F413456

General Info

Members Datasets Scaffolds Average Seq Length
338 230 676 67

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_101389395|Ga0070712_1013893951
Length 72
Sequence MGAVVELNRSLEQELQALLRGASLECLVCGEFVLHLPGGEIFCPECGCSLGARLAEVRKADTMRDAGRVTAG

Samples

Sample ID Description Type Environment
1 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
94 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
95 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
109 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
158 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
159 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
160 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
161 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
174 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
175 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
183 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
184 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
185 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
186 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
189 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
192 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
193 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
194 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
201 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
230 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.41
Metatranscriptomes 0.59
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.18
Nodule 0
Rhizoplane 5.62
Rhizosphere 91.72
Stem 0
Stem Tuber 0
Unclassified 5.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070712_101389395 3300006175 Bacteria 612
2 JGI24744J21845_10001812 3300002077 Bacteria 4291
3 Ga0070690_100163646 3300005330 Bacteria 1526
4 Ga0068869_100391944 3300005334 Bacteria 1140
5 Ga0068869_101186134 3300005334 Bacteria 671
6 Ga0070666_10888352 3300005335 Bacteria 658
7 Ga0070680_100121239 3300005336 Bacteria 2183
8 Ga0070682_100094112 3300005337 Bacteria 1965
9 Ga0068868_100163187 3300005338 Bacteria 1841
10 Ga0070689_100386487 3300005340 Bacteria 1180
11 Ga0070687_100121499 3300005343 Bacteria 1494
12 Ga0070692_10054476 3300005345 Bacteria 2088
13 Ga0070668_100056957 3300005347 Bacteria 3019
14 Ga0070669_100440398 3300005353 Bacteria 1072
15 Ga0070675_100713858 3300005354 Bacteria 913
16 Ga0070671_100413655 3300005355 Bacteria 1154
17 Ga0070674_100022242 3300005356 Bacteria 4087
18 Ga0070673_100011004 3300005364 Bacteria 6159
19 Ga0070688_100501612 3300005365 Bacteria 915
20 Ga0070659_100058112 3300005366 Bacteria 3051
21 Ga0070709_10416799 3300005434 Bacteria 1006
22 Ga0070714_100432248 3300005435 Bacteria 1248
23 Ga0070713_100090956 3300005436 Bacteria 2624
24 Ga0070713_100174932 3300005436 Bacteria 1925
25 Ga0070710_10006010 3300005437 Bacteria 5798
26 Ga0070701_10012896 3300005438 Bacteria 3785
27 Ga0070711_100333818 3300005439 Bacteria 1214
28 Ga0070705_100706358 3300005440 Bacteria 792
29 Ga0070700_100137498 3300005441 Bacteria 1656
30 Ga0070694_100325225 3300005444 Bacteria 1184
31 Ga0070694_100407671 3300005444 Bacteria 1065
32 Ga0070694_100800950 3300005444 Bacteria 772
