F413845

General Info

Members Datasets Scaffolds Average Seq Length
339 244 678 222

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100219926|Ga0068859_1002199262
Length 261
Sequence VRAQLLNRTLIHAVAGLHVPRTPIVSGWNECEAIYGRCRLEKQKMRVLVVEDEPRLLRNLAKALREEGYAVDTADVGDEGLYKAESYDYDAIVLDGMLPRLDGWEVLERLRKRKRTPVLMLTARDAPKDRVRGLDTGADDYLVKPFDLPELLARLRALIRRAAGQARPEIELADLLIDTRARTVMRGGEAVTLTAREYAILEYLALHRGEVVTRTELYEHLFDESDDTLSNLLDVHVFSIRKKLGRDLITTRRGQGYCIEV

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
51 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
52 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
54 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
55 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
56 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
59 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
60 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
96 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
97 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
98 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
99 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
100 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
101 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
102 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
103 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
106 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
107 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
108 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
109 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
111 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
113 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
121 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
122 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
128 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
133 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
139 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
142 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
145 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
146 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
147 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
148 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
149 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
150 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
151 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
152 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
153 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
165 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
166 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
167 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
174 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
183 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
184 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
187 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
192 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
193 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
194 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
195 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
196 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
197 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
198 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
199 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
200 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
201 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
202 2643221599 Rhizobium sp. Root708 Isolate Unclassified
203 2643221607 Rhizobium sp. Root73 Isolate Unclassified
204 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
205 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
206 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
207 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
208 2643221718 Rhizobium sp. Root268 Isolate Unclassified
209 2643221719 Rhizobium sp. Root274 Isolate Unclassified
210 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
211 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
212 2786546940 Opitutaceae bacterium EW11 Isolate Unclassified
213 2791355264 Rhizobium sp. S9 Isolate Nodule
214 2791355267 Rhizobium sp. L18 Isolate Nodule
215 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
216 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
217 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
218 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
219 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
220 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
221 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
222 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
223 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
224 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
225 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
226 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
227 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
228 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
229 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
230 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
231 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
232 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
233 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
234 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
235 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
236 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
237 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
238 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
239 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
240 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
241 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
242 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
243 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
244 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 82.01
Metatranscriptomes 2.06
Isolates 15.93

