F413165

General Info

Members Datasets Scaffolds Average Seq Length
337 212 323 239

Family's Representative Sequence

Representative Sequence 3300036712|Ga0316584_0201499|Ga0316584_0201499_169_990
Length 273
Sequence MAPLWALNLSRFSDILPPRQESETGADLMSDGSARQPAPAYKRVLLKISGEALMGDQGYGLHPPTVQRIAEEVKSVRDLGVEICMVIGGGNIFRGLAGSAQGMERTTADYMGMLATVMNALALQSALEGMGVFTRVITAIRMDEVAEPYIRRRAVRHLEKGRVCIFAAGTGNPYFTTDTAATLRANEMACEVIFKGTKVDGVYDKDPKTHPDATRYDEVTYDDCLQKNLKVMDASAIALARDNDLPIIVFSLDEPGGFRGILAGQGTYTIVHG

Samples

Sample ID Description Type Environment
1 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
2 2713897090 Paracoccus sphaerophysae HAMBI 3106 Isolate Nodule
3 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
4 2840878972 Albibacillus kandeliae J95 Isolate Rhizosphere
5 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
6 2854681122 Luteovulum sphaeroides SCJ Isolate Unclassified
7 2855020534 Paracoccus endophyticus SYSUP0003 Isolate Stem Tuber
8 2898795034 Rhodobacter sp. SGA-6-6 Isolate Rhizosphere
9 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
10 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
11 2919679072 Pseudotabrizicola sp. 4114 Isolate Unclassified
12 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
13 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
75 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
117 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
121 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
122 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
123 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
124 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
125 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
126 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
138 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
139 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
140 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
141 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
143 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
148 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
208 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
212 8057132660 Paracoccus rhizosphaerae LMG 21293 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0
Isolates 4.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0.3
Rhizoplane 8.61
Rhizosphere 82.79
Stem 0
Stem Tuber 0.3
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10031158 3300003320 Bacteria 2006
2 Ga0065715_10322017 3300005293 Bacteria 1000
3 Ga0070658_10031187 3300005327 Bacteria 4280
4 Ga0070666_10001325 3300005335 Bacteria 15007
5 Ga0070680_100037343 3300005336 Bacteria 3924
6 Ga0070660_100002162 3300005339 Bacteria 13542
7 Ga0070691_10000026 3300005341 Bacteria 40701
8 Ga0070691_10000423 3300005341 Bacteria 15521
9 Ga0070668_100044842 3300005347 Bacteria 3393
10 Ga0070668_100114119 3300005347 Bacteria 2153
11 Ga0070669_100047794 3300005353 Bacteria 3122
12 Ga0070671_100054385 3300005355 Bacteria 3329
13 Ga0070673_100011955 3300005364 Bacteria 5943
14 Ga0070673_100245870 3300005364 Bacteria 1557
15 Ga0070659_100007064 3300005366 Bacteria 8135
16 Ga0070659_100023241 3300005366 Bacteria 4742
17 Ga0070667_100002362 3300005367 Bacteria 16528
18 Ga0070709_10001084 3300005434 Bacteria 15078
19 Ga0070714_100460415 3300005435 Bacteria 1209
20 Ga0070713_100000008 3300005436 Bacteria 160153
21 Ga0070713_100153774 3300005436 Bacteria 2049
22 Ga0070713_100158763 3300005436 Bacteria 2017
23 Ga0070713_100253727 3300005436 Bacteria 1605
24 Ga0070711_100169027 3300005439 Bacteria 1665
25 Ga0070681_10028353 3300005458 Bacteria 5628
26 Ga0070706_100149466 3300005467 Bacteria 2181
27 Ga0070679_100056119 3300005530 Bacteria 3924
28 Ga0070679_100137978 3300005530 Bacteria 2419
29 Ga0068853_100025374 3300005539 Bacteria 4972
30 Ga0068853_100049546 3300005539 Bacteria 3610
31 Ga0068853_100319017 3300005539 Bacteria 1440
32 Ga0070693_100060956 3300005547 Bacteria 2192
33 Ga0070665_100025094 3300005548 Bacteria 6007
34 Ga0070704_100457354 3300005549 Bacteria 1100
35 Ga0068855_100029133 3300005563 Bacteria 6603
36 Ga0068855_100040684 3300005563 Bacteria 5515
37 Ga0068855_100104119 3300005563 Bacteria 3264
38 Ga0070664_100097190 3300005564 Bacteria 2557
39 Ga0070664_100465231 3300005564 Bacteria 1162
40 Ga0068857_100000572 3300005577 Bacteria 26923
41 Ga0068854_100083557 3300005578 Bacteria 2361
42 Ga0068856_100000362 3300005614 Bacteria 49802
43 Ga0068852_100012265 3300005616 Bacteria 6498
44 Ga0068852_100806657 3300005616 Bacteria 953
45 Ga0068859_100035948 3300005617 Bacteria 4970
46 Ga0068864_100006382 3300005618 Bacteria 9664
47 Ga0068851_10132476 3300005834 Bacteria 1349
48 Ga0068860_101028390 3300005843 Bacteria 842
49 Ga0068862_100016230 3300005844 Bacteria 6197
50 Ga0068862_100519506 3300005844 Bacteria 1133
51 Ga0070712_100000435 3300006175 Bacteria 23865
52 Ga0075428_100021520 3300006844 Bacteria 7137
53 Ga0075428_100400555 3300006844 Bacteria 1471
54 Ga0075430_100109724 3300006846 Bacteria 2301