33 Ga0070708_100142490 3300005445 Bacteria 2223
34 Ga0070708_100198514 3300005445 Bacteria 1877
35 Ga0070708_102221871 3300005445 Unclassified 507
36 Ga0070663_100137537 3300005455 Bacteria 1861
37 Ga0070678_100006210 3300005456 Bacteria 6987
38 Ga0070662_100115990 3300005457 Bacteria 2046
39 Ga0070662_101999097 3300005457 Unclassified 501
40 Ga0070681_12006896 3300005458 Bacteria 506
41 Ga0068867_100276451 3300005459 Bacteria 1375
42 Ga0070685_10361183 3300005466 Bacteria 995
43 Ga0070706_100044401 3300005467 Bacteria 4106
44 Ga0070706_100096034 3300005467 Bacteria 2751
45 Ga0070706_100203069 3300005467 Bacteria 1851
46 Ga0070706_101705654 3300005467 Bacteria 574
47 Ga0070707_100003196 3300005468 Bacteria 15507
48 Ga0070707_100675567 3300005468 Bacteria 995
49 Ga0070707_100742790 3300005468 Bacteria 944
50 Ga0070707_101186602 3300005468 Unclassified 729
51 Ga0070699_100256480 3300005518 Bacteria 1563
52 Ga0070699_100366967 3300005518 Bacteria 1298
53 Ga0070699_100484705 3300005518 Bacteria 1122
54 Ga0070699_101266122 3300005518 Bacteria 676
55 Ga0070699_102030441 3300005518 Unclassified 525
56 Ga0070679_100397350 3300005530 Bacteria 1324
57 Ga0070697_100168394 3300005536 Bacteria 1853
58 Ga0070697_100230920 3300005536 Bacteria 1578
59 Ga0068853_100010132 3300005539 Bacteria 7617
60 Ga0070672_100379714 3300005543 Bacteria 1208
61 Ga0070672_101717894 3300005543 Unclassified 564
62 Ga0070686_100135439 3300005544 Bacteria 1708
63 Ga0070686_101110041 3300005544 Bacteria 653
64 Ga0070686_101267151 3300005544 Bacteria 614
65 Ga0070695_100145679 3300005545 Bacteria 1647
66 Ga0070696_100321700 3300005546 Bacteria 1190
67 Ga0070696_100443864 3300005546 Bacteria 1023
68 Ga0070696_101178452 3300005546 Bacteria 647
69 Ga0070696_101214324 3300005546 Bacteria 637
70 Ga0070693_101122164 3300005547 Bacteria 600
71 Ga0070665_100145927 3300005548 Bacteria 2369
72 Ga0070704_100594523 3300005549 Bacteria 972
73 Ga0070704_100706473 3300005549 Bacteria 894
74 Ga0068855_101308534 3300005563 Bacteria 750
75 Ga0068854_101919800 3300005578 Bacteria 545
76 Ga0068854_102242686 3300005578 Bacteria 505
77 Ga0068856_100176090 3300005614 Bacteria 2151
78 Ga0068856_101776081 3300005614 Bacteria 629
79 Ga0070702_100003435 3300005615 Bacteria 7085
80 Ga0068852_100026941 3300005616 Bacteria 4679
81 Ga0068859_102358745 3300005617 Bacteria 586
82 Ga0068864_101585398 3300005618 Bacteria 659
83 Ga0068866_10071570 3300005718 Bacteria 1834
84 Ga0068861_101326537 3300005719 Bacteria 700
85 Ga0068870_10763152 3300005840 Bacteria 673
86 Ga0068863_100304429 3300005841 Bacteria 1546
87 Ga0068858_102182662 3300005842 Bacteria 547
88 Ga0081455_10051755 3300005937 Bacteria 3521
89 Ga0081538_10032891 3300005981 Bacteria 3463
90 Ga0081540_1009639 3300005983 Bacteria 6638
91 Ga0081540_1016752 3300005983 Bacteria 4569
92 Ga0081539_10013142 3300005985 Bacteria 6274
93 Ga0070717_10019918 3300006028 Bacteria 5268
94 Ga0070717_10109896 3300006028 Bacteria 2350
95 Ga0075365_10005738 3300006038 Bacteria 6736
96 Ga0075364_11038794 3300006051 Bacteria 557
97 Ga0075432_10002751 3300006058 Bacteria 5888
98 Ga0070715_10104157 3300006163 Bacteria 1328
99 Ga0070716_100300415 3300006173 Bacteria 1116
100 Ga0070716_101455844 3300006173 Bacteria 558