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.44
Nodule 8.55
Rhizoplane 1.77
Rhizosphere 64.31
Stem 0
Stem Tuber 0
Unclassified 7.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100219926 3300005617 Bacteria 1987
2 JGI25156J39149_1000034 3300002705 Bacteria 114036
3 JGI25162J39368_1000976 3300002737 Bacteria 18186
4 JGI25154J39366_1000034 3300002738 Bacteria 176764
5 JGI25157J39369_1000092 3300002741 Bacteria 76674
6 JGI25165J46597_1001088 3300003214 Bacteria 17342
7 rootH1_10254748 3300003323 Bacteria 2767
8 rootH1_10341265 3300003323 Unclassified 1464
9 JGI25160J50197_1001724 3300003354 Bacteria 10605
10 Ga0055540_1000126 3300003792 Bacteria 78462
11 Ga0055531_10072483 3300003794 Bacteria 789
12 Ga0065165_1059037 3300005262 Bacteria 1057
13 Ga0065712_10000280 3300005290 Bacteria 15006
14 Ga0065715_10109699 3300005293 Unclassified 2653
15 Ga0070690_100147084 3300005330 Bacteria 1604
16 Ga0070670_100130475 3300005331 Unclassified 2170
17 Ga0070659_100061654 3300005366 Unclassified 2963
18 Ga0070701_10139706 3300005438 Bacteria 1384
19 Ga0070678_100135721 3300005456 Bacteria 1962
20 Ga0070662_100092801 3300005457 Unclassified 2270
21 Ga0068867_100549417 3300005459 Bacteria 1000
22 Ga0070679_100070626 3300005530 Bacteria 3483
23 Ga0070696_100768408 3300005546 Bacteria 791
24 Ga0070665_100301299 3300005548 Bacteria 1606
25 Ga0070665_100310546 3300005548 Bacteria 1580
26 Ga0068856_100752339 3300005614 Bacteria 995
27 Ga0068859_100228909 3300005617 Bacteria 1947
28 Ga0068864_100009146 3300005618 Bacteria 8167
29 Ga0068858_100360213 3300005842 Bacteria 1394
30 Ga0068860_100079743 3300005843 Bacteria 3113
31 Ga0068860_101515500 3300005843 Bacteria 692
32 Ga0081455_10066733 3300005937 Unclassified 3002
33 Ga0081538_10064024 3300005981 Bacteria 2083
34 Ga0075365_10412038 3300006038 Bacteria 954
35 Ga0075364_10042726 3300006051 Bacteria 2945
36 Ga0097621_100087647 3300006237 Unclassified 2600
37 Ga0097621_100382556 3300006237 Unclassified 1257
38 Ga0075370_10026114 3300006353 Bacteria 3233
39 Ga0075431_100083003 3300006847 Bacteria 3308
40 Ga0075431_100202484 3300006847 Bacteria 2031
41 Ga0075434_100058301 3300006871 Unclassified 3838
42 Ga0068865_100095108 3300006881 Bacteria 2170
43 Ga0075436_100059904 3300006914 Unclassified 2630
44 Ga0097620_100219912 3300006931 Bacteria 1987
45 Ga0097620_100228906 3300006931 Bacteria 1947
46 Ga0099826_10000042 3300006948 Bacteria 92895
47 Ga0075435_100033924 3300007076 Unclassified 4040
48 Ga0111539_10019708 3300009094 Bacteria 8318
49 Ga0111539_10198283 3300009094 Unclassified 2341
50 Ga0111539_10539163 3300009094 Bacteria 1359
51 Ga0105245_10084093 3300009098 Bacteria 2914
52 Ga0105245_10436805 3300009098 Bacteria 1315
53 Ga0105248_10144996 3300009177 Bacteria 2679
54 Ga0105237_10730136 3300009545 Bacteria 997
55 Ga0105238_10583792 3300009551 Bacteria 1124
56 Ga0105239_10089461 3300010375 Bacteria 3395
57 Ga0105239_10204660 3300010375 Bacteria 2212
58 Ga0105239_10533812 3300010375 Bacteria 1335
59 Ga0157373_10228820 3300013100 Bacteria 1313
60 Ga0163163_10039858 3300014325 Bacteria 4586
61 Ga0157380_10032529 3300014326 Bacteria 4013
62 Ga0157376_10118381 3300014969 Bacteria 2343
63 Ga0209435_100023 3300025206 Bacteria 201972
64 Ga0209563_102025 3300025230 Bacteria 4830
65 Ga0209437_100023 3300025233 Bacteria 614195
66 Ga0209646_1000080 3300025246 Bacteria 201975
67 Ga0209026_1000076 3300025250 Bacteria 201975
68 Ga0209759_1000059 3300025256 Bacteria 201975
69 Ga0209233_1000062 3300025261 Bacteria 399685
70 Ga0209673_1000348 3300025273 Bacteria 84966
71 Ga0209130_1000389 3300025284 Bacteria 48487
72 Ga0209050_1005045 3300025298 Bacteria 8547
73 Ga0207426_1000361 3300025302 Bacteria 81889
74 Ga0209051_1000201 3300025303 Bacteria 106123
75 Ga0209257_1002937 3300025304 Bacteria 15684
76 Ga0207697_10104455 3300025315 Unclassified 1210
77 Ga0207705_10476323 3300025909 Bacteria 969
78 Ga0207695_10011276 3300025913 Bacteria 10836