55 Ga0075434_100019465 3300006871 Bacteria 6571
56 Ga0075434_100167468 3300006871 Bacteria 2217
57 Ga0075436_100000099 3300006914 Bacteria 51125
58 Ga0075436_100002921 3300006914 Bacteria 11716
59 Ga0075436_100031551 3300006914 Bacteria 3649
60 Ga0097620_100035948 3300006931 Bacteria 4970
61 Ga0075435_100008130 3300007076 Bacteria 7512
62 Ga0075435_100363738 3300007076 Bacteria 1241
63 Ga0105240_10008089 3300009093 Bacteria 15108
64 Ga0111539_10021677 3300009094 Bacteria 7903
65 Ga0114129_11005629 3300009147 Bacteria 1050
66 Ga0105241_10059972 3300009174 Bacteria 2926
67 Ga0105241_10369786 3300009174 Bacteria 1250
68 Ga0105242_10184712 3300009176 Bacteria 1842
69 Ga0105248_10421972 3300009177 Bacteria 1502
70 Ga0105237_10012207 3300009545 Bacteria 9057
71 Ga0105238_10001957 3300009551 Bacteria 20734
72 Ga0105238_10019848 3300009551 Bacteria 6841
73 Ga0105238_10067214 3300009551 Bacteria 3585
74 Ga0105239_10002396 3300010375 Bacteria 23907
75 Ga0157373_10000393 3300013100 Bacteria 35085
76 Ga0157370_10006364 3300013104 Bacteria 13035
77 Ga0157370_10162847 3300013104 Bacteria 2075
78 Ga0157369_10004678 3300013105 Bacteria 16088
79 Ga0157369_10156713 3300013105 Bacteria 2405
80 Ga0163162_10633970 3300013306 Bacteria 1193
81 Ga0157372_10004098 3300013307 Bacteria 15629
82 Ga0157375_10091029 3300013308 Bacteria 3111
83 Ga0163163_10123537 3300014325 Bacteria 2624
84 Ga0163163_10171125 3300014325 Bacteria 2219
85 Ga0163163_10785523 3300014325 Bacteria 1015
86 Ga0182008_10100528 3300014497 Bacteria 1429
87 Ga0157379_10000809 3300014968 Bacteria 25373
88 Ga0157379_10002785 3300014968 Bacteria 14743
89 Ga0157379_10002800 3300014968 Bacteria 14691
90 Ga0157379_10018004 3300014968 Bacteria 6226
91 Ga0213871_10074692 3300021441 Bacteria 963
92 Ga0224572_1002291 3300024225 Bacteria 3062
93 Ga0207680_10001877 3300025903 Bacteria 9861
94 Ga0207699_10000140 3300025906 Bacteria 48523
95 Ga0207705_10000130 3300025909 Bacteria 82082
96 Ga0207705_10377371 3300025909 Bacteria 1095
97 Ga0207654_10054236 3300025911 Bacteria 2316
98 Ga0207707_10000839 3300025912 Bacteria 30215
99 Ga0207707_10083396 3300025912 Bacteria 2791
100 Ga0207695_10135029 3300025913 Bacteria 2421
101 Ga0207671_10344807 3300025914 Bacteria 1180
102 Ga0207693_10001130 3300025915 Bacteria 23920
103 Ga0207663_10127686 3300025916 Bacteria 1752
104 Ga0207660_10000793 3300025917 Bacteria 20929
105 Ga0207662_10373495 3300025918 Bacteria 962
106 Ga0207657_10000203 3300025919 Bacteria 61390
107 Ga0207652_10001704 3300025921 Bacteria 19206
108 Ga0207652_10016226 3300025921 Bacteria 6077
109 Ga0207694_10043175 3300025924 Bacteria 3480
110 Ga0207694_10053944 3300025924 Bacteria 3118
111 Ga0207650_10017209 3300025925 Bacteria 5059
112 Ga0207700_10000011 3300025928 Bacteria 266323
113 Ga0207700_10242562 3300025928 Bacteria 1536
114 Ga0207644_10088630 3300025931 Bacteria 2302
115 Ga0207644_10150502 3300025931 Bacteria 1800
116 Ga0207690_10101512 3300025932 Bacteria 2055
117 Ga0207690_10221361 3300025932 Bacteria 1448
118 Ga0207665_10139433 3300025939 Bacteria 1727
119 Ga0207691_10240147 3300025940 Bacteria 1567
120 Ga0207711_10097080 3300025941 Bacteria 2601
121 Ga0207679_10191772 3300025945 Bacteria 1700
122 Ga0207679_10395292 3300025945 Bacteria 1215
123 Ga0207667_10006070 3300025949 Bacteria 14691
124 Ga0207667_10018856 3300025949 Bacteria 7722
125 Ga0207651_10040496 3300025960 Bacteria 3083
126 Ga0207668_10001036 3300025972 Bacteria 16597
127 Ga0207668_10089107 3300025972 Bacteria 2261
128 Ga0207640_10039961 3300025981 Bacteria 2973
129 Ga0207658_10050844 3300025986 Bacteria 3051
130 Ga0207703_10039522 3300026035 Bacteria 3771
131 Ga0207703_10166629 3300026035 Bacteria 1934
132 Ga0207639_10055272 3300026041 Bacteria 3038
133 Ga0207639_10073439 3300026041 Bacteria 2681
134 Ga0207639_10329039 3300026041 Bacteria 1359
135 Ga0207678_10149069 3300026067 Bacteria 1997
136 Ga0207702_10000162 3300026078 Bacteria 79378
137 Ga0207702_10000968 3300026078 Bacteria 29412
138 Ga0207702_10510650 3300026078 Bacteria 1172
139 Ga0207641_10078289 3300026088 Bacteria 2863
140 Ga0207676_10052094 3300026095 Bacteria 3198
141 Ga0207674_10001803 3300026116 Bacteria 27309
142 Ga0207698_10066852 3300026142 Bacteria 2832
143 Ga0207698_10337387 3300026142 Bacteria 1418
144 Ga0268266_10099801 3300028379 Bacteria 2556
145 Ga0268265_10217418 3300028380 Bacteria 1669
146 Ga0268265_10426048 3300028380 Bacteria 1233
147 Ga0268264_10049049 3300028381 Bacteria 3512
148 Ga0268264_10930268 3300028381 Bacteria 874
149 Ga0307517_10000497 3300028786 Bacteria 67390
150 Ga0265338_10052693 3300028800 Bacteria 3647
151 Ga0265338_10150070 3300028800 Bacteria 1812
152 Ga0265338_10340586 3300028800 Bacteria 1081
153 Ga0265332_10077307 3300031238 Bacteria 1414
154 Ga0265320_10000561 3300031240 Bacteria 28649
155 Ga0265325_10000677 3300031241 Bacteria 24870
156 Ga0265325_10002084 3300031241 Bacteria 13686
157 Ga0265339_10007789 3300031249 Bacteria 6884
158 Ga0265339_10019156 3300031249 Bacteria 4020
159 Ga0265316_10311361 3300031344 Bacteria 1145
