F413055

General Info

Members Datasets Scaffolds Average Seq Length
337 169 674 284

Family's Representative Sequence

Representative Sequence 3300009101|Ga0105247_10024846|Ga0105247_100248462
Length 323
Sequence VPENRKRTVFAARRTPAGGLCNRNLTVTACDRAQTDATVAGVKRLLTLAGCLSLAIVVAGAQVPQDGQRGPRTRKAVLAWADPRNGIAQHDSVSHALAVIERLGYESGLYDTFIRTDSNIISKHPLMTDGKPASGGPNLTNVDAIFFLGHRDVPLDPQQKADLLSFVKDDGKGFVAAHTATTAFLDWPEFGELLGARYDGHPWNTVYGSVINEDPSFPATRHLAPVFAFTDEFYQAQEYSRDKIRVLLRLDVSKLPPNAELRRKDGDFPLAWAKTYGKGRVFYSSLGHAPATWDNPDVYRMYFEALKWSLGLTDADVSPRPLK

Samples

Sample ID Description Type Environment
1 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
115 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
116 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
117 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
118 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
119 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
120 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
121 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
124 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
125 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
126 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
127 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
128 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
137 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
140 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
169 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.48
Nodule 0
Rhizoplane 1.78
Rhizosphere 96.44
Stem 0
Stem Tuber 0
Unclassified 18.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105247_10024846 3300009101 Bacteria 3612
2 JGI25406J46586_10014177 3300003203 Bacteria 3397
3 Ga0065715_10044612 3300005293 Bacteria 1406
4 Ga0070676_10003215 3300005328 Bacteria 8464
5 Ga0070683_100000008 3300005329 Bacteria 329206
6 Ga0070683_100203954 3300005329 Unclassified 1878
7 Ga0070683_100538811 3300005329 Bacteria 1116
8 Ga0070666_10157814 3300005335 Bacteria 1585
9 Ga0068868_100293642 3300005338 Bacteria 1379
10 Ga0068868_100297415 3300005338 Bacteria 1370
11 Ga0070689_100135562 3300005340 Bacteria 1977
12 Ga0070689_100236530 3300005340 Unclassified 1503
13 Ga0070689_100474393 3300005340 Bacteria 1068
14 Ga0070691_10017780 3300005341 Bacteria 3271
15 Ga0070692_10002783 3300005345 Bacteria 6894
16 Ga0070668_100092981 3300005347 Bacteria 2380
17 Ga0070669_100053170 3300005353 Bacteria 2964
18 Ga0070675_100101135 3300005354 Bacteria 2428
19 Ga0070675_100258950 3300005354 Bacteria 1524
20 Ga0070671_100030172 3300005355 Bacteria 4474
21 Ga0070674_100036300 3300005356 Bacteria 3307
22 Ga0070673_100039002 3300005364 Unclassified 3632
23 Ga0070673_100106817 3300005364 Bacteria 2315
24 Ga0070673_100312669 3300005364 Unclassified 1386
25 Ga0070688_100175479 3300005365 Bacteria 1483
26 Ga0070659_100060097 3300005366 Unclassified 3002
27 Ga0070667_100159193 3300005367 Bacteria 1988