101 Ga0070716_101500274 3300006173 Unclassified 551
102 Ga0070712_100004780 3300006175 Bacteria 8372
103 Ga0070712_100305190 3300006175 Bacteria 1289
104 Ga0070712_101349959 3300006175 Bacteria 622
105 Ga0075367_10261665 3300006178 Bacteria 1086
106 Ga0097621_100428418 3300006237 Bacteria 1188
107 Ga0068871_100547731 3300006358 Bacteria 1047
108 Ga0075428_100057745 3300006844 Bacteria 4248
109 Ga0075428_101835535 3300006844 Bacteria 631
110 Ga0075431_100347258 3300006847 Bacteria 1492
111 Ga0075431_100613629 3300006847 Bacteria 1071
112 Ga0075433_10015782 3300006852 Bacteria 6208
113 Ga0075433_10047129 3300006852 Bacteria 3749
114 Ga0075434_100135858 3300006871 Bacteria 2478
115 Ga0075434_101363345 3300006871 Bacteria 719
116 Ga0068865_100519491 3300006881 Bacteria 995
117 Ga0068865_100534294 3300006881 Bacteria 982
118 Ga0075436_100104837 3300006914 Bacteria 1971
119 Ga0097620_102358741 3300006931 Bacteria 586
120 Ga0075435_100011240 3300007076 Bacteria 6573
121 Ga0075435_100044416 3300007076 Bacteria 3559
122 Ga0111539_12657330 3300009094 Bacteria 580
123 Ga0111539_13457257 3300009094 Bacteria 507
124 Ga0105245_10004539 3300009098 Bacteria 12257
125 Ga0105245_10099034 3300009098 Bacteria 2694
126 Ga0105247_10839192 3300009101 Bacteria 704
127 Ga0114129_10667179 3300009147 Bacteria 1340
128 Ga0114129_10695308 3300009147 Bacteria 1307
129 Ga0114129_10743186 3300009147 Bacteria 1256
130 Ga0105243_10863016 3300009148 Bacteria 897
131 Ga0105243_11045799 3300009148 Bacteria 822
132 Ga0105243_12596695 3300009148 Bacteria 546
133 Ga0105241_11139176 3300009174 Bacteria 736
134 Ga0105242_10067313 3300009176 Bacteria 2961
135 Ga0105248_10117575 3300009177 Bacteria 2998
136 Ga0105248_11228868 3300009177 Bacteria 847
137 Ga0105238_10945199 3300009551 Bacteria 881
138 Ga0105249_10010495 3300009553 Bacteria 8138
139 Ga0105239_10013008 3300010375 Bacteria 9256
140 Ga0105246_10096547 3300011119 Bacteria 2143
141 Ga0157347_1042397 3300012502 Bacteria 605
142 Ga0157326_1093090 3300012513 Bacteria 510
143 Ga0157373_10352335 3300013100 Bacteria 1050
144 Ga0157371_10670032 3300013102 Bacteria 775
145 Ga0157369_11426630 3300013105 Bacteria 705
146 Ga0157369_11599290 3300013105 Bacteria 663
147 Ga0157374_10498437 3300013296 Bacteria 1222
148 Ga0157374_12402689 3300013296 Bacteria 554
149 Ga0157378_10008166 3300013297 Bacteria 9132
150 Ga0157378_12514530 3300013297 Bacteria 567
151 Ga0163162_10132965 3300013306 Bacteria 2597
152 Ga0163162_13167040 3300013306 Bacteria 528
153 Ga0157372_10625137 3300013307 Bacteria 1255
154 Ga0157375_10976848 3300013308 Bacteria 987
155 Ga0157375_12666694 3300013308 Bacteria 597
156 Ga0157380_10033478 3300014326 Bacteria 3957
157 Ga0157380_13275901 3300014326 Bacteria 517
158 Ga0157377_10042494 3300014745 Bacteria 2524
159 Ga0157379_11106653 3300014968 Bacteria 759
160 Ga0157376_12107983 3300014969 Bacteria 602
161 Ga0213871_10230364 3300021441 Bacteria 584
162 Ga0207653_10006357 3300025885 Bacteria 3686
163 Ga0207692_10011277 3300025898 Bacteria 3796
164 Ga0207642_10002046 3300025899 Bacteria 6226
165 Ga0207680_11135144 3300025903 Bacteria 558
166 Ga0207699_10015203 3300025906 Bacteria 3994
167 Ga0207699_10601941 3300025906 Bacteria 800