79 Ga0207663_10057004 3300025916 Bacteria 2460
80 Ga0207652_10039343 3300025921 Bacteria 4013
81 Ga0207694_10123909 3300025924 Bacteria 2066
82 Ga0207650_10100935 3300025925 Unclassified 2221
83 Ga0207650_10312453 3300025925 Bacteria 1286
84 Ga0207706_10208000 3300025933 Unclassified 1715
85 Ga0207669_10494151 3300025937 Bacteria 978
86 Ga0207704_10074193 3300025938 Bacteria 2170
87 Ga0207661_10258360 3300025944 Unclassified 1551
88 Ga0207667_10876171 3300025949 Bacteria 891
89 Ga0207668_10265783 3300025972 Bacteria 1400
90 Ga0207640_10377296 3300025981 Bacteria 1148
91 Ga0207708_10326988 3300026075 Bacteria 1252
92 Ga0207702_10398962 3300026078 Bacteria 1326
93 Ga0207648_10128382 3300026089 Bacteria 2231
94 Ga0207648_10492037 3300026089 Bacteria 1121
95 Ga0207676_10206821 3300026095 Bacteria 1738
96 Ga0207675_100072337 3300026118 Bacteria 3225
97 Ga0207683_10122380 3300026121 Bacteria 2337
98 Ga0207683_10242821 3300026121 Bacteria 1643
99 Ga0209282_1000065 3300027666 Bacteria 91676
100 Ga0207428_10073626 3300027907 Bacteria 2679
101 Ga0207428_10281169 3300027907 Bacteria 1235
102 Ga0268266_10434120 3300028379 Bacteria 1246
103 Ga0268265_10463547 3300028380 Bacteria 1186
104 Ga0268265_10540891 3300028380 Bacteria 1104
105 Ga0268264_11024943 3300028381 Bacteria 832
106 Ga0307517_10117040 3300028786 Bacteria 1992
107 Ga0307515_10001253 3300028794 Bacteria 57911
108 Ga0307515_10428424 3300028794 Bacteria 942
109 Ga0265338_10013438 3300028800 Bacteria 9249
110 Ga0265338_10090172 3300028800 Bacteria 2538
111 Ga0265320_10008453 3300031240 Bacteria 6300
112 Ga0265340_10074435 3300031247 Bacteria 1606
113 Ga0265339_10070702 3300031249 Bacteria 1861
114 Ga0307408_100327856 3300031548 Bacteria 1292
115 Ga0316575_10027384 3300031665 Bacteria 2218
116 Ga0316575_10069398 3300031665 Bacteria 1415
117 Ga0316579_10011451 3300031691 Bacteria 3769
118 Ga0316579_10025544 3300031691 Bacteria 2667
119 Ga0316579_10173619 3300031691 Bacteria 1042
120 Ga0316579_10203526 3300031691 Bacteria 957
121 Ga0265314_10061713 3300031711 Bacteria 2551
122 Ga0265342_10048465 3300031712 Bacteria 2547
123 Ga0316576_10000547 3300031727 Bacteria 17677
124 Ga0316576_10002096 3300031727 Bacteria 11223
125 Ga0316576_10006200 3300031727 Bacteria 7422
126 Ga0316576_10024665 3300031727 Bacteria 4200
127 Ga0316576_10043743 3300031727 Bacteria 3232
128 Ga0316576_10064934 3300031727 Bacteria 2681
129 Ga0316576_10074200 3300031727 Bacteria 2514
130 Ga0316576_10143466 3300031727 Bacteria 1798
131 Ga0316576_10359861 3300031727 Bacteria 1082
132 Ga0316578_10004061 3300031728 Bacteria 6842
133 Ga0316578_10005344 3300031728 Bacteria 6212
134 Ga0316578_10015451 3300031728 Bacteria 4105
135 Ga0316578_10022469 3300031728 Bacteria 3517
136 Ga0316578_10028724 3300031728 Bacteria 3151
137 Ga0316578_10037903 3300031728 Bacteria 2777
138 Ga0316578_10045325 3300031728 Bacteria 2559
139 Ga0316578_10086716 3300031728 Bacteria 1866
140 Ga0316578_10209939 3300031728 Bacteria 1171
141 Ga0307516_10073148 3300031730 Bacteria 3285
142 Ga0316577_10001239 3300031733 Bacteria 11885
143 Ga0316577_10020662 3300031733 Bacteria 3649
144 Ga0316577_10041426 3300031733 Bacteria 2576
145 Ga0316577_10055019 3300031733 Bacteria 2220
146 Ga0316577_10100464 3300031733 Bacteria 1621
147 Ga0316577_10127697 3300031733 Bacteria 1430
148 Ga0316577_10177682 3300031733 Bacteria 1202
149 Ga0307413_10526238 3300031824 Bacteria 954
150 Ga0307411_10066237 3300032005 Bacteria 2426
151 Ga0316583_10012267 3300032133 Bacteria 3092
152 Ga0316583_10013011 3300032133 Bacteria 3000
153 Ga0316583_10040386 3300032133 Bacteria 1652
154 Ga0316585_10002246 3300032137 Bacteria 5193
155 Ga0316585_10014022 3300032137 Bacteria 2390
156 Ga0316585_10086800 3300032137 Bacteria 1021
157 Ga0316580_10001261 3300032139 Bacteria 6530
158 Ga0316580_10005293 3300032139 Bacteria 3760
159 Ga0316580_10005737 3300032139 Bacteria 3640
160 Ga0316580_10010443 3300032139 Bacteria 2806