28 Ga0070667_100333137 3300005367 Unclassified 1371
29 Ga0070713_100046801 3300005436 Bacteria 3551
30 Ga0070713_100122758 3300005436 Unclassified 2280
31 Ga0070713_100157296 3300005436 Unclassified 2026
32 Ga0070701_10176763 3300005438 Bacteria 1247
33 Ga0070705_100037293 3300005440 Bacteria 2740
34 Ga0070700_100015564 3300005441 Unclassified 4317
35 Ga0070700_100060850 3300005441 Unclassified 2381
36 Ga0070700_100214217 3300005441 Unclassified 1361
37 Ga0070700_100241026 3300005441 Bacteria 1292
38 Ga0070694_100003989 3300005444 Bacteria 8832
39 Ga0070694_100008492 3300005444 Bacteria 6283
40 Ga0070694_100061228 3300005444 Bacteria 2568
41 Ga0070708_100008433 3300005445 Bacteria 8272
42 Ga0070708_100090539 3300005445 Unclassified 2785
43 Ga0070678_100069405 3300005456 Bacteria 2631
44 Ga0070678_100142847 3300005456 Bacteria 1918
45 Ga0070662_100223729 3300005457 Bacteria 1503
46 Ga0068867_100171523 3300005459 Bacteria 1719
47 Ga0068867_100246419 3300005459 Bacteria 1451
48 Ga0068867_100254273 3300005459 Bacteria 1430
49 Ga0068867_100356265 3300005459 Bacteria 1222
50 Ga0070706_100218822 3300005467 Bacteria 1778
51 Ga0070706_100292550 3300005467 Bacteria 1520
52 Ga0070707_100172533 3300005468 Bacteria 2107
53 Ga0070707_100361080 3300005468 Bacteria 1411
54 Ga0070698_100010823 3300005471 Bacteria 9709
55 Ga0070698_100080483 3300005471 Bacteria 3253
56 Ga0070699_100007891 3300005518 Bacteria 9252
57 Ga0070699_100008161 3300005518 Bacteria 9086
58 Ga0070699_100021409 3300005518 Bacteria 5577
59 Ga0070699_100093121 3300005518 Bacteria 2636
60 Ga0070699_100521608 3300005518 Bacteria 1080
61 Ga0070679_100138238 3300005530 Unclassified 2417
62 Ga0070684_100000044 3300005535 Bacteria 84710
63 Ga0070684_100300393 3300005535 Unclassified 1473
64 Ga0070672_100020095 3300005543 Unclassified 4865
65 Ga0070672_100041935 3300005543 Bacteria 3522
66 Ga0070672_100200639 3300005543 Bacteria 1668
67 Ga0070686_100255359 3300005544 Unclassified 1282
68 Ga0070695_100020389 3300005545 Unclassified 4048
69 Ga0070695_100022519 3300005545 Bacteria 3865
70 Ga0070695_100140135 3300005545 Unclassified 1676
71 Ga0070696_100011251 3300005546 Bacteria 5992
72 Ga0070696_100039877 3300005546 Bacteria 3242
73 Ga0070665_100011196 3300005548 Bacteria 9069
74 Ga0070665_100016556 3300005548 Bacteria 7391
75 Ga0070704_100004577 3300005549 Bacteria 7995
76 Ga0070704_100026373 3300005549 Unclassified 3838
77 Ga0070704_100027308 3300005549 Bacteria 3784
78 Ga0070704_100055594 3300005549 Bacteria 2807
79 Ga0070664_100140867 3300005564 Unclassified 2123
80 Ga0068854_100487688 3300005578 Bacteria 1036
81 Ga0070702_100181403 3300005615 Bacteria 1378
82 Ga0068859_100161587 3300005617 Bacteria 2319
83 Ga0068864_100163888 3300005618 Bacteria 2022
84 Ga0068866_10061822 3300005718 Bacteria 1946
85 Ga0068861_100023517 3300005719 Bacteria 4445
86 Ga0068861_100025881 3300005719 Bacteria 4261
87 Ga0068861_100059065 3300005719 Bacteria 2935
88 Ga0068861_100307687 3300005719 Unclassified 1375
