ga0207428_10012103
552 Ga0268266_10001999
553 Ga0268266_10014978
554 Ga0268266_10491409
555 Ga0268265_10000293
556 Ga0268265_10096410
557 Ga0268264_10053339
558 Ga0307408_100012291
559 Ga0307408_100072767
560 Ga0307405_10396257
561 Ga0307406_10092971
562 Ga0307406_10102400
563 Ga0307412_10072074
564 Ga0307409_100303725
565 Ga0307416_100070448
566 Ga0307416_100153643
567 Ga0307411_10015477
568 Ga0373949_0016740
569 Ga0373957_0135719
570 Ga0373924_0114486
571 Ga0373937_0075783
572 Ga0373925_0186684
573 Ga0373925_0334189
574 Ga0439443_011417
575 Ga0439435_0036695
576 Ga0439464_0000198
577 Ga0451576_0013970
578 Ga0451576_0019279
579 Ga0451576_0042281
580 Ga0495603_0033663
581 Ga0495642_0002110
582 Ga0495640_0079580
583 Ga0495635_0043623
584 Ga0495659_0002917
585 Ga0495659_0011477
586 Ga0495659_0044189
587 Ga0495658_0039194
588 Ga0495669_0020197
589 Ga0495636_0017569
590 Ga0495685_019806
591 Ga0495684_0101430
592 Ga0496106_0150092
593 Ga0496108_0030917
594 Ga0496109_0449136
595 Ga0496112_0001527
596 Ga0496114_0019162
597 Ga0496114_0163364
598 Ga0501298_031219
599 Ga0501299_012744
600 Ga0501031_0190816
601 Ga0501033_0059747
602 Ga0501036_0002735
603 Ga0501036_0304506
604 Ga0501039_0033167
605 Ga0501040_0000468
606 Ga0501041_0002714
607 Ga0501042_0000459
608 Ga0501043_0096762
609 Ga0501046_0002826
610 Ga0501047_0083186
611 Ga0501048_0008550
612 Ga0501071_0002504
613 Ga0501072_0024710
614 Ga0501075_0001512
615 Ga0501075_0055691
616 Ga0501076_0000509
617 Ga0501217_053769
618 Ga0501079_0005010
619 Ga0501079_0091648
620 Ga0501080_0168081
621 Ga0501083_0264364
622 Ga0501044_0003028
623 Ga0501045_0003445
624 Ga0501045_0037738
625 Ga0501045_0110407
626 nmdc:mga05p37_10650_c1
627 nmdc:mga05p37_13203_c1
628 nmdc:mga05p37_134389_c1
629 nmdc:mga05p37_158786_c1
630 nmdc:mga05p37_1622_c1
631 nmdc:mga05p37_18204_c1
632 nmdc:mga05p37_275014_c1
633 nmdc:mga05p37_353583_c1
634 nmdc:mga05p37_4187_c1
635 nmdc:mga09592_100542_c1
636 nmdc:mga09592_2752_c1
637 nmdc:mga0qj67_10174_c1
638 nmdc:mga06r32_113930_c1
639 nmdc:mga06r32_237776_c1
640 nmdc:mga06r32_4367_c1
641 nmdc:mga06r32_793198_c1
642 nmdc:mga08y16_102212_c1
643 nmdc:mga08y16_17258_c1
644 nmdc:mga0n895_101398_c1
645 nmdc:mga0n895_10566_c1
646 nmdc:mga0n895_137_c1
647 nmdc:mga0n895_259700_c1
648 nmdc:mga0n895_3387_c1
649 nmdc:mga0n895_44480_c1
650 nmdc:mga0n895_56438_c1
651 nmdc:mga0n895_85057_c1
652 nmdc:mga0rr50_123212_c1
653 nmdc:mga0rr50_18863_c1
654 nmdc:mga0rr50_193657_c1
655 nmdc:mga0rr50_22_c1
656 nmdc:mga0rr50_2457_c1
657 nmdc:mga0rr50_25545_c1
658 nmdc:mga0rr50_2912_c1
659 nmdc:mga0rr50_31800_c1
660 nmdc:mga0rr50_492561_c1
661 nmdc:mga08x19_16582_c1
662 nmdc:mga08x19_18435_c1
663 nmdc:mga08x19_4793_c1
664 nmdc:mga08x19_5222_c1
665 nmdc:mga08x19_55288_c1
666 nmdc:mga08x19_60081_c1
667 nmdc:mga0a205_11887_c1
668 nmdc:mga0a205_24160_c1
669 nmdc:mga0a205_49171_c1
670 nmdc:mga0a205_560_c1
671 nmdc:mga0a205_61421_c1
672 nmdc:mga0a205_8641_c1
673 Ga0495595_0023174
674 Ga0501084_0035667
675 Ga0501084_0444373
676 Ga0501082_0000463
677 Ga0501082_0027235
678 Ga0530510_0001827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

74

250

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ute-assembly1.cif.gz_A pig purple acid phosphatase complexed with phosphate 0.8766 33 282
2bq8-assembly1.cif.gz_X crystal structure of human purple acid phosphatase with an inhibitory conformation of the repression loop 0.8702 33 282
1qfc-assembly1.cif.gz_A structure of rat purple acid phosphatase 0.8617 31 280
1qhw-assembly1.cif.gz_A purple acid phosphatase from rat bone 0.8596 33 282
6j9e-assembly1.cif.gz_J cryo-em structure of xanthomonos oryzae transcription elongation complex with nusa and the bacteriophage protein p7 0.8323 252 280
ID Description Score Start End Superfamily
af_A0A0R0HK88_1_184_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8999 127 276 3.60.21.10
af_A0A2R8Q7Q3_23_327_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8913 30 284 3.60.21.10
3htvA01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.8896 257 279 3.30.420.40
af_Q9SCX8_41_336_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8799 32 279 3.60.21.10
af_Q8BX37_131_432_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8774 33 281 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A143PN39-F1-model_v4 Alkaline phosphatase (EC 3.1.3.1) 0.9968 27 282 GO:0004035
AF-A0A3N5FRS0-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.9968 39 282 GO:0016787
AF-A0A2V9UDA0-F1-model_v4 Metallophosphoesterase 0.9956 27 282 GO:0016787
AF-A0A2V9Y505-F1-model_v4 Metallophosphoesterase 0.9953 27 284 GO:0016787
AF-A0A3N5GQK2-F1-model_v4 Metallophosphoesterase 0.9942 27 282 GO:0016787

Map