161 Ga0316586_1000377 3300033527 Bacteria 4213
162 Ga0316586_1001210 3300033527 Bacteria 2867
163 Ga0316586_1002047 3300033527 Bacteria 2454
164 Ga0316586_1008433 3300033527 Bacteria 1528
165 Ga0316588_1008635 3300033528 Bacteria 2103
166 Ga0316588_1048873 3300033528 Bacteria 1024
167 Ga0316596_1006938 3300033541 Bacteria 2656
168 Ga0316574_0003770 3300035398 Bacteria 7853
169 Ga0316574_0050873 3300035398 Bacteria 2580
170 Ga0373927_0001501 3300035695 Bacteria 17568
171 Ga0373933_0219369 3300035724 Bacteria 1220
172 Ga0373937_0041554 3300036401 Bacteria 4194
173 Ga0316582_0012498 3300036647 Bacteria 4742
174 Ga0316582_0017584 3300036647 Bacteria 4140
175 Ga0316582_0021911 3300036647 Bacteria 3784
176 Ga0316582_0089058 3300036647 Bacteria 2028
177 Ga0316582_0107044 3300036647 Bacteria 1857
178 Ga0316582_0154635 3300036647 Bacteria 1552
179 Ga0316584_0006909 3300036712 Bacteria 7715
180 Ga0316584_0007324 3300036712 Bacteria 7537
181 Ga0316584_0009184 3300036712 Bacteria 6848
182 Ga0316584_0044213 3300036712 Bacteria 3321
183 Ga0316584_0053644 3300036712 Bacteria 3017
184 Ga0316584_0080623 3300036712 Bacteria 2438
185 Ga0316584_0090176 3300036712 Bacteria 2295
186 Ga0316584_0149428 3300036712 Bacteria 1739
187 Ga0373925_0002442 3300037068 Bacteria 14897
188 Ga0395905_0055209 3300037471 Bacteria 3717
189 Ga0395905_0113725 3300037471 Bacteria 2543
190 Ga0316581_0009162 3300037588 Bacteria 2714
191 Ga0451833_1443940 3300041491 Bacteria 984
192 Ga0451835_0928277 3300041492 Bacteria 4678
193 Ga0451837_1573602 3300041494 Bacteria 1902
194 Ga0451839_1000783 3300041496 Bacteria 1494
195 Ga0451845_0213170 3300041501 Bacteria 2446
196 Ga0451849_0714017 3300041505 Bacteria 4752
197 Ga0451851_0075445 3300041507 Bacteria 817
198 Ga0451843_0318838 3300041509 Bacteria 5307
199 Ga0451853_1778854 3300041512 Bacteria 7986
200 Ga0451577_0211041 3300042876 Bacteria 1754
201 Ga0451577_0232061 3300042876 Bacteria 1669
202 Ga0453684_0007471 3300044712 Bacteria 20067
203 Ga0453684_0246181 3300044712 Bacteria 2055
204 Ga0453684_0804664 3300044712 Unclassified 1013
205 Ga0451576_0146540 3300045051 Bacteria 2461
206 Ga0495617_030086 3300046452 Bacteria 1826
207 Ga0495607_0031955 3300046501 Bacteria 3219
208 Ga0495608_0272963 3300046511 Bacteria 1051
209 Ga0495648_0110932 3300046524 Bacteria 1493
210 Ga0495645_0091945 3300046543 Bacteria 2167
211 Ga0495625_0003211 3300046660 Bacteria 16592
212 Ga0495658_0005874 3300046683 Bacteria 6024
213 Ga0495672_0018443 3300047320 Bacteria 4631
214 Ga0495684_0073957 3300047471 Bacteria 2589
215 Ga0496112_0067292 3300048915 Unclassified 3535
216 Ga0496113_0267554 3300048916 Unclassified 1366
217 Ga0496117_0057163 3300048920 Bacteria 2712
218 Ga0496119_0099945 3300048922 Bacteria 1630
219 Ga0496120_0099610 3300048923 Bacteria 1538
220 Ga0496121_0000033 3300048924 Bacteria 377542
221 Ga0496121_0001871 3300048924 Bacteria 33787
222 Ga0496121_0023445 3300048924 Bacteria 5943
223 Ga0496122_0024521 3300048925 Bacteria 5275
224 Ga0496122_0164011 3300048925 Bacteria 1350
225 Ga0496123_0009835 3300048926 Bacteria 8539
226 Ga0496123_0121898 3300048926 Bacteria 1464
227 Ga0496124_0025782 3300048927 Bacteria 5315
228 Ga0496125_0000152 3300048928 Bacteria 153295
229 Ga0496125_0072366 3300048928 Bacteria 2686
230 Ga0496125_0089322 3300048928 Bacteria 2318
231 Ga0496126_0271748 3300048929 Bacteria 1406
232 Ga0501032_0130146 3300049569 Bacteria 1661
233 Ga0501033_0000002 3300049570 Bacteria 668574
234 Ga0501034_0039525 3300049571 Bacteria 4778
235 Ga0501034_0177046 3300049571 Bacteria 2099
236 Ga0501034_0373965 3300049571 Bacteria 1351
237 Ga0501036_0273860 3300049572 Bacteria 1413
238 Ga0501036_0453985 3300049572 Bacteria 1068
239 Ga0501038_0262880 3300049574 Bacteria 1363
240 Ga0501038_0697133 3300049574 Bacteria 761
241 Ga0501046_0000246 3300049580 Bacteria 55453
242 Ga0501046_0038943 3300049580 Bacteria 3811
243 Ga0501046_0407201 3300049580 Bacteria 982