89 Ga0068861_100360944 3300005719 Bacteria 1277
90 Ga0068851_10047836 3300005834 Unclassified 2167
91 Ga0068863_100002195 3300005841 Bacteria 19378
92 Ga0068863_100277820 3300005841 Bacteria 1622
93 Ga0068858_100017350 3300005842 Bacteria 6753
94 Ga0068858_100072779 3300005842 Bacteria 3189
95 Ga0068858_100337192 3300005842 Bacteria 1443
96 Ga0068860_100102317 3300005843 Bacteria 2733
97 Ga0068860_100636405 3300005843 Unclassified 1074
98 Ga0068862_100211087 3300005844 Bacteria 1754
99 Ga0068862_100273181 3300005844 Bacteria 1547
100 Ga0081539_10000025 3300005985 Bacteria 340255
101 Ga0081539_10002557 3300005985 Bacteria 25249
102 Ga0081539_10003526 3300005985 Bacteria 19053
103 Ga0070717_10172839 3300006028 Unclassified 1880
104 Ga0075362_10008113 3300006177 Bacteria 4005
105 Ga0097621_100060964 3300006237 Bacteria 3093
106 Ga0097621_100075287 3300006237 Bacteria 2797
107 Ga0097621_100093490 3300006237 Bacteria 2520
108 Ga0097621_100217094 3300006237 Bacteria 1665
109 Ga0068871_100075036 3300006358 Bacteria 2791
110 Ga0068871_100078376 3300006358 Unclassified 2732
111 Ga0068871_100313890 3300006358 Bacteria 1379
112 Ga0075428_100071153 3300006844 Unclassified 3801
113 Ga0075428_100321571 3300006844 Unclassified 1662
114 Ga0075428_100326878 3300006844 Bacteria 1647
115 Ga0075428_100451193 3300006844 Bacteria 1377
116 Ga0075433_10399426 3300006852 Bacteria 1213
117 Ga0075434_100003265 3300006871 Bacteria 14496
118 Ga0075434_100106732 3300006871 Bacteria 2810
119 Ga0075434_100373825 3300006871 Unclassified 1446
120 Ga0075434_100405618 3300006871 Bacteria 1384
121 Ga0075429_100015011 3300006880 Bacteria 6717
122 Ga0075429_100070255 3300006880 Bacteria 3049
123 Ga0075429_100170595 3300006880 Bacteria 1906
124 Ga0075429_100272279 3300006880 Bacteria 1483
125 Ga0068865_100545372 3300006881 Bacteria 973
126 Ga0075436_100000657 3300006914 Bacteria 22779
127 Ga0075436_100013496 3300006914 Bacteria 5594
128 Ga0075436_100146753 3300006914 Bacteria 1659
129 Ga0097620_100161578 3300006931 Bacteria 2319
130 Ga0075435_100000483 3300007076 Bacteria 24195
131 Ga0075435_100018777 3300007076 Bacteria 5267
132 Ga0075435_100034147 3300007076 Unclassified 4027
133 Ga0075435_100040966 3300007076 Bacteria 3700
134 Ga0075435_100058361 3300007076 Bacteria 3125
135 Ga0075435_100157693 3300007076 Bacteria 1910
136 Ga0075435_100191129 3300007076 Bacteria 1733
137 Ga0075435_100192681 3300007076 Unclassified 1726
138 Ga0105240_10000137 3300009093 Bacteria 149925
139 Ga0105240_10056686 3300009093 Bacteria 4902
140 Ga0111539_10003851 3300009094 Bacteria 19747
141 Ga0111539_10011781 3300009094 Bacteria 10963
142 Ga0111539_10017398 3300009094 Bacteria 8898
143 Ga0111539_10019557 3300009094 Bacteria 8355
144 Ga0111539_10091867 3300009094 Bacteria 3566
145 Ga0111539_10189427 3300009094 Bacteria 2400
146 Ga0114129_10002517 3300009147 Bacteria 25438
147 Ga0114129_10017350 3300009147 Bacteria 10250
148 Ga0114129_10035435 3300009147 Bacteria 7050