168 Ga0207684_10084707 3300025910 Bacteria 2700
169 Ga0207684_10125151 3300025910 Bacteria 2205
170 Ga0207654_10883257 3300025911 Bacteria 648
171 Ga0207707_10522792 3300025912 Bacteria 1010
172 Ga0207707_11026983 3300025912 Bacteria 675
173 Ga0207693_10024393 3300025915 Bacteria 4799
174 Ga0207693_10477528 3300025915 Bacteria 974
175 Ga0207663_10008266 3300025916 Bacteria 5433
176 Ga0207663_10523103 3300025916 Bacteria 924
177 Ga0207660_10259703 3300025917 Bacteria 1373
178 Ga0207662_10040430 3300025918 Bacteria 2741
179 Ga0207652_10935131 3300025921 Bacteria 764
180 Ga0207646_10007307 3300025922 Bacteria 11258
181 Ga0207646_10617779 3300025922 Bacteria 972
182 Ga0207681_10401503 3300025923 Bacteria 1107
183 Ga0207687_10018169 3300025927 Bacteria 4638
184 Ga0207687_10339139 3300025927 Bacteria 1222
185 Ga0207700_10032594 3300025928 Bacteria 3718
186 Ga0207700_10283764 3300025928 Bacteria 1425
187 Ga0207664_11236986 3300025929 Bacteria 665
188 Ga0207644_11775935 3300025931 Bacteria 516
189 Ga0207706_10186658 3300025933 Bacteria 1821
190 Ga0207706_10963084 3300025933 Bacteria 718
191 Ga0207686_10260431 3300025934 Bacteria 1271
192 Ga0207709_10005788 3300025935 Bacteria 6987
193 Ga0207709_10767908 3300025935 Bacteria 776
194 Ga0207670_10174733 3300025936 Bacteria 1613
195 Ga0207704_10004485 3300025938 Bacteria 6382
196 Ga0207665_10231289 3300025939 Bacteria 1359
197 Ga0207665_10615675 3300025939 Bacteria 849
198 Ga0207665_10957442 3300025939 Bacteria 680
199 Ga0207691_10104786 3300025940 Bacteria 2520
200 Ga0207691_11056783 3300025940 Bacteria 676
201 Ga0207711_10071146 3300025941 Bacteria 3018
202 Ga0207711_10543626 3300025941 Bacteria 1083
203 Ga0207689_10289107 3300025942 Bacteria 1358
204 Ga0207651_10355250 3300025960 Bacteria 1235
205 Ga0207712_10057589 3300025961 Bacteria 2742
206 Ga0207668_11873420 3300025972 Bacteria 541
207 Ga0207658_10299947 3300025986 Bacteria 1384
208 Ga0207677_10134271 3300026023 Bacteria 1884
209 Ga0207677_11538326 3300026023 Bacteria 615
210 Ga0207703_10464189 3300026035 Bacteria 1184
211 Ga0207639_10389290 3300026041 Bacteria 1253
212 Ga0207678_10014624 3300026067 Bacteria 6906
213 Ga0207708_10548529 3300026075 Bacteria 974
214 Ga0207702_10107813 3300026078 Bacteria 2471
215 Ga0207641_10547879 3300026088 Bacteria 1128
216 Ga0207648_10091957 3300026089 Bacteria 2652
217 Ga0207676_10047123 3300026095 Bacteria 3339
218 Ga0207676_11325597 3300026095 Bacteria 715
219 Ga0207675_100839291 3300026118 Bacteria 933
220 Ga0207675_101566711 3300026118 Bacteria 679
221 Ga0207683_10004922 3300026121 Bacteria 11491
222 Ga0207698_10175394 3300026142 Bacteria 1892
223 Ga0209966_1043721 3300027695 Bacteria 939
224 Ga0207428_10009525 3300027907 Bacteria 8702
225 Ga0268266_10155567 3300028379 Bacteria 2064
226 Ga0265337_1203652 3300028556 Bacteria 537
227 Ga0265326_10127083 3300028558 Bacteria 726
228 Ga0265319_1148556 3300028563 Bacteria 726
229 Ga0265338_10001085 3300028800 Bacteria 45201
230 Ga0265313_10023337 3300031595 Bacteria 3333
231 Ga0307409_100443305 3300031995 Bacteria 1251
232 Ga0373943_0879025 3300035170 Unclassified 535
233 Ga0373946_0350585 3300035171 Bacteria 738
234 Ga0373931_0151434 3300035691 Bacteria 1352