160 Ga0265316_10546135 3300031344 Bacteria 825
161 Ga0307513_10000448 3300031456 Bacteria 59427
162 Ga0307513_10002007 3300031456 Bacteria 28699
163 Ga0307513_10004437 3300031456 Bacteria 18736
164 Ga0265313_10026643 3300031595 Bacteria 3041
165 Ga0265313_10045567 3300031595 Bacteria 2134
166 Ga0265314_10001066 3300031711 Bacteria 31856
167 Ga0265314_10003381 3300031711 Bacteria 15464
168 Ga0265314_10004545 3300031711 Bacteria 12813
169 Ga0265314_10024285 3300031711 Bacteria 4598
170 Ga0265314_10049532 3300031711 Bacteria 2940
171 Ga0265342_10049352 3300031712 Bacteria 2518
172 Ga0316576_10025424 3300031727 Bacteria 4145
173 Ga0316578_10101909 3300031728 Bacteria 1721
174 Ga0307516_10000004 3300031730 Bacteria 367451
175 Ga0316583_10040129 3300032133 Bacteria 1658
176 Ga0373944_0150004 3300035089 Bacteria 821
177 Ga0373923_0023853 3300035111 Bacteria 2411
178 Ga0373923_0045555 3300035111 Bacteria 1822
179 Ga0373932_0013397 3300035112 Bacteria 2039
180 Ga0373932_0076927 3300035112 Bacteria 1047
181 Ga0373945_0017742 3300035116 Bacteria 2414
182 Ga0373943_0287204 3300035170 Bacteria 931
183 Ga0373931_0061144 3300035691 Bacteria 2030
184 Ga0373935_0237851 3300035692 Bacteria 1270
185 Ga0373927_0000526 3300035695 Bacteria 29046
186 Ga0373927_0205119 3300035695 Bacteria 1294
187 Ga0373933_0182067 3300035724 Bacteria 1340
188 Ga0373947_0027212 3300035725 Bacteria 3346
189 Ga0373937_0006766 3300036401 Bacteria 9897
190 Ga0373937_0013567 3300036401 Bacteria 7178
191 Ga0373937_0077347 3300036401 Bacteria 3075
192 Ga0373937_0172675 3300036401 Bacteria 2028
193 Ga0316584_0201499 3300036712 Bacteria 1468
194 Ga0373925_0000061 3300037068 Bacteria 117783
195 Ga0373925_0023782 3300037068 Bacteria 4469
196 Ga0373925_0059238 3300037068 Bacteria 2872
197 Ga0395905_0265249 3300037471 Bacteria 1603
198 Ga0400483_082259 3300039062 Bacteria 1122
199 Ga0400483_135916 3300039062 Bacteria 2087
200 Ga0400483_154659 3300039062 Bacteria 2976
201 Ga0400483_205214 3300039062 Bacteria 1434
202 Ga0400483_217969 3300039062 Bacteria 1371
203 Ga0400483_260120 3300039062 Bacteria 1279
204 Ga0400483_279640 3300039062 Bacteria 1501
205 Ga0400483_288211 3300039062 Bacteria 3663
206 Ga0436365_0500054 3300039437 Bacteria 2183
207 Ga0436365_1542298 3300039437 Bacteria 914
208 Ga0436360_0580037 3300039438 Bacteria 1754
209 Ga0451576_0000661 3300045051 Bacteria 71055
210 Ga0495580_0202297 3300046472 Bacteria 1368
211 Ga0495582_0033289 3300046473 Bacteria 2833
212 Ga0495628_0190838 3300046516 Bacteria 1547
213 Ga0495665_0027367 3300046531 Bacteria 3060
214 Ga0495586_0103827 3300046535 Bacteria 1579
215 Ga0495625_0288127 3300046660 Bacteria 1054
216 Ga0495657_0225706 3300046675 Bacteria 1134
217 Ga0495674_0067306 3300047319 Bacteria 3104
218 Ga0495672_0005999 3300047320 Bacteria 9513
219 Ga0495684_0203937 3300047471 Bacteria 1457
220 Ga0496100_0151099 3300048903 Bacteria 1656
221 Ga0496101_0010317 3300048904 Bacteria 6169
222 Ga0496101_0705858 3300048904 Bacteria 796
223 Ga0496102_0002224 3300048905 Bacteria 16640
224 Ga0496102_0133896 3300048905 Bacteria 2321
225 Ga0496102_0308641 3300048905 Bacteria 1491
226 Ga0496102_0414154 3300048905 Bacteria 1266
227 Ga0496103_0026234 3300048906 Bacteria 3528
228 Ga0496104_0052920 3300048907 Bacteria 3835
229 Ga0496104_0056495 3300048907 Bacteria 3712
230 Ga0496104_0067990 3300048907 Bacteria 3385
231 Ga0496105_0022876 3300048908 Bacteria 5066
232 Ga0496106_0004642 3300048909 Bacteria 10189
233 Ga0496107_0002984 3300048910 Bacteria 11209
234 Ga0496107_0184626 3300048910 Bacteria 1549
235 Ga0496108_0011953 3300048911 Bacteria 7062
236 Ga0496108_0027044 3300048911 Bacteria 4733
237 Ga0496109_0009852 3300048912 Bacteria 8156
238 Ga0496109_0029476 3300048912 Bacteria 4915
239 Ga0496109_0038758 3300048912 Bacteria 4310
240 Ga0496110_0028561 3300048913 Bacteria 4792
241 Ga0496110_0060884 3300048913 Bacteria 3330
242 Ga0496111_0016755 3300048914 Bacteria 5055
243 Ga0496111_0066302 3300048914 Bacteria 2621
244 Ga0496111_0304196 3300048914 Bacteria 1182
245 Ga0496112_0091807 3300048915 Bacteria 3005
246 Ga0496112_0188872 3300048915 Bacteria 2023
247 Ga0496113_0085995 3300048916 Bacteria 2416
248 Ga0496114_0217731 3300048917 Bacteria 1676
249 Ga0496122_0020937 3300048925 Bacteria 5878
250 Ga0496126_0000382 3300048929 Bacteria 91611
251 Ga0496126_0181034 3300048929 Bacteria 1790
252 Ga0501032_0002879 3300049569 Bacteria 13385
253 Ga0501032_0067117 3300049569 Bacteria 2397
254 Ga0501033_0022889 3300049570 Bacteria 4710
255 Ga0501033_0030287 3300049570 Bacteria 4067
256 Ga0501033_0032973 3300049570 Bacteria 3889
257 Ga0501034_0000012 3300049571 Bacteria 310504
258 Ga0501034_0007444 3300049571 Bacteria 11652
259 Ga0501037_0001908 3300049573 Bacteria 15140
260 Ga0501037_0019872 3300049573 Bacteria 4957
261 Ga0501038_0004396 3300049574 Bacteria 13117
262 Ga0501038_0290176 3300049574 Bacteria 1286
263 Ga0501038_0572484 3300049574 Bacteria 857
264 Ga0501039_0001573 3300049575 Bacteria 16801
265 Ga0501039_0273285 3300049575 Bacteria 1328
266 Ga0501042_0011142 3300049578 Bacteria 6058