149 Ga0114129_10064295 3300009147 Bacteria 5119
150 Ga0114129_10226026 3300009147 Bacteria 2522
151 Ga0114129_10288348 3300009147 Bacteria 2191
152 Ga0114129_10321275 3300009147 Bacteria 2058
153 Ga0114129_10673458 3300009147 Bacteria 1333
154 Ga0105243_10040820 3300009148 Unclassified 3626
155 Ga0105242_10010882 3300009176 Bacteria 6987
156 Ga0105242_10074091 3300009176 Bacteria 2832
157 Ga0105248_10007513 3300009177 Bacteria 11959
158 Ga0105248_10013350 3300009177 Bacteria 9040
159 Ga0105248_10056172 3300009177 Bacteria 4416
160 Ga0105248_10067824 3300009177 Bacteria 4005
161 Ga0105248_10097681 3300009177 Bacteria 3309
162 Ga0105248_10105294 3300009177 Unclassified 3180
163 Ga0105237_10016826 3300009545 Bacteria 7590
164 Ga0157369_10618429 3300013105 Bacteria 1118
165 Ga0157378_10308458 3300013297 Bacteria 1534
166 Ga0163162_10454697 3300013306 Bacteria 1412
167 Ga0157375_10272507 3300013308 Bacteria 1855
168 Ga0163163_10027946 3300014325 Bacteria 5410
169 Ga0163163_10076420 3300014325 Unclassified 3343
170 Ga0163163_10253116 3300014325 Bacteria 1812
171 Ga0163163_10474781 3300014325 Bacteria 1311
172 Ga0157380_10001321 3300014326 Bacteria 16098
173 Ga0157380_10002713 3300014326 Bacteria 12006
174 Ga0157379_10011321 3300014968 Bacteria 7775
175 Ga0157379_10077480 3300014968 Bacteria 2977
176 Ga0157376_10173371 3300014969 Unclassified 1966
177 Ga0157376_10179004 3300014969 Bacteria 1936
178 Ga0157376_10181126 3300014969 Bacteria 1926
179 Ga0157376_10686936 3300014969 Unclassified 1027
180 Ga0207697_10092189 3300025315 Bacteria 1284
181 Ga0207645_10016189 3300025907 Bacteria 4940
182 Ga0207695_10003599 3300025913 Bacteria 21692
183 Ga0207695_10068958 3300025913 Bacteria 3621
184 Ga0207695_10165224 3300025913 Bacteria 2142
185 Ga0207652_10097366 3300025921 Unclassified 2593
186 Ga0207646_10263285 3300025922 Bacteria 1558
187 Ga0207681_10081105 3300025923 Bacteria 2290
188 Ga0207650_10115740 3300025925 Bacteria 2081
189 Ga0207659_10000641 3300025926 Bacteria 20755
190 Ga0207659_10178861 3300025926 Bacteria 1679
191 Ga0207700_10101258 3300025928 Unclassified 2298
192 Ga0207700_10120973 3300025928 Bacteria 2123
193 Ga0207644_10250692 3300025931 Bacteria 1412
194 Ga0207686_10041606 3300025934 Unclassified 2803
195 Ga0207686_10105330 3300025934 Bacteria 1891
196 Ga0207709_10030810 3300025935 Bacteria 3124
197 Ga0207709_10327740 3300025935 Unclassified 1148
198 Ga0207670_10258140 3300025936 Unclassified 1349
199 Ga0207669_10001811 3300025937 Bacteria 9049
200 Ga0207691_10054445 3300025940 Unclassified 3649
201 Ga0207691_10264474 3300025940 Bacteria 1482
202 Ga0207691_10265900 3300025940 Bacteria 1478
203 Ga0207711_10025814 3300025941 Bacteria 4927
204 Ga0207711_10246020 3300025941 Bacteria 1641
205 Ga0207689_10198209 3300025942 Unclassified 1657
206 Ga0207661_10000008 3300025944 Bacteria 451211
207 Ga0207651_10028627 3300025960 Bacteria 3518
208 Ga0207651_10333866 3300025960 Bacteria 1271
209 Ga0207712_10223559 3300025961 Bacteria 1507