244 Ga0501048_0023307 3300049582 Bacteria 4526
245 Ga0501070_0165298 3300049586 Bacteria 1824
246 Ga0501071_0024363 3300049587 Bacteria 4233
247 Ga0501072_0100018 3300049588 Bacteria 2305
248 Ga0501072_0364197 3300049588 Bacteria 1147
249 Ga0501073_0306147 3300049589 Bacteria 1096
250 Ga0501075_0191048 3300049591 Bacteria 1562
251 Ga0501076_0040800 3300049592 Bacteria 3648
252 Ga0501077_0088505 3300049593 Bacteria 1962
253 Ga0501079_0227673 3300049741 Bacteria 1456
254 Ga0501079_0479365 3300049741 Bacteria 978
255 Ga0501083_0287023 3300049744 Bacteria 1070
256 Ga0501035_0212212 3300049822 Bacteria 1656
257 Ga0501044_0107510 3300049823 Bacteria 2801
258 Ga0501045_0029430 3300049824 Bacteria 3970
259 nmdc:mga00v17_609_c1 3300050491 Bacteria 19791
260 nmdc:mga00v17_6499_c1 3300050491 Bacteria 6204
261 nmdc:mga06z11_231200_c1 3300050494 Bacteria 1083
262 nmdc:mga07m45_25139_c1 3300050496 Bacteria 3264
263 nmdc:mga05p37_144147_c1 3300050507 Unclassified 2917
264 nmdc:mga06r32_58697_c1 3300050510 Bacteria 3698
265 nmdc:mga08y16_60286_c1 3300050511 Bacteria 3964
266 nmdc:mga08y16_607263_c1 3300050511 Bacteria 1102
267 nmdc:mga0n895_296056_c1 3300050512 Unclassified 1641
268 nmdc:mga0rr50_86997_c1 3300050513 Unclassified 2425
269 nmdc:mga08x19_40117_c1 3300050514 Unclassified 2978
270 nmdc:mga0a205_221152_c1 3300050515 Unclassified 1779
271 Ga0500556_0000511 3300053104 Bacteria 26561
272 Ga0500593_000442 3300053117 Bacteria 16334
273 Ga0500618_001133 3300053125 Bacteria 12921
274 Ga0500568_0000002 3300053139 Bacteria 880601
275 Ga0500568_0000873 3300053139 Bacteria 21154
276 Ga0500568_0009206 3300053139 Bacteria 4709
277 Ga0500616_0001564 3300053153 Bacteria 21442
278 Ga0500616_0018788 3300053153 Bacteria 3905
279 Ga0500622_0000241 3300053156 Bacteria 56799
280 Ga0500622_0049332 3300053156 Bacteria 2171
281 Ga0501084_0314538 3300054114 Bacteria 1322
282 Ga0501082_0068273 3300060353 Bacteria 3061
283 Ga0501082_0158941 3300060353 Bacteria 1964
284 Ga0530510_0014666 3300061734 Bacteria 5532
285 Ga0530510_0036481 3300061734 Bacteria 3544
286 2510840595 2510461069 Bacteria 5505000
287 2514002258 2513237159 Bacteria 6810126
288 2515655992 2515154116 Bacteria 7552979
289 2517081038 2516653085 Bacteria 7346596
290 2517407978 2517287029 Bacteria 6905599
291 2574430963 2574179768 Bacteria 4907129
292 2585540159 2585427528 Bacteria 6842387
293 2585838357 2585427593 Bacteria 7141551
294 2599721727 2599185236 Bacteria 6875203
295 2601612566 2600255279 Bacteria 5605316
296 2601749317 2600255308 Bacteria 5611129
297 2644005004 2643221599 Bacteria 6292121
298 2644050085 2643221607 Bacteria 6314006
299 2644202734 2643221636 Bacteria 6583769
300 2644208507 2643221637 Bacteria 5345260
301 2644298983 2643221653 Bacteria 4569637
302 2644482999 2643221686 Bacteria 6310811
303 2644652038 2643221718 Bacteria 5345506
304 2644657211 2643221719 Bacteria 4568197
305 2671116540 2667528174 Bacteria 6435400
306 2776914268 2775507049 Bacteria 6284736
307 2788436753 2786546940 Bacteria 6396474
308 2793350174 2791355264 Bacteria 6429314
309 2793366203 2791355267 Bacteria 7222458
310 2819241005 2818991272 Bacteria 4622173
311 2821125846 2821123053 Bacteria 7836056
312 2838030331 2838029111 Bacteria 6603031
313 2838693556 2838686498 Bacteria 7807632
314 2838735449 2838729681 Bacteria 7400765
315 2838737705 2838736955 Bacteria 5760694
316 2838748351 2838742623 Bacteria 7396178
317 2841841926 2841840854 Bacteria 5761912
318 2841858415 2841851746 Bacteria 7532261
319 2842141705 2842140634 Bacteria 5759631
320 2842162663 2842156927 Bacteria 6894975
321 2842186167 2842180545 Bacteria 6888678
322 2842236042 2842229732 Bacteria 7475766
323 2842249973 2842243621 Bacteria 7421798
324 2842263269 2842257432 Bacteria 7401195
325 2842278025 2842271015 Bacteria 7807131
326 2842477390 2842475841 Bacteria 6603183
327 2842488494 2842482326 Bacteria 7212537
328 2842504186 2842502639 Bacteria 6604161