267 Ga0501042_0484535 3300049578 Bacteria 898
268 Ga0501043_0044199 3300049579 Bacteria 3502
269 Ga0501043_0048058 3300049579 Bacteria 3354
270 Ga0501043_0103614 3300049579 Bacteria 2236
271 Ga0501046_0006278 3300049580 Bacteria 10541
272 Ga0501047_0007287 3300049581 Bacteria 10398
273 Ga0501047_0014477 3300049581 Bacteria 7501
274 Ga0501047_0169386 3300049581 Bacteria 2053
275 Ga0501048_0003926 3300049582 Bacteria 11295
276 Ga0501067_0003131 3300049583 Bacteria 9134
277 Ga0501069_0131083 3300049585 Bacteria 1435
278 Ga0501070_0000002 3300049586 Bacteria 347524
279 Ga0501070_0002559 3300049586 Bacteria 15917
280 Ga0501071_0226154 3300049587 Bacteria 1409
281 Ga0501073_0000802 3300049589 Bacteria 22364
282 Ga0501073_0016658 3300049589 Bacteria 5326
283 Ga0501074_0000138 3300049590 Bacteria 37896
284 Ga0501074_0040721 3300049590 Bacteria 3364
285 Ga0501075_0212639 3300049591 Bacteria 1475
286 Ga0501076_0293549 3300049592 Bacteria 1332
287 Ga0501079_0007294 3300049741 Bacteria 8348
288 Ga0501079_0047737 3300049741 Bacteria 3304
289 Ga0501080_0001693 3300049742 Bacteria 18802
290 Ga0501080_0008063 3300049742 Bacteria 9546
291 Ga0501080_0046399 3300049742 Bacteria 4045
292 Ga0501080_0117816 3300049742 Bacteria 2462
293 Ga0501083_0008522 3300049744 Bacteria 7238
294 Ga0501083_0013979 3300049744 Bacteria 5609
295 Ga0501035_0012091 3300049822 Bacteria 7980
296 Ga0501035_0017376 3300049822 Bacteria 6632
297 Ga0501035_0027849 3300049822 Bacteria 5163
298 Ga0501044_0016840 3300049823 Bacteria 7841
299 Ga0501044_0030091 3300049823 Bacteria 5722
300 Ga0501044_0034767 3300049823 Bacteria 5282
301 Ga0501044_0049845 3300049823 Bacteria 4322
302 Ga0501044_0186912 3300049823 Bacteria 2036
303 Ga0501045_0017987 3300049824 Bacteria 5019
304 Ga0501045_0309944 3300049824 Bacteria 1175
305 nmdc:mga00v17_239358_c1 3300050491 Bacteria 1176
306 nmdc:mga06r32_363305_c1 3300050510 Bacteria 1431
307 nmdc:mga08y16_75046_c1 3300050511 Bacteria 3525
308 nmdc:mga0n895_25084_c1 3300050512 Bacteria 5628
309 nmdc:mga0n895_300949_c1 3300050512 Bacteria 1626
310 nmdc:mga0rr50_10688_c1 3300050513 Bacteria 5842
311 nmdc:mga08x19_2099_c1 3300050514 Bacteria 12187
312 nmdc:mga08x19_28809_c1 3300050514 Bacteria 3481
313 nmdc:mga08x19_394_c1 3300050514 Bacteria 30675
314 Ga0495619_0088205 3300053085 Bacteria 2098
315 Ga0495619_0315065 3300053085 Bacteria 1083
316 Ga0500618_020042 3300053125 Bacteria 1641
317 Ga0500636_0050744 3300053177 Bacteria 2440
318 Ga0500611_069736 3300053727 Bacteria 853
319 Ga0501084_0001765 3300054114 Bacteria 17203
320 Ga0501082_0009503 3300060353 Bacteria 8369
321 Ga0501082_0016763 3300060353 Bacteria 6309
322 Ga0501082_0051949 3300060353 Bacteria 3533
323 Ga0530510_0137751 3300061734 Bacteria 1797

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046675 Ga0495657_0225706 Ga0495657_0225706_17_616 197
2 3300031727 Ga0316576_10025424 Ga0316576_100254245 219
3 3300031728 Ga0316578_10101909 Ga0316578_101019092 219
4 3300014497 Ga0182008_10100528 Ga0182008_101005282 221
5 3300031241 Ga0265325_10000677 Ga0265325_1000067716 221
6 3300031595 Ga0265313_10045567 Ga0265313_100455672 221
7 3300031711 Ga0265314_10024285 Ga0265314_100242854 221
8 3300049574 Ga0501038_0290176 Ga0501038_0290176_599_1264 221
9 3300049575 Ga0501039_0273285 Ga0501039_0273285_20_685 221
10 3300005293 Ga0065715_10322017 Ga0065715_103220171 222
11 3300005547 Ga0070693_100060956 Ga0070693_1000609561 222
12 3300028800 Ga0265338_10150070 Ga0265338_101500703 222
13 3300035089 Ga0373944_0150004 Ga0373944_0150004_110_778 222
14 3300039437 Ga0436365_1542298 Ga0436365_1542298_35_703 222
15 3300049822 Ga0501035_0027849 Ga0501035_0027849_4469_5137 222
16 3300005364 Ga0070673_100011955 Ga0070673_1000119556 225
17 3300005436 Ga0070713_100158763 Ga0070713_1001587632 225
18 3300005548 Ga0070665_100025094 Ga0070665_1000250943 225
19 3300005564 Ga0070664_100097190 Ga0070664_1000971903 225
20 3300005616 Ga0068852_100806657 Ga0068852_1008066571 225
21 3300005618 Ga0068864_100006382 Ga0068864_1000063823 225
22 3300005844 Ga0068862_100519506 Ga0068862_1005195062 225
23 3300009094 Ga0111539_10021677 Ga0111539_100216772 225
24 3300009551 Ga0105238_10067214 Ga0105238_100672143 225
25 3300013308 Ga0157375_10091029 Ga0157375_100910294 225
26 3300014325 Ga0163163_10123537 Ga0163163_101235372 225
27 3300021441 Ga0213871_10074692 Ga0213871_100746922 225
28 3300024225 Ga0224572_1002291 Ga0224572_10022912 225
29 3300025914 Ga0207671_10344807 Ga0207671_103448072 225
30 3300025931 Ga0207644_10150502 Ga0207644_101505022 225
31 3300025940 Ga0207691_10240147 Ga0207691_102401471 225
32 3300025941 Ga0207711_10097080 Ga0207711_100970802 225
33 3300025945 Ga0207679_10191772 Ga0207679_101917722 225
34 3300025960 Ga0207651_10040496 Ga0207651_100404963 225
35 3300026035 Ga0207703_10166629 Ga0207703_101666292 225
36 3300026088 Ga0207641_10078289 Ga0207641_100782893 225
37 3300028379 Ga0268266_10099801 Ga0268266_100998013 225
38 3300028380 Ga0268265_10426048 Ga0268265_104260482 225
39 3300028786 Ga0307517_10000497 Ga0307517_1000049754 225