210 Ga0207640_10195120 3300025981 Bacteria 1529
211 Ga0207658_10238713 3300025986 Bacteria 1538
212 Ga0207677_10016393 3300026023 Bacteria 4388
213 Ga0207677_10129824 3300026023 Bacteria 1911
214 Ga0207703_10014447 3300026035 Bacteria 6157
215 Ga0207703_10018986 3300026035 Bacteria 5370
216 Ga0207703_10158825 3300026035 Bacteria 1978
217 Ga0207708_10021898 3300026075 Unclassified 4823
218 Ga0207708_10079476 3300026075 Bacteria 2519
219 Ga0207708_10109187 3300026075 Bacteria 2146
220 Ga0207708_10147046 3300026075 Bacteria 1852
221 Ga0207708_10153263 3300026075 Unclassified 1816
222 Ga0207708_10281109 3300026075 Unclassified 1349
223 Ga0207641_10001723 3300026088 Bacteria 21130
224 Ga0207641_10267162 3300026088 Bacteria 1604
225 Ga0207648_10135235 3300026089 Bacteria 2171
226 Ga0207648_10210130 3300026089 Unclassified 1727
227 Ga0207648_10234019 3300026089 Bacteria 1635
228 Ga0207648_10293197 3300026089 Bacteria 1457
229 Ga0207676_10007246 3300026095 Bacteria 7855
230 Ga0207676_10016827 3300026095 Bacteria 5295
231 Ga0207676_10020452 3300026095 Bacteria 4843
232 Ga0207675_100004193 3300026118 Bacteria 13952
233 Ga0207675_100020232 3300026118 Bacteria 6205
234 Ga0207675_100027385 3300026118 Bacteria 5308
235 Ga0207675_100056099 3300026118 Bacteria 3675
236 Ga0207675_100355996 3300026118 Unclassified 1435
237 Ga0207683_10005118 3300026121 Bacteria 11253
238 Ga0207428_10000139 3300027907 Bacteria 98277
239 Ga0207428_10003891 3300027907 Bacteria 14321
240 Ga0207428_10029278 3300027907 Bacteria 4567
241 Ga0207428_10048438 3300027907 Bacteria 3409
242 Ga0268266_10001170 3300028379 Bacteria 32423
243 Ga0268266_10015893 3300028379 Bacteria 6441
244 Ga0268265_10372150 3300028380 Bacteria 1311
245 Ga0307406_10294474 3300031901 Bacteria 1244
246 Ga0373950_0005123 3300034818 Bacteria 1946
247 Ga0373958_0001012 3300034819 Bacteria 3679
248 Ga0373959_0000473 3300034820 Bacteria 7423
249 Ga0373938_0000817 3300034957 Bacteria 5036
250 Ga0373940_0000834 3300035088 Bacteria 5140
251 Ga0373949_0001796 3300035090 Bacteria 5870
252 Ga0373951_0001409 3300035091 Bacteria 6319
253 Ga0373939_0000198 3300035114 Bacteria 16611
254 Ga0373941_0000490 3300035115 Bacteria 7921
255 Ga0373941_0090536 3300035115 Bacteria 1049
256 Ga0373960_0000078 3300035121 Bacteria 14239
257 Ga0373943_0080228 3300035170 Bacteria 1672
258 Ga0373942_0000908 3300035207 Bacteria 8108
259 Ga0373961_0001270 3300035241 Bacteria 7682
260 Ga0373947_0055630 3300035725 Bacteria 2390
261 Ga0373947_0137952 3300035725 Bacteria 1562
262 Ga0373947_0172884 3300035725 Bacteria 1403
263 Ga0373925_0069438 3300037068 Bacteria 2662
264 Ga0436364_0863544 3300037853 Unclassified 4930
265 Ga0451577_0050454 3300042876 Bacteria 3714
266 Ga0451577_0108689 3300042876 Unclassified 2479
267 Ga0451577_0250495 3300042876 Bacteria 1603
268 Ga0453684_0187054 3300044712 Unclassified 2426
269 Ga0451576_0004084 3300045051 Bacteria 19289
270 Ga0451576_0019071 3300045051 Bacteria 7495
271 Ga0451576_0026561 3300045051 Bacteria 6226