235 Ga0373935_0710959 3300035692 Unclassified 739
236 Ga0373947_0855010 3300035725 Bacteria 621
237 Ga0373925_0885067 3300037068 Bacteria 736
238 Ga0395899_0007998 3300037312 Bacteria 8145
239 Ga0395899_0015128 3300037312 Bacteria 5882
240 Ga0395899_0056993 3300037312 Bacteria 2886
241 Ga0395899_0126764 3300037312 Bacteria 1825
242 Ga0395899_0958592 3300037312 Bacteria 518
243 Ga0395900_0016063 3300037418 Bacteria 7629
244 Ga0395900_0101737 3300037418 Bacteria 2951
245 Ga0395900_0110945 3300037418 Bacteria 2817
246 Ga0395900_0350495 3300037418 Bacteria 1450
247 Ga0395900_1302539 3300037418 Bacteria 640
248 Ga0395900_1820041 3300037418 Unclassified 519
249 Ga0395898_0017277 3300037466 Bacteria 7368
250 Ga0395898_0071220 3300037466 Bacteria 3360
251 Ga0395898_0142318 3300037466 Bacteria 2296
252 Ga0395898_0205646 3300037466 Bacteria 1878
253 Ga0395898_0929062 3300037466 Bacteria 807
254 Ga0395898_1538643 3300037466 Bacteria 590
255 Ga0395905_0014235 3300037471 Bacteria 7599
256 Ga0395905_0041326 3300037471 Bacteria 4327
257 Ga0395905_0047150 3300037471 Bacteria 4040
258 Ga0395905_0756077 3300037471 Bacteria 874
259 Ga0395901_0093497 3300038443 Bacteria 3148
260 Ga0395901_0165052 3300038443 Bacteria 2325
261 Ga0395901_0468497 3300038443 Bacteria 1286
262 Ga0395901_0904562 3300038443 Bacteria 864
263 Ga0395901_2138503 3300038443 Bacteria 504
264 Ga0451789_0304025 3300041443 Unclassified 667
265 Ga0451851_0773872 3300041507 Unclassified 721
266 Ga0451853_0165228 3300041512 Unclassified 521
267 Ga0451853_1541846 3300041512 Bacteria 688
268 Ga0451853_2035030 3300041512 Bacteria 581
269 Ga0451853_3035776 3300041512 Bacteria 1138
270 Ga0439448_0002328 3300042005 Bacteria 5146
271 Ga0439458_0050171 3300042157 Bacteria 1028
272 Ga0453683_0818295 3300044673 Bacteria 614
273 Ga0451576_0020418 3300045051 Bacteria 7216
274 Ga0466958_0413847 3300045836 Bacteria 871
275 Ga0466958_0433889 3300045836 Bacteria 850
276 Ga0495603_0625925 3300046455 Bacteria 616
277 Ga0495603_0699409 3300046455 Bacteria 580
278 Ga0495651_0334730 3300046462 Bacteria 1005
279 Ga0495605_0286153 3300046474 Bacteria 700
280 Ga0495584_0054267 3300046491 Bacteria 2017
281 Ga0495585_0396157 3300046492 Bacteria 665
282 Ga0495596_0124119 3300046500 Bacteria 1002
283 Ga0495630_0200978 3300046517 Bacteria 1521
284 Ga0495644_0307776 3300046523 Unclassified 620
285 Ga0495663_0345647 3300046525 Bacteria 541
286 Ga0495642_0113808 3300046528 Bacteria 1158
287 Ga0495642_0172037 3300046528 Bacteria 941
288 Ga0495665_0115412 3300046531 Bacteria 1407
289 Ga0495609_0104044 3300046538 Bacteria 1229
290 Ga0495609_0213070 3300046538 Unclassified 804
291 Ga0495621_0142349 3300046539 Unclassified 939
292 Ga0495645_0704449 3300046543 Bacteria 613
293 Ga0495656_0437716 3300046615 Bacteria 688
294 Ga0495656_0518540 3300046615 Bacteria 633
295 Ga0495668_0250077 3300046616 Bacteria 971
296 Ga0495611_0273667 3300046648 Bacteria 781
297 Ga0495659_0038909 3300046664 Bacteria 1690
298 Ga0495669_0211721 3300046684 Bacteria 928
299 Ga0495671_0586250 3300046692 Unclassified 530
300 Ga0495589_0385116 3300046794 Bacteria 644
301 Ga0495589_0529112 3300046794 Bacteria 538
302 Ga0495674_1140638 3300047319 Bacteria 592