40 3300031456 Ga0307513_10002007 Ga0307513_1000200710 225
41 3300031456 Ga0307513_10004437 Ga0307513_100044374 225
42 3300035695 Ga0373927_0000526 Ga0373927_0000526_18404_19123 225
43 3300037068 Ga0373925_0000061 Ga0373925_0000061_38071_38790 225
44 3300037471 Ga0395905_0265249 Ga0395905_0265249_619_1335 225
45 3300046516 Ga0495628_0190838 Ga0495628_0190838_585_1274 225
46 3300046660 Ga0495625_0288127 Ga0495625_0288127_123_869 225
47 3300047320 Ga0495672_0005999 Ga0495672_0005999_7754_8473 225
48 3300048905 Ga0496102_0414154 Ga0496102_0414154_330_1049 225
49 3300048912 Ga0496109_0009852 Ga0496109_0009852_3475_4194 225
50 3300048916 Ga0496113_0085995 Ga0496113_0085995_615_1334 225
51 3300050511 nmdc:mga08y16_75046_c1 nmdc:mga08y16_75046_c1_2430_3110 225
52 3300039062 Ga0400483_217969 Ga0400483_217969_119_853 227
53 3300039062 Ga0400483_135916 Ga0400483_135916_38_730 228
54 3300005467 Ga0070706_100149466 Ga0070706_1001494662 229
55 3300005347 Ga0070668_100114119 Ga0070668_1001141193 233
56 3300005353 Ga0070669_100047794 Ga0070669_1000477942 233
57 3300005367 Ga0070667_100002362 Ga0070667_1000023622 233
58 3300005617 Ga0068859_100035948 Ga0068859_1000359482 233
59 3300005844 Ga0068862_100016230 Ga0068862_1000162307 233
60 3300006931 Ga0097620_100035948 Ga0097620_1000359486 233
61 3300025925 Ga0207650_10017209 Ga0207650_100172093 233
62 3300025972 Ga0207668_10001036 Ga0207668_100010366 233
63 3300025986 Ga0207658_10050844 Ga0207658_100508444 233
64 3300026095 Ga0207676_10052094 Ga0207676_100520944 233
65 3300028380 Ga0268265_10217418 Ga0268265_102174182 233
66 3300028381 Ga0268264_10049049 Ga0268264_100490495 233
67 3300006844 Ga0075428_100021520 Ga0075428_1000215203 234
68 3300006844 Ga0075428_100400555 Ga0075428_1004005552 234
69 3300006846 Ga0075430_100109724 Ga0075430_1001097242 234
70 3300009147 Ga0114129_11005629 Ga0114129_110056291 234
71 3300039438 Ga0436360_0580037 Ga0436360_0580037_662_1381 234
72 3300047319 Ga0495674_0067306 Ga0495674_0067306_1305_2024 234
73 3300047471 Ga0495684_0203937 Ga0495684_0203937_112_831 234
74 3300050510 nmdc:mga06r32_363305_c1 nmdc:mga06r32_363305_c1_13_720 234
75 3300053085 Ga0495619_0088205 Ga0495619_0088205_522_1241 234
76 iso_pu_bacteria 2899275550 2899276033 235
77 iso_pu_bacteria 8057132660 8057134147 235
78 3300049571 Ga0501034_0000012 Ga0501034_0000012_294860_295591 236
79 iso_pu_bacteria 2854681122 2854683360 236
80 iso_pu_bacteria 2898795034 2898798962 236
81 iso_pu_bacteria 3000017691 3000018499 236
82 iso_pu_bacteria 3000405567 3000408361 236
83 3300005347 Ga0070668_100044842 Ga0070668_1000448422 237
84 3300005435 Ga0070714_100460415 Ga0070714_1004604152 237
85 3300005549 Ga0070704_100457354 Ga0070704_1004573542 237
86 3300025972 Ga0207668_10089107 Ga0207668_100891072 237
87 3300032133 Ga0316583_10040129 Ga0316583_100401292 237
88 3300039062 Ga0400483_154659 Ga0400483_154659_245_967 237
89 3300039062 Ga0400483_260120 Ga0400483_260120_214_939 237
90 3300039062 Ga0400483_279640 Ga0400483_279640_671_1393 237
91 3300048904 Ga0496101_0705858 Ga0496101_0705858_29_742 237
92 3300048905 Ga0496102_0133896 Ga0496102_0133896_154_867 237
93 3300048907 Ga0496104_0067990 Ga0496104_0067990_1785_2498 237
94 3300048915 Ga0496112_0188872 Ga0496112_0188872_1127_1840 237
95 3300048917 Ga0496114_0217731 Ga0496114_0217731_750_1463 237
96 3300053085 Ga0495619_0315065 Ga0495619_0315065_36_752 237
97 3300053727 Ga0500611_069736 Ga0500611_069736_72_788 237
98 iso_pu_bacteria 2855020534 2855023366 237
99 iso_pu_bacteria 2919679072 2919681205 237
100 3300005355 Ga0070671_100054385 Ga0070671_1000543852 238
101 3300006871 Ga0075434_100167468 Ga0075434_1001674682 238
102 3300007076 Ga0075435_100363738 Ga0075435_1003637382 238
103 3300025931 Ga0207644_10088630 Ga0207644_100886303 238
104 3300031456 Ga0307513_10000448 Ga0307513_1000044851 238
105 3300031730 Ga0307516_10000004 Ga0307516_10000004373 238
106 3300036712 Ga0316584_0201499 Ga0316584_0201499_169_990 238
107 3300039062 Ga0400483_082259 Ga0400483_082259_307_1044 238
108 3300039062 Ga0400483_205214 Ga0400483_205214_283_1011 238
109 3300039062 Ga0400483_288211 Ga0400483_288211_2599_3333 238
110 3300045051 Ga0451576_0000661 Ga0451576_0000661_34898_35719 238
111 3300048903 Ga0496100_0151099 Ga0496100_0151099_543_1298 238
112 3300048904 Ga0496101_0010317 Ga0496101_0010317_2885_3640 238
113 3300048905 Ga0496102_0002224 Ga0496102_0002224_6659_7414 238
114 3300048906 Ga0496103_0026234 Ga0496103_0026234_465_1220 238
115 3300048907 Ga0496104_0056495 Ga0496104_0056495_2633_3388 238
116 3300048908 Ga0496105_0022876 Ga0496105_0022876_4234_4989 238
117 3300048909 Ga0496106_0004642 Ga0496106_0004642_4409_5164 238
118 3300048910 Ga0496107_0002984 Ga0496107_0002984_2654_3409 238
119 3300048911 Ga0496108_0011953 Ga0496108_0011953_3631_4386 238
120 3300048911 Ga0496108_0027044 Ga0496108_0027044_3222_3977 238
121 3300048912 Ga0496109_0029476 Ga0496109_0029476_803_1558 238
122 3300048912 Ga0496109_0038758 Ga0496109_0038758_1353_2108 238
123 3300048913 Ga0496110_0028561 Ga0496110_0028561_3234_3989 238