272 Ga0451576_0235549 3300045051 Unclassified 1912
273 Ga0495629_0192369 3300046459 Bacteria 1412
274 Ga0495580_0016183 3300046472 Bacteria 5605
275 Ga0495580_0107944 3300046472 Bacteria 1933
276 Ga0495664_0044428 3300046477 Bacteria 2633
277 Ga0495594_0177917 3300046499 Bacteria 1211
278 Ga0495608_0166235 3300046511 Bacteria 1401
279 Ga0495642_0016470 3300046528 Bacteria 2881
280 Ga0495621_0031266 3300046539 Unclassified 1825
281 Ga0495645_0077472 3300046543 Bacteria 2390
282 Ga0495667_0021701 3300046559 Bacteria 4333
283 Ga0495659_0001533 3300046664 Bacteria 7808
284 Ga0495647_0036992 3300046681 Bacteria 1840
285 Ga0495658_0072688 3300046683 Bacteria 2001
286 Ga0495613_0087497 3300046689 Bacteria 2258
287 Ga0495670_0085494 3300046691 Bacteria 1610
288 Ga0495581_0258160 3300047315 Unclassified 1019
289 Ga0495674_0008422 3300047319 Bacteria 9823
290 Ga0495674_0020611 3300047319 Bacteria 6103
291 Ga0495674_0077672 3300047319 Unclassified 2854
292 Ga0495674_0096750 3300047319 Bacteria 2516
293 Ga0495674_0115754 3300047319 Bacteria 2269
294 Ga0495680_0028347 3300047322 Bacteria 4592
295 Ga0495684_0002068 3300047471 Bacteria 16129
296 Ga0496106_0225516 3300048909 Bacteria 1495
297 Ga0496108_0031780 3300048911 Bacteria 4382
298 Ga0496110_0549561 3300048913 Bacteria 1049
299 Ga0496112_0336234 3300048915 Bacteria 1454
300 Ga0496113_0062748 3300048916 Unclassified 2807
301 Ga0496115_0304697 3300048918 Bacteria 1305
302 nmdc:mga00v17_41658_c1 3300050491 Bacteria 2759
303 nmdc:mga0yw44_41821_c1 3300050492 Bacteria 2730
304 nmdc:mga06z11_2964_c1 3300050494 Bacteria 6538
305 nmdc:mga05p37_112655_c1 3300050507 Bacteria 3345
306 nmdc:mga05p37_15679_c1 3300050507 Bacteria 9110
307 nmdc:mga05p37_26224_c1 3300050507 Bacteria 7087
308 nmdc:mga05p37_26654_c1 3300050507 Bacteria 7028
309 nmdc:mga05p37_338420_c1 3300050507 Bacteria 1775
310 nmdc:mga05p37_3603_c1 3300050507 Bacteria 18091
311 nmdc:mga05p37_535769_c1 3300050507 Bacteria 1336
312 nmdc:mga05p37_54383_c1 3300050507 Unclassified 4925
313 nmdc:mga09592_124039_c1 3300050508 Bacteria 2220
314 nmdc:mga09592_207468_c1 3300050508 Unclassified 1697
315 nmdc:mga09592_8853_c1 3300050508 Bacteria 8187
316 nmdc:mga08y16_11001_c1 3300050511 Bacteria 9500
317 nmdc:mga08y16_20064_c1 3300050511 Bacteria 7052
318 nmdc:mga08y16_368780_c1 3300050511 Bacteria 1473
319 nmdc:mga08y16_763_c1 3300050511 Bacteria 30631
320 nmdc:mga08y16_96691_c1 3300050511 Bacteria 3075
321 nmdc:mga0n895_142405_c1 3300050512 Bacteria 2427
322 nmdc:mga0n895_226860_c1 3300050512 Unclassified 1896
323 nmdc:mga0n895_555_c1 3300050512 Bacteria 25552
324 nmdc:mga0rr50_12347_c1 3300050513 Bacteria 5517
325 nmdc:mga0rr50_13_c1 3300050513 Bacteria 213605
326 nmdc:mga0rr50_225412_c1 3300050513 Bacteria 1549
327 nmdc:mga0rr50_227246_c1 3300050513 Unclassified 1543
328 nmdc:mga0rr50_355914_c1 3300050513 Bacteria 1232
329 nmdc:mga0rr50_70481_c1 3300050513 Unclassified 2664
330 nmdc:mga08x19_97_c1 3300050514 Bacteria 77512