303 Ga0496100_1399360 3300048903 Bacteria 552
304 Ga0496101_0244063 3300048904 Bacteria 1398
305 Ga0496102_0125431 3300048905 Bacteria 2399
306 Ga0496103_0089142 3300048906 Bacteria 1945
307 Ga0496103_0281982 3300048906 Bacteria 1068
308 Ga0496104_1057176 3300048907 Bacteria 715
309 Ga0496106_0261344 3300048909 Bacteria 1385
310 Ga0496106_1093731 3300048909 Unclassified 625
311 Ga0496107_0647406 3300048910 Bacteria 779
312 Ga0496108_0042304 3300048911 Bacteria 3803
313 Ga0496108_0559530 3300048911 Bacteria 997
314 Ga0496109_0327867 3300048912 Bacteria 1445
315 Ga0496110_0690635 3300048913 Bacteria 922
316 Ga0496111_0875191 3300048914 Bacteria 648
317 Ga0496112_0972040 3300048915 Bacteria 769
318 Ga0496113_0034837 3300048916 Bacteria 3677
319 Ga0496113_0289959 3300048916 Bacteria 1309
320 Ga0496114_0358205 3300048917 Bacteria 1290
321 Ga0501039_1368275 3300049575 Bacteria 545
322 Ga0501072_0417552 3300049588 Bacteria 1064
323 nmdc:mga06z11_569321_c1 3300050494 Bacteria 688
324 nmdc:mga05p37_192237_c1 3300050507 Bacteria 2477
325 nmdc:mga05p37_634086_c1 3300050507 Bacteria 1200
326 nmdc:mga09592_152494_c1 3300050508 Bacteria 1994
327 nmdc:mga06r32_1559652_c1 3300050510 Bacteria 600
328 nmdc:mga06r32_9681_c1 3300050510 Bacteria 8706
329 nmdc:mga08y16_1319357_c1 3300050511 Bacteria 688
330 nmdc:mga08y16_527974_c1 3300050511 Bacteria 1196
331 nmdc:mga0n895_188490_c1 3300050512 Bacteria 2094
332 nmdc:mga0a205_1109242_c1 3300050515 Bacteria 639
333 nmdc:mga0a205_74640_c1 3300050515 Bacteria 3277
334 Ga0495655_0030996 3300053083 Bacteria 1298
335 Ga0587080_160010 3300059503 Unclassified 527
336 Ga0587076_196111 3300059645 Bacteria 517
337 Ga0501082_1160533 3300060353 Bacteria 675
338 Ga0530510_1507436 3300061734 Bacteria 516
339 Ga0070712_101389395
340 JGI24744J21845_10001812
341 Ga0070690_100163646
342 Ga0068869_100391944
343 Ga0068869_101186134
344 Ga0070666_10888352
345 Ga0070680_100121239
346 Ga0070682_100094112
347 Ga0068868_100163187
348 Ga0070689_100386487
349 Ga0070687_100121499
350 Ga0070692_10054476
351 Ga0070668_100056957
352 Ga0070669_100440398
353 Ga0070675_100713858
354 Ga0070671_100413655
355 Ga0070674_100022242
356 Ga0070673_100011004
357 Ga0070688_100501612
358 Ga0070659_100058112
359 Ga0070709_10416799
360 Ga0070714_100432248
361 Ga0070713_100090956
362 Ga0070713_100174932
363 Ga0070710_10006010
364 Ga0070701_10012896
365 Ga0070711_100333818
366 Ga0070705_100706358
367 Ga0070700_100137498
368 Ga0070694_100325225
369 Ga0070694_100407671
370 Ga0070694_100800950
371 Ga0070708_100142490
372 Ga0070708_100198514
373 Ga0070708_102221871
374 Ga0070663_100137537
375 Ga0070678_100006210
376 Ga0070662_100115990
377 Ga0070662_101999097
378 Ga0070681_12006896
379 Ga0068867_100276451
380 Ga0070685_10361183
381 Ga0070706_100044401
382 Ga0070706_100096034
383 Ga0070706_100203069
384 Ga0070706_101705654
385 Ga0070707_100003196
386 Ga0070707_100675567
387 Ga0070707_100742790
388 Ga0070707_101186602
389 Ga0070699_100256480
390 Ga0070699_100366967
391 Ga0070699_100484705
392 Ga0070699_101266122
393 Ga0070699_102030441
394 Ga0070679_100397350
395 Ga0070697_100168394
396 Ga0070697_100230920
397 Ga0068853_100010132
398 Ga0070672_100379714
399 Ga0070672_101717894