124 3300048913 Ga0496110_0060884 Ga0496110_0060884_1650_2405 238
125 3300048914 Ga0496111_0016755 Ga0496111_0016755_784_1539 238
126 3300048914 Ga0496111_0066302 Ga0496111_0066302_1229_1984 238
127 3300048915 Ga0496112_0091807 Ga0496112_0091807_826_1581 238
128 3300049578 Ga0501042_0484535 Ga0501042_0484535_58_810 238
129 3300049587 Ga0501071_0226154 Ga0501071_0226154_28_768 238
130 3300049591 Ga0501075_0212639 Ga0501075_0212639_401_1141 238
131 3300049592 Ga0501076_0293549 Ga0501076_0293549_544_1284 238
132 3300049741 Ga0501079_0047737 Ga0501079_0047737_1481_2221 238
133 3300049742 Ga0501080_0117816 Ga0501080_0117816_298_1038 238
134 3300049824 Ga0501045_0309944 Ga0501045_0309944_260_1000 238
135 3300050491 nmdc:mga00v17_239358_c1 nmdc:mga00v17_239358_c1_168_899 238
136 3300060353 Ga0501082_0051949 Ga0501082_0051949_1702_2442 238
137 3300061734 Ga0530510_0137751 Ga0530510_0137751_204_944 238
138 iso_pu_bacteria 2713897090 2715499632 238
139 iso_pu_bacteria 2834578030 2834580742 238
140 iso_pu_bacteria 2840878972 2840879758 238
141 iso_pu_bacteria 2899259804 2899260578 238
142 3300053125 Ga0500618_020042 Ga0500618_020042_716_1438 239
143 3300053177 Ga0500636_0050744 Ga0500636_0050744_22_741 239
144 iso_pu_bacteria 2848297114 2848298526 239
145 3300005366 Ga0070659_100007064 Ga0070659_1000070642 240
146 3300005563 Ga0068855_100104119 Ga0068855_1001041192 240
147 3300013104 Ga0157370_10162847 Ga0157370_101628473 240
148 3300014325 Ga0163163_10785523 Ga0163163_107855232 240
149 3300025909 Ga0207705_10377371 Ga0207705_103773712 240
150 3300025932 Ga0207690_10101512 Ga0207690_101015123 240
151 3300039437 Ga0436365_0500054 Ga0436365_0500054_156_881 240
152 3300046473 Ga0495582_0033289 Ga0495582_0033289_263_985 240
153 3300048929 Ga0496126_0181034 Ga0496126_0181034_762_1484 240
154 3300049569 Ga0501032_0002879 Ga0501032_0002879_8894_9616 240
155 3300049570 Ga0501033_0022889 Ga0501033_0022889_592_1314 240
156 3300049570 Ga0501033_0030287 Ga0501033_0030287_3104_3841 240
157 3300049571 Ga0501034_0007444 Ga0501034_0007444_10816_11538 240
158 3300049573 Ga0501037_0001908 Ga0501037_0001908_11150_11872 240
159 3300049574 Ga0501038_0004396 Ga0501038_0004396_12294_13016 240
160 3300049575 Ga0501039_0001573 Ga0501039_0001573_3024_3746 240
161 3300049578 Ga0501042_0011142 Ga0501042_0011142_3746_4468 240
162 3300049579 Ga0501043_0044199 Ga0501043_0044199_1869_2600 240
163 3300049579 Ga0501043_0048058 Ga0501043_0048058_2292_3014 240
164 3300049579 Ga0501043_0103614 Ga0501043_0103614_70_807 240
165 3300049580 Ga0501046_0006278 Ga0501046_0006278_5314_6036 240
166 3300049581 Ga0501047_0007287 Ga0501047_0007287_3161_3898 240
167 3300049581 Ga0501047_0014477 Ga0501047_0014477_4379_5101 240
168 3300049581 Ga0501047_0169386 Ga0501047_0169386_371_1108 240
169 3300049582 Ga0501048_0003926 Ga0501048_0003926_3821_4543 240
170 3300049583 Ga0501067_0003131 Ga0501067_0003131_4933_5655 240
171 3300049586 Ga0501070_0002559 Ga0501070_0002559_4379_5101 240
172 3300049589 Ga0501073_0000802 Ga0501073_0000802_12192_12914 240
173 3300049589 Ga0501073_0016658 Ga0501073_0016658_2399_3151 240
174 3300049590 Ga0501074_0000138 Ga0501074_0000138_17495_18217 240
175 3300049590 Ga0501074_0040721 Ga0501074_0040721_2028_2780 240
176 3300049741 Ga0501079_0007294 Ga0501079_0007294_5226_5948 240
177 3300049742 Ga0501080_0008063 Ga0501080_0008063_2273_2995 240
178 3300049742 Ga0501080_0046399 Ga0501080_0046399_290_1042 240
179 3300049744 Ga0501083_0008522 Ga0501083_0008522_3498_4250 240
180 3300049744 Ga0501083_0013979 Ga0501083_0013979_468_1190 240
181 3300049822 Ga0501035_0012091 Ga0501035_0012091_7218_7955 240
182 3300049822 Ga0501035_0017376 Ga0501035_0017376_2273_2995 240
183 3300049823 Ga0501044_0030091 Ga0501044_0030091_3061_3798 240
184 3300049823 Ga0501044_0034767 Ga0501044_0034767_2683_3405 240
185 3300049823 Ga0501044_0049845 Ga0501044_0049845_3024_3755 240
186 3300049824 Ga0501045_0017987 Ga0501045_0017987_3396_4118 240
187 3300054114 Ga0501084_0001765 Ga0501084_0001765_3250_3972 240
188 3300060353 Ga0501082_0009503 Ga0501082_0009503_6567_7289 240
189 3300060353 Ga0501082_0016763 Ga0501082_0016763_4759_5511 240
190 3300003320 rootH2_10031158 rootH2_100311582 241
191 3300005327 Ga0070658_10031187 Ga0070658_100311872 241
192 3300005335 Ga0070666_10001325 Ga0070666_100013251 241
193 3300005336 Ga0070680_100037343 Ga0070680_1000373435 241
194 3300005339 Ga0070660_100002162 Ga0070660_1000021622 241
195 3300005341 Ga0070691_10000026 Ga0070691_1000002624 241
196 3300005341 Ga0070691_10000423 Ga0070691_100004233 241
197 3300005364 Ga0070673_100245870 Ga0070673_1002458701 241
198 3300005366 Ga0070659_100023241 Ga0070659_1000232415 241
199 3300005434 Ga0070709_10001084 Ga0070709_1000108413 241
200 3300005436 Ga0070713_100000008 Ga0070713_100000008126 241
201 3300005436 Ga0070713_100153774 Ga0070713_1001537741 241
202 3300005436 Ga0070713_100253727 Ga0070713_1002537273 241
203 3300005439 Ga0070711_100169027 Ga0070711_1001690272 241
204 3300005458 Ga0070681_10028353 Ga0070681_100283536 241