329 2842525023 2842521101 Bacteria 6569494
330 2844461112 2844454524 Bacteria 7952546
331 2857532407 2857531043 Bacteria 6754041
332 2919413541 2919408235 Bacteria 6149349
333 2929144276 2929138655 Bacteria 5810547
334 2933598751 2933594066 Bacteria 5594265
335 2989779551 2989776772 Bacteria 4843317
336 3005420611 3005416602 Bacteria 7064308
337 8005249843 8005246636 Bacteria 4933972
338 8005318028 8005314921 Bacteria 7072929
339 8056379891 8056375014 Bacteria 7006639
340 Ga0068859_100219926
341 JGI25156J39149_1000034
342 JGI25162J39368_1000976
343 JGI25154J39366_1000034
344 JGI25157J39369_1000092
345 JGI25165J46597_1001088
346 rootH1_10254748
347 rootH1_10341265
348 JGI25160J50197_1001724
349 Ga0055540_1000126
350 Ga0055531_10072483
351 Ga0065165_1059037
352 Ga0065712_10000280
353 Ga0065715_10109699
354 Ga0070690_100147084
355 Ga0070670_100130475
356 Ga0070659_100061654
357 Ga0070701_10139706
358 Ga0070678_100135721
359 Ga0070662_100092801
360 Ga0068867_100549417
361 Ga0070679_100070626
362 Ga0070696_100768408
363 Ga0070665_100301299
364 Ga0070665_100310546
365 Ga0068856_100752339
366 Ga0068859_100228909
367 Ga0068864_100009146
368 Ga0068858_100360213
369 Ga0068860_100079743
370 Ga0068860_101515500
371 Ga0081455_10066733
372 Ga0081538_10064024
373 Ga0075365_10412038
374 Ga0075364_10042726
375 Ga0097621_100087647
376 Ga0097621_100382556
377 Ga0075370_10026114
378 Ga0075431_100083003
379 Ga0075431_100202484
380 Ga0075434_100058301
381 Ga0068865_100095108
382 Ga0075436_100059904
383 Ga0097620_100219912
384 Ga0097620_100228906
385 Ga0099826_10000042
386 Ga0075435_100033924
387 Ga0111539_10019708
388 Ga0111539_10198283
389 Ga0111539_10539163
390 Ga0105245_10084093
391 Ga0105245_10436805
392 Ga0105248_10144996
393 Ga0105237_10730136
394 Ga0105238_10583792
395 Ga0105239_10089461
396 Ga0105239_10204660
397 Ga0105239_10533812
398 Ga0157373_10228820
399 Ga0163163_10039858
400 Ga0157380_10032529
401 Ga0157376_10118381
402 Ga0209435_100023
403 Ga0209563_102025
404 Ga0209437_100023
405 Ga0209646_1000080
406 Ga0209026_1000076
407 Ga0209759_1000059
408 Ga0209233_1000062
409 Ga0209673_1000348
410 Ga0209130_1000389
411 Ga0209050_1005045
412 Ga0207426_1000361
413 Ga0209051_1000201
414 Ga0209257_1002937
415 Ga0207697_10104455
416 Ga0207705_10476323
417 Ga0207695_10011276
418 Ga0207663_10057004
419 Ga0207652_10039343
420 Ga0207694_10123909
421 Ga0207650_10100935
422 Ga0207650_10312453
423 Ga0207706_10208000
424 Ga0207669_10494151
425 Ga0207704_10074193
426 Ga0207661_10258360
427 Ga0207667_10876171
428 Ga0207668_10265783
429 Ga0207640_10377296
430 Ga0207708_10326988
431 Ga0207702_10398962
432 Ga0207648_10128382
433 Ga0207648_10492037
434 Ga0207676_10206821
435 Ga0207675_100072337
436 Ga0207683_10122380
437 Ga0207683_10242821
438 Ga0209282_1000065
439 Ga0207428_10073626
440 Ga0207428_10281169
441 Ga0268266_10434120
442 Ga0268265_10463547
443 Ga0268265_10540891
444 Ga0268264_11024943
445 Ga0307517_10117040
446 Ga0307515_10001253
447 Ga0307515_10428424
448 Ga0265338_10013438
449 Ga0265338_10090172
450 Ga0265320_10008453
451 Ga0265340_10074435
452 Ga0265339_10070702
453 Ga0307408_100327856
454 Ga0316575_10027384
455 Ga0316575_10069398
456 Ga0316579_10011451
457 Ga0316579_10025544
458 Ga0316579_10173619
459 Ga0316579_10203526
460 Ga0265314_10061713
461 Ga0265342_10048465
462 Ga0316576_10000547
463 Ga0316576_10002096
464 Ga0316576_10006200
465 Ga0316576_10024665
466 Ga0316576_10043743
467 Ga0316576_10064934
468 Ga0316576_10074200
469 Ga0316576_10143466
470 Ga0316576_10359861
471 Ga0316578_10004061
472 Ga0316578_10005344
473 Ga0316578_10015451
474 Ga0316578_10022469
475 Ga0316578_10028724
476 Ga0316578_10037903
477 Ga0316578_10045325
478 Ga0316578_10086716
479 Ga0316578_10209939
480 Ga0307516_10073148
481 Ga0316577_10001239
482 Ga0316577_10020662
483 Ga0316577_10041426
484 Ga0316577_10055019
485 Ga0316577_10100464
486 Ga0316577_10127697
487 Ga0316577_10177682
488 Ga0307413_10526238