331 nmdc:mga0a205_123201_c1 3300050515 Unclassified 2492
332 nmdc:mga0a205_44599_c1 3300050515 Bacteria 4275
333 nmdc:mga0a205_463802_c1 3300050515 Bacteria 1126
334 nmdc:mga0a205_61004_c1 3300050515 Unclassified 3642
335 nmdc:mga0a205_80042_c1 3300050515 Bacteria 3158
336 Ga0495595_0050339 3300053084 Bacteria 1929
337 Ga0500646_0010727 3300053090 Unclassified 2352
338 Ga0105247_10024846
339 JGI25406J46586_10014177
340 Ga0065715_10044612
341 Ga0070676_10003215
342 Ga0070683_100000008
343 Ga0070683_100203954
344 Ga0070683_100538811
345 Ga0070666_10157814
346 Ga0068868_100293642
347 Ga0068868_100297415
348 Ga0070689_100135562
349 Ga0070689_100236530
350 Ga0070689_100474393
351 Ga0070691_10017780
352 Ga0070692_10002783
353 Ga0070668_100092981
354 Ga0070669_100053170
355 Ga0070675_100101135
356 Ga0070675_100258950
357 Ga0070671_100030172
358 Ga0070674_100036300
359 Ga0070673_100039002
360 Ga0070673_100106817
361 Ga0070673_100312669
362 Ga0070688_100175479
363 Ga0070659_100060097
364 Ga0070667_100159193
365 Ga0070667_100333137
366 Ga0070713_100046801
367 Ga0070713_100122758
368 Ga0070713_100157296
369 Ga0070701_10176763
370 Ga0070705_100037293
371 Ga0070700_100015564
372 Ga0070700_100060850
373 Ga0070700_100214217
374 Ga0070700_100241026
375 Ga0070694_100003989
376 Ga0070694_100008492
377 Ga0070694_100061228
378 Ga0070708_100008433
379 Ga0070708_100090539
380 Ga0070678_100069405
381 Ga0070678_100142847
382 Ga0070662_100223729
383 Ga0068867_100171523
384 Ga0068867_100246419
385 Ga0068867_100254273
386 Ga0068867_100356265
387 Ga0070706_100218822
388 Ga0070706_100292550
389 Ga0070707_100172533
390 Ga0070707_100361080
391 Ga0070698_100010823
392 Ga0070698_100080483
393 Ga0070699_100007891
394 Ga0070699_100008161
395 Ga0070699_100021409
396 Ga0070699_100093121
397 Ga0070699_100521608
398 Ga0070679_100138238
399 Ga0070684_100000044
400 Ga0070684_100300393
401 Ga0070672_100020095
402 Ga0070672_100041935
403 Ga0070672_100200639
404 Ga0070686_100255359
405 Ga0070695_100020389
406 Ga0070695_100022519
407 Ga0070695_100140135
408 Ga0070696_100011251
409 Ga0070696_100039877
410 Ga0070665_100011196
411 Ga0070665_100016556
412 Ga0070704_100004577
413 Ga0070704_100026373
414 Ga0070704_100027308
415 Ga0070704_100055594
416 Ga0070664_100140867
417 Ga0068854_100487688
418 Ga0070702_100181403
419 Ga0068859_100161587
420 Ga0068864_100163888
421 Ga0068866_10061822
422 Ga0068861_100023517
423 Ga0068861_100025881
424 Ga0068861_100059065
425 Ga0068861_100307687
426 Ga0068861_100360944
427 Ga0068851_10047836
428 Ga0068863_100002195
429 Ga0068863_100277820
430 Ga0068858_100017350
431 Ga0068858_100072779
432 Ga0068858_100337192
433 Ga0068860_100102317
434 Ga0068860_100636405
435 Ga0068862_100211087
436 Ga0068862_100273181
437 Ga0081539_10000025
438 Ga0081539_10002557
439 Ga0081539_10003526
440 Ga0070717_10172839
441 Ga0075362_10008113
442 Ga0097621_100060964
443 Ga0097621_100075287
444 Ga0097621_100093490
445 Ga0097621_100217094
446 Ga0068871_100075036