205 3300005530 Ga0070679_100056119 Ga0070679_1000561192 241
206 3300005530 Ga0070679_100137978 Ga0070679_1001379782 241
207 3300005539 Ga0068853_100025374 Ga0068853_1000253744 241
208 3300005539 Ga0068853_100049546 Ga0068853_1000495465 241
209 3300005539 Ga0068853_100319017 Ga0068853_1003190171 241
210 3300005563 Ga0068855_100029133 Ga0068855_1000291334 241
211 3300005563 Ga0068855_100040684 Ga0068855_1000406844 241
212 3300005564 Ga0070664_100465231 Ga0070664_1004652312 241
213 3300005577 Ga0068857_100000572 Ga0068857_10000057222 241
214 3300005578 Ga0068854_100083557 Ga0068854_1000835572 241
215 3300005614 Ga0068856_100000362 Ga0068856_10000036235 241
216 3300005616 Ga0068852_100012265 Ga0068852_1000122655 241
217 3300005834 Ga0068851_10132476 Ga0068851_101324762 241
218 3300005843 Ga0068860_101028390 Ga0068860_1010283901 241
219 3300006175 Ga0070712_100000435 Ga0070712_1000004357 241
220 3300006871 Ga0075434_100019465 Ga0075434_1000194652 241
221 3300006914 Ga0075436_100000099 Ga0075436_10000009933 241
222 3300006914 Ga0075436_100002921 Ga0075436_1000029213 241
223 3300006914 Ga0075436_100031551 Ga0075436_1000315513 241
224 3300007076 Ga0075435_100008130 Ga0075435_1000081304 241
225 3300009093 Ga0105240_10008089 Ga0105240_1000808912 241
226 3300009174 Ga0105241_10059972 Ga0105241_100599724 241
227 3300009174 Ga0105241_10369786 Ga0105241_103697862 241
228 3300009176 Ga0105242_10184712 Ga0105242_101847122 241
229 3300009177 Ga0105248_10421972 Ga0105248_104219721 241
230 3300009545 Ga0105237_10012207 Ga0105237_100122078 241
231 3300009551 Ga0105238_10001957 Ga0105238_1000195717 241
232 3300009551 Ga0105238_10019848 Ga0105238_100198485 241
233 3300010375 Ga0105239_10002396 Ga0105239_100023965 241
234 3300013100 Ga0157373_10000393 Ga0157373_1000039331 241
235 3300013104 Ga0157370_10006364 Ga0157370_100063647 241
236 3300013105 Ga0157369_10004678 Ga0157369_1000467814 241
237 3300013105 Ga0157369_10156713 Ga0157369_101567132 241
238 3300013306 Ga0163162_10633970 Ga0163162_106339702 241
239 3300013307 Ga0157372_10004098 Ga0157372_100040982 241
240 3300014325 Ga0163163_10171125 Ga0163163_101711252 241
241 3300014968 Ga0157379_10000809 Ga0157379_100008094 241
242 3300014968 Ga0157379_10002785 Ga0157379_1000278511 241
243 3300014968 Ga0157379_10002800 Ga0157379_100028006 241
244 3300014968 Ga0157379_10018004 Ga0157379_100180045 241
245 3300025903 Ga0207680_10001877 Ga0207680_100018776 241
246 3300025906 Ga0207699_10000140 Ga0207699_1000014016 241
247 3300025909 Ga0207705_10000130 Ga0207705_1000013046 241
248 3300025911 Ga0207654_10054236 Ga0207654_100542362 241
249 3300025912 Ga0207707_10000839 Ga0207707_1000083910 241
250 3300025912 Ga0207707_10083396 Ga0207707_100833961 241
251 3300025913 Ga0207695_10135029 Ga0207695_101350292 241
252 3300025915 Ga0207693_10001130 Ga0207693_100011307 241
253 3300025916 Ga0207663_10127686 Ga0207663_101276862 241
254 3300025917 Ga0207660_10000793 Ga0207660_100007933 241
255 3300025918 Ga0207662_10373495 Ga0207662_103734952 241
256 3300025919 Ga0207657_10000203 Ga0207657_100002037 241
257 3300025921 Ga0207652_10001704 Ga0207652_100017043 241
258 3300025921 Ga0207652_10016226 Ga0207652_100162265 241
259 3300025924 Ga0207694_10043175 Ga0207694_100431752 241
260 3300025924 Ga0207694_10053944 Ga0207694_100539444 241
261 3300025928 Ga0207700_10000011 Ga0207700_1000001168 241
262 3300025928 Ga0207700_10242562 Ga0207700_102425622 241
263 3300025932 Ga0207690_10221361 Ga0207690_102213611 241
264 3300025939 Ga0207665_10139433 Ga0207665_101394332 241
265 3300025945 Ga0207679_10395292 Ga0207679_103952922 241
266 3300025949 Ga0207667_10006070 Ga0207667_100060707 241
267 3300025949 Ga0207667_10018856 Ga0207667_100188562 241
268 3300025981 Ga0207640_10039961 Ga0207640_100399612 241
269 3300026035 Ga0207703_10039522 Ga0207703_100395225 241
270 3300026041 Ga0207639_10055272 Ga0207639_100552724 241
271 3300026041 Ga0207639_10073439 Ga0207639_100734393 241
272 3300026041 Ga0207639_10329039 Ga0207639_103290392 241
273 3300026067 Ga0207678_10149069 Ga0207678_101490693 241
274 3300026078 Ga0207702_10000162 Ga0207702_1000016215 241
275 3300026078 Ga0207702_10000968 Ga0207702_1000096810 241
276 3300026078 Ga0207702_10510650 Ga0207702_105106502 241
277 3300026116 Ga0207674_10001803 Ga0207674_100018035 241
278 3300026142 Ga0207698_10066852 Ga0207698_100668522 241
279 3300026142 Ga0207698_10337387 Ga0207698_103373872 241
280 3300028381 Ga0268264_10930268 Ga0268264_109302681 241
281 3300028800 Ga0265338_10052693 Ga0265338_100526932 241
282 3300028800 Ga0265338_10340586 Ga0265338_103405862 241
283 3300031238 Ga0265332_10077307 Ga0265332_100773072 241
284 3300031240 Ga0265320_10000561 Ga0265320_100005613 241
285 3300031241 Ga0265325_10002084 Ga0265325_100020847 241
286 3300031249 Ga0265339_10007789 Ga0265339_100077893 241
287 3300031249 Ga0265339_10019156 Ga0265339_100191563 241
288 3300031344 Ga0265316_10311361 Ga0265316_103113612 241
289 3300031344 Ga0265316_10546135 Ga0265316_105461351 241