489 Ga0307411_10066237
490 Ga0316583_10012267
491 Ga0316583_10013011
492 Ga0316583_10040386
493 Ga0316585_10002246
494 Ga0316585_10014022
495 Ga0316585_10086800
496 Ga0316580_10001261
497 Ga0316580_10005293
498 Ga0316580_10005737
499 Ga0316580_10010443
500 Ga0316586_1000377
501 Ga0316586_1001210
502 Ga0316586_1002047
503 Ga0316586_1008433
504 Ga0316588_1008635
505 Ga0316588_1048873
506 Ga0316596_1006938
507 Ga0316574_0003770
508 Ga0316574_0050873
509 Ga0373927_0001501
510 Ga0373933_0219369
511 Ga0373937_0041554
512 Ga0316582_0012498
513 Ga0316582_0017584
514 Ga0316582_0021911
515 Ga0316582_0089058
516 Ga0316582_0107044
517 Ga0316582_0154635
518 Ga0316584_0006909
519 Ga0316584_0007324
520 Ga0316584_0009184
521 Ga0316584_0044213
522 Ga0316584_0053644
523 Ga0316584_0080623
524 Ga0316584_0090176
525 Ga0316584_0149428
526 Ga0373925_0002442
527 Ga0395905_0055209
528 Ga0395905_0113725
529 Ga0316581_0009162
530 Ga0451833_1443940
531 Ga0451835_0928277
532 Ga0451837_1573602
533 Ga0451839_1000783
534 Ga0451845_0213170
535 Ga0451849_0714017
536 Ga0451851_0075445
537 Ga0451843_0318838
538 Ga0451853_1778854
539 Ga0451577_0211041
540 Ga0451577_0232061
541 Ga0453684_0007471
542 Ga0453684_0246181
543 Ga0453684_0804664
544 Ga0451576_0146540
545 Ga0495617_030086
546 Ga0495607_0031955
547 Ga0495608_0272963
548 Ga0495648_0110932
549 Ga0495645_0091945
550 Ga0495625_0003211
551 Ga0495658_0005874
552 Ga0495672_0018443
553 Ga0495684_0073957
554 Ga0496112_0067292
555 Ga0496113_0267554
556 Ga0496117_0057163
557 Ga0496119_0099945
558 Ga0496120_0099610
559 Ga0496121_0000033
560 Ga0496121_0001871
561 Ga0496121_0023445
562 Ga0496122_0024521
563 Ga0496122_0164011
564 Ga0496123_0009835
565 Ga0496123_0121898
566 Ga0496124_0025782
567 Ga0496125_0000152
568 Ga0496125_0072366
569 Ga0496125_0089322
570 Ga0496126_0271748
571 Ga0501032_0130146
572 Ga0501033_0000002
573 Ga0501034_0039525
574 Ga0501034_0177046
575 Ga0501034_0373965
576 Ga0501036_0273860
577 Ga0501036_0453985
578 Ga0501038_0262880
579 Ga0501038_0697133
580 Ga0501046_0000246
581 Ga0501046_0038943
582 Ga0501046_0407201
583 Ga0501048_0023307
584 Ga0501070_0165298
585 Ga0501071_0024363
586 Ga0501072_0100018
587 Ga0501072_0364197
588 Ga0501073_0306147
589 Ga0501075_0191048
590 Ga0501076_0040800
591 Ga0501077_0088505
592 Ga0501079_0227673
593 Ga0501079_0479365
594 Ga0501083_0287023
595 Ga0501035_0212212
596 Ga0501044_0107510
597 Ga0501045_0029430
598 nmdc:mga00v17_609_c1
599 nmdc:mga00v17_6499_c1
600 nmdc:mga06z11_231200_c1
601 nmdc:mga07m45_25139_c1
602 nmdc:mga05p37_144147_c1
603 nmdc:mga06r32_58697_c1
604 nmdc:mga08y16_60286_c1
605 nmdc:mga08y16_607263_c1
606 nmdc:mga0n895_296056_c1
607 nmdc:mga0rr50_86997_c1
608 nmdc:mga08x19_40117_c1
609 nmdc:mga0a205_221152_c1
610 Ga0500556_0000511
611 Ga0500593_000442
612 Ga0500618_001133
613 Ga0500568_0000002
614 Ga0500568_0000873
615 Ga0500568_0009206
616 Ga0500616_0001564
617 Ga0500616_0018788
618 Ga0500622_0000241
619 Ga0500622_0049332
620 Ga0501084_0314538
621 Ga0501082_0068273
622 Ga0501082_0158941
623 Ga0530510_0014666
624 Ga0530510_0036481
625 2510840595
626 2514002258
627 2515655992
628 2517081038
629 2517407978
630 2574430963
631 2585540159
632 2585838357
633 2599721727
634 2601612566
635 2601749317
636 2644005004
637 2644050085
638 2644202734
639 2644208507
640 2644298983
641 2644482999
642 2644652038
643 2644657211
644 2671116540
645 2776914268
646 2788436753
647 2793350174
648 2793366203
649 2819241005
650 2821125846
651 2838030331
652 2838693556
653 2838735449
654 2838737705
655 2838748351
656 2841841926
657 2841858415
658 2842141705
659 2842162663
660 2842186167
661 2842236042
662 2842249973
663 2842263269
664 2842278025
665 2842477390
666 2842488494
667 2842504186
668 2842525023
669 2844461112
670 2857532407
671 2919413541
672 2929144276
673 2933598751
674 2989779551
675 3005420611
676 8005249843
677 8005318028
678 8056379891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