400 Ga0070686_100135439
401 Ga0070686_101110041
402 Ga0070686_101267151
403 Ga0070695_100145679
404 Ga0070696_100321700
405 Ga0070696_100443864
406 Ga0070696_101178452
407 Ga0070696_101214324
408 Ga0070693_101122164
409 Ga0070665_100145927
410 Ga0070704_100594523
411 Ga0070704_100706473
412 Ga0068855_101308534
413 Ga0068854_101919800
414 Ga0068854_102242686
415 Ga0068856_100176090
416 Ga0068856_101776081
417 Ga0070702_100003435
418 Ga0068852_100026941
419 Ga0068859_102358745
420 Ga0068864_101585398
421 Ga0068866_10071570
422 Ga0068861_101326537
423 Ga0068870_10763152
424 Ga0068863_100304429
425 Ga0068858_102182662
426 Ga0081455_10051755
427 Ga0081538_10032891
428 Ga0081540_1009639
429 Ga0081540_1016752
430 Ga0081539_10013142
431 Ga0070717_10019918
432 Ga0070717_10109896
433 Ga0075365_10005738
434 Ga0075364_11038794
435 Ga0075432_10002751
436 Ga0070715_10104157
437 Ga0070716_100300415
438 Ga0070716_101455844
439 Ga0070716_101500274
440 Ga0070712_100004780
441 Ga0070712_100305190
442 Ga0070712_101349959
443 Ga0075367_10261665
444 Ga0097621_100428418
445 Ga0068871_100547731
446 Ga0075428_100057745
447 Ga0075428_101835535
448 Ga0075431_100347258
449 Ga0075431_100613629
450 Ga0075433_10015782
451 Ga0075433_10047129
452 Ga0075434_100135858
453 Ga0075434_101363345
454 Ga0068865_100519491
455 Ga0068865_100534294
456 Ga0075436_100104837
457 Ga0097620_102358741
458 Ga0075435_100011240
459 Ga0075435_100044416
460 Ga0111539_12657330
461 Ga0111539_13457257
462 Ga0105245_10004539
463 Ga0105245_10099034
464 Ga0105247_10839192
465 Ga0114129_10667179
466 Ga0114129_10695308
467 Ga0114129_10743186
468 Ga0105243_10863016
469 Ga0105243_11045799
470 Ga0105243_12596695
471 Ga0105241_11139176
472 Ga0105242_10067313
473 Ga0105248_10117575
474 Ga0105248_11228868
475 Ga0105238_10945199
476 Ga0105249_10010495
477 Ga0105239_10013008
478 Ga0105246_10096547
479 Ga0157347_1042397
480 Ga0157326_1093090
481 Ga0157373_10352335
482 Ga0157371_10670032
483 Ga0157369_11426630
484 Ga0157369_11599290
485 Ga0157374_10498437
486 Ga0157374_12402689
487 Ga0157378_10008166
488 Ga0157378_12514530
489 Ga0163162_10132965
490 Ga0163162_13167040
491 Ga0157372_10625137
492 Ga0157375_10976848
493 Ga0157375_12666694
494 Ga0157380_10033478
495 Ga0157380_13275901
496 Ga0157377_10042494
497 Ga0157379_11106653
498 Ga0157376_12107983
499 Ga0213871_10230364
500 Ga0207653_10006357
501 Ga0207692_10011277
502 Ga0207642_10002046
503 Ga0207680_11135144
504 Ga0207699_10015203
505 Ga0207699_10601941
506 Ga0207684_10084707
507 Ga0207684_10125151
508 Ga0207654_10883257
509 Ga0207707_10522792
510 Ga0207707_11026983
511 Ga0207693_10024393
512 Ga0207693_10477528
513 Ga0207663_10008266
514 Ga0207663_10523103
515 Ga0207660_10259703
516 Ga0207662_10040430
517 Ga0207652_10935131
518 Ga0207646_10007307
519 Ga0207646_10617779
520 Ga0207681_10401503
521 Ga0207687_10018169
522 Ga0207687_10339139
523 Ga0207700_10032594
524 Ga0207700_10283764
525 Ga0207664_11236986
526 Ga0207644_11775935
527 Ga0207706_10186658
528 Ga0207706_10963084
529 Ga0207686_10260431
530 Ga0207709_10005788
531 Ga0207709_10767908
532 Ga0207670_10174733
533 Ga0207704_10004485
534 Ga0207665_10231289
535 Ga0207665_10615675
536 Ga0207665_10957442
537 Ga0207691_10104786