447 Ga0068871_100078376
448 Ga0068871_100313890
449 Ga0075428_100071153
450 Ga0075428_100321571
451 Ga0075428_100326878
452 Ga0075428_100451193
453 Ga0075433_10399426
454 Ga0075434_100003265
455 Ga0075434_100106732
456 Ga0075434_100373825
457 Ga0075434_100405618
458 Ga0075429_100015011
459 Ga0075429_100070255
460 Ga0075429_100170595
461 Ga0075429_100272279
462 Ga0068865_100545372
463 Ga0075436_100000657
464 Ga0075436_100013496
465 Ga0075436_100146753
466 Ga0097620_100161578
467 Ga0075435_100000483
468 Ga0075435_100018777
469 Ga0075435_100034147
470 Ga0075435_100040966
471 Ga0075435_100058361
472 Ga0075435_100157693
473 Ga0075435_100191129
474 Ga0075435_100192681
475 Ga0105240_10000137
476 Ga0105240_10056686
477 Ga0111539_10003851
478 Ga0111539_10011781
479 Ga0111539_10017398
480 Ga0111539_10019557
481 Ga0111539_10091867
482 Ga0111539_10189427
483 Ga0114129_10002517
484 Ga0114129_10017350
485 Ga0114129_10035435
486 Ga0114129_10064295
487 Ga0114129_10226026
488 Ga0114129_10288348
489 Ga0114129_10321275
490 Ga0114129_10673458
491 Ga0105243_10040820
492 Ga0105242_10010882
493 Ga0105242_10074091
494 Ga0105248_10007513
495 Ga0105248_10013350
496 Ga0105248_10056172
497 Ga0105248_10067824
498 Ga0105248_10097681
499 Ga0105248_10105294
500 Ga0105237_10016826
501 Ga0157369_10618429
502 Ga0157378_10308458
503 Ga0163162_10454697
504 Ga0157375_10272507
505 Ga0163163_10027946
506 Ga0163163_10076420
507 Ga0163163_10253116
508 Ga0163163_10474781
509 Ga0157380_10001321
510 Ga0157380_10002713
511 Ga0157379_10011321
512 Ga0157379_10077480
513 Ga0157376_10173371
514 Ga0157376_10179004
515 Ga0157376_10181126
516 Ga0157376_10686936
517 Ga0207697_10092189
518 Ga0207645_10016189
519 Ga0207695_10003599
520 Ga0207695_10068958
521 Ga0207695_10165224
522 Ga0207652_10097366
523 Ga0207646_10263285
524 Ga0207681_10081105
525 Ga0207650_10115740
526 Ga0207659_10000641
527 Ga0207659_10178861
528 Ga0207700_10101258
529 Ga0207700_10120973
530 Ga0207644_10250692
531 Ga0207686_10041606
532 Ga0207686_10105330
533 Ga0207709_10030810
534 Ga0207709_10327740
535 Ga0207670_10258140
536 Ga0207669_10001811
537 Ga0207691_10054445
538 Ga0207691_10264474
539 Ga0207691_10265900
540 Ga0207711_10025814
541 Ga0207711_10246020
542 Ga0207689_10198209
543 Ga0207661_10000008
544 Ga0207651_10028627
545 Ga0207651_10333866
546 Ga0207712_10223559
547 Ga0207640_10195120
548 Ga0207658_10238713
549 Ga0207677_10016393
550 Ga0207677_10129824
551 Ga0207703_10014447
552 Ga0207703_10018986
553 Ga0207703_10158825
554 Ga0207708_10021898
555 Ga0207708_10079476
556 Ga0207708_10109187
557 Ga0207708_10147046
558 Ga0207708_10153263
559 Ga0207708_10281109
560 Ga0207641_10001723
561 Ga0207641_10267162
562 Ga0207648_10135235
563 Ga0207648_10210130
564 Ga0207648_10234019
565 Ga0207648_10293197
566 Ga0207676_10007246
567 Ga0207676_10016827
568 Ga0207676_10020452
569 Ga0207675_100004193
570 Ga0207675_100020232
571 Ga0207675_100027385
572 Ga0207675_100056099
573 Ga0207675_100355996
574 Ga0207