47

156

0.99

PF00486

Trans_reg_C

Transcriptional regulatory protein, C terminal

188

259

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6is2-assembly1.cif.gz_A crystal structure of staphylococcus aureus response regulator arlr receiver domain in complex with mg 0.9678 1 118
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9663 1 118
3nnn-assembly1.cif.gz_B bef3 activated drrd receiver domain 0.9651 2 118
8fk2-assembly1.cif.gz_B the n-terminal vicr from streptococcus mutans 0.9621 2 118
1zh4-assembly1.cif.gz_A crystal structure of the mg+2/bef3-bound receiver domain of kdp potassium transport system response regulator kdpe 0.9591 2 118
ID Description Score Start End Superfamily
af_Q9KJN4_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.98 1 77 3.40.50.2300
af_Q2FY79_1_81_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9777 2 80 3.40.50.2300
af_P76340_1_79_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9762 1 80 3.40.50.2300
af_O07776_22_102_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9728 1 80 3.40.50.2300
af_P52076_1_80_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9647 1 80 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A3L7TDR4-F1-model_v4 Response regulator 0.9722 2 117 GO:0000160
AF-A0A3N5E267-F1-model_v4 Response regulator 0.9668 2 117 GO:0000160
AF-A0A836T6Z4-F1-model_v4 deleted 0.9651 2 118
AF-A0A399NDE7-F1-model_v4 DNA-binding response regulator 0.9625 1 120 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A3B0T465-F1-model_v4 Response regulator of zinc sigma-54-dependent two-component system 0.9584 1 118 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565

Map