538 Ga0207691_11056783
539 Ga0207711_10071146
540 Ga0207711_10543626
541 Ga0207689_10289107
542 Ga0207651_10355250
543 Ga0207712_10057589
544 Ga0207668_11873420
545 Ga0207658_10299947
546 Ga0207677_10134271
547 Ga0207677_11538326
548 Ga0207703_10464189
549 Ga0207639_10389290
550 Ga0207678_10014624
551 Ga0207708_10548529
552 Ga0207702_10107813
553 Ga0207641_10547879
554 Ga0207648_10091957
555 Ga0207676_10047123
556 Ga0207676_11325597
557 Ga0207675_100839291
558 Ga0207675_101566711
559 Ga0207683_10004922
560 Ga0207698_10175394
561 Ga0209966_1043721
562 Ga0207428_10009525
563 Ga0268266_10155567
564 Ga0265337_1203652
565 Ga0265326_10127083
566 Ga0265319_1148556
567 Ga0265338_10001085
568 Ga0265313_10023337
569 Ga0307409_100443305
570 Ga0373943_0879025
571 Ga0373946_0350585
572 Ga0373931_0151434
573 Ga0373935_0710959
574 Ga0373947_0855010
575 Ga0373925_0885067
576 Ga0395899_0007998
577 Ga0395899_0015128
578 Ga0395899_0056993
579 Ga0395899_0126764
580 Ga0395899_0958592
581 Ga0395900_0016063
582 Ga0395900_0101737
583 Ga0395900_0110945
584 Ga0395900_0350495
585 Ga0395900_1302539
586 Ga0395900_1820041
587 Ga0395898_0017277
588 Ga0395898_0071220
589 Ga0395898_0142318
590 Ga0395898_0205646
591 Ga0395898_0929062
592 Ga0395898_1538643
593 Ga0395905_0014235
594 Ga0395905_0041326
595 Ga0395905_0047150
596 Ga0395905_0756077
597 Ga0395901_0093497
598 Ga0395901_0165052
599 Ga0395901_0468497
600 Ga0395901_0904562
601 Ga0395901_2138503
602 Ga0451789_0304025
603 Ga0451851_0773872
604 Ga0451853_0165228
605 Ga0451853_1541846
606 Ga0451853_2035030
607 Ga0451853_3035776
608 Ga0439448_0002328
609 Ga0439458_0050171
610 Ga0453683_0818295
611 Ga0451576_0020418
612 Ga0466958_0413847
613 Ga0466958_0433889
614 Ga0495603_0625925
615 Ga0495603_0699409
616 Ga0495651_0334730
617 Ga0495605_0286153
618 Ga0495584_0054267
619 Ga0495585_0396157
620 Ga0495596_0124119
621 Ga0495630_0200978
622 Ga0495644_0307776
623 Ga0495663_0345647
624 Ga0495642_0113808
625 Ga0495642_0172037
626 Ga0495665_0115412
627 Ga0495609_0104044
628 Ga0495609_0213070
629 Ga0495621_0142349
630 Ga0495645_0704449
631 Ga0495656_0437716
632 Ga0495656_0518540
633 Ga0495668_0250077
634 Ga0495611_0273667
635 Ga0495659_0038909
636 Ga0495669_0211721
637 Ga0495671_0586250
638 Ga0495589_0385116
639 Ga0495589_0529112
640 Ga0495674_1140638
641 Ga0496100_1399360
642 Ga0496101_0244063
643 Ga0496102_0125431
644 Ga0496103_0089142
645 Ga0496103_0281982
646 Ga0496104_1057176
647 Ga0496106_0261344
648 Ga0496106_1093731
649 Ga0496107_0647406
650 Ga0496108_0042304
651 Ga0496108_0559530
652 Ga0496109_0327867
653 Ga0496110_0690635
654 Ga0496111_0875191
655 Ga0496112_0972040
656 Ga0496113_0034837
657 Ga0496113_0289959
658 Ga0496114_0358205
659 Ga0501039_1368275
660 Ga0501072_0417552
661 nmdc:mga06z11_569321_c1
662 nmdc:mga05p37_192237_c1
663 nmdc:mga05p37_634086_c1
664 nmdc:mga09592_152494_c1
665 nmdc:mga06r32_1559652_c1
666 nmdc:mga06r32_9681_c1
667 nmdc:mga08y16_1319357_c1
668 nmdc:mga08y16_527974_c1
669 nmdc:mga0n895_188490_c1
670 nmdc:mga0a205_1109242_c1
671 nmdc:mga0a205_74640_c1
672 Ga0495655_0030996
673 Ga0587080_160010
674 Ga0587076_196111
675 Ga0501082_1160533
676 Ga0530510_1507436

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map