290 3300031595 Ga0265313_10026643 Ga0265313_100266433 241
291 3300031711 Ga0265314_10001066 Ga0265314_1000106619 241
292 3300031711 Ga0265314_10003381 Ga0265314_100033815 241
293 3300031711 Ga0265314_10004545 Ga0265314_1000454510 241
294 3300031711 Ga0265314_10049532 Ga0265314_100495322 241
295 3300031712 Ga0265342_10049352 Ga0265342_100493522 241
296 3300035111 Ga0373923_0023853 Ga0373923_0023853_1077_1802 241
297 3300035111 Ga0373923_0045555 Ga0373923_0045555_323_1048 241
298 3300035112 Ga0373932_0013397 Ga0373932_0013397_657_1382 241
299 3300035112 Ga0373932_0076927 Ga0373932_0076927_241_966 241
300 3300035116 Ga0373945_0017742 Ga0373945_0017742_127_852 241
301 3300035170 Ga0373943_0287204 Ga0373943_0287204_122_847 241
302 3300035691 Ga0373931_0061144 Ga0373931_0061144_1057_1782 241
303 3300035692 Ga0373935_0237851 Ga0373935_0237851_188_913 241
304 3300035695 Ga0373927_0205119 Ga0373927_0205119_203_928 241
305 3300035724 Ga0373933_0182067 Ga0373933_0182067_484_1209 241
306 3300035725 Ga0373947_0027212 Ga0373947_0027212_1655_2380 241
307 3300036401 Ga0373937_0006766 Ga0373937_0006766_5496_6221 241
308 3300036401 Ga0373937_0013567 Ga0373937_0013567_316_1041 241
309 3300036401 Ga0373937_0077347 Ga0373937_0077347_1609_2334 241
310 3300036401 Ga0373937_0172675 Ga0373937_0172675_490_1215 241
311 3300037068 Ga0373925_0023782 Ga0373925_0023782_3451_4176 241
312 3300037068 Ga0373925_0059238 Ga0373925_0059238_2036_2761 241
313 3300046472 Ga0495580_0202297 Ga0495580_0202297_22_747 241
314 3300046531 Ga0495665_0027367 Ga0495665_0027367_2114_2863 241
315 3300046535 Ga0495586_0103827 Ga0495586_0103827_635_1384 241
316 3300048905 Ga0496102_0308641 Ga0496102_0308641_321_1046 241
317 3300048907 Ga0496104_0052920 Ga0496104_0052920_1420_2145 241
318 3300048910 Ga0496107_0184626 Ga0496107_0184626_157_882 241
319 3300048914 Ga0496111_0304196 Ga0496111_0304196_383_1108 241
320 3300048925 Ga0496122_0020937 Ga0496122_0020937_4638_5393 241
321 3300048929 Ga0496126_0000382 Ga0496126_0000382_41032_41757 241
322 3300049569 Ga0501032_0067117 Ga0501032_0067117_31_756 241
323 3300049570 Ga0501033_0032973 Ga0501033_0032973_36_761 241
324 3300049573 Ga0501037_0019872 Ga0501037_0019872_2712_3437 241
325 3300049574 Ga0501038_0572484 Ga0501038_0572484_31_798 241
326 3300049585 Ga0501069_0131083 Ga0501069_0131083_293_1018 241
327 3300049586 Ga0501070_0000002 Ga0501070_0000002_147186_147911 241
328 3300049742 Ga0501080_0001693 Ga0501080_0001693_8414_9139 241
329 3300049823 Ga0501044_0016840 Ga0501044_0016840_2566_3291 241
330 3300049823 Ga0501044_0186912 Ga0501044_0186912_519_1244 241
331 3300050512 nmdc:mga0n895_25084_c1 nmdc:mga0n895_25084_c1_4844_5569 241
332 3300050512 nmdc:mga0n895_300949_c1 nmdc:mga0n895_300949_c1_240_965 241
333 3300050513 nmdc:mga0rr50_10688_c1 nmdc:mga0rr50_10688_c1_4824_5549 241
334 3300050514 nmdc:mga08x19_2099_c1 nmdc:mga08x19_2099_c1_6381_7106 241
335 3300050514 nmdc:mga08x19_28809_c1 nmdc:mga08x19_28809_c1_2242_2967 241
336 3300050514 nmdc:mga08x19_394_c1 nmdc:mga08x19_394_c1_13130_13855 241
337 iso_pu_bacteria 2511231221 2512032942 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

42

251

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7lpq-assembly3.cif.gz_C crystal structure of cryptococcus neoformans sterylglucosidase 1 with hit 9 0.8028 6 53
5j7z-assembly1.cif.gz_A crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm1 0.7975 6 51
5j14-assembly2.cif.gz_B crystal structure of endoglycoceramidase i from rhodococ-cus equi in complex with gm3 0.797 6 51
5ccu-assembly1.cif.gz_B crystal structure of endoglycoceramidase i from rhodococ-cus equi 0.7953 6 51
5ccu-assembly1.cif.gz_A crystal structure of endoglycoceramidase i from rhodococ-cus equi 0.794 6 51
ID Description Score Start End Superfamily
af_A0A1D6HC20_408_528_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.831 24 51 3.40.50.10190
af_F4JC91_1_132_3.40.50.410 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;von Willebrand factor, type A domain 0.8068 8 53 3.40.50.410
af_Q55CF6_73_417_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.8022 7 52 3.20.20.80
af_P13458_780_1036_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7883 7 53 3.40.50.300
af_P40566_62_298_3.20.20.80 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Glycosidases 0.7796 7 53 3.20.20.80
ID Description Score Start End GO Terms
AF-A0A7X4CX93-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9957 153 239 GO:0005524
GO:0005829
GO:0006225
GO:0033862
AF-A0A4V1UIY5-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9884 147 241 GO:0005524
GO:0006225
GO:0033862
AF-A0A529K8N8-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9862 144 240 GO:0005524
GO:0005829
GO:0006225
GO:0033862
AF-A0A3D5RSN6-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.9781 147 241 GO:0005524
GO:0006225
GO:0033862
AF-A0A7Y2GDC9-F1-model_v4 UMP kinase (EC 2.7.4.22) (Uridine monophosphate kinase) 0.977 150 239 GO:0005524
GO:0006225
GO:0033862

Feature Viewer

pLDDT pTM Quality
90.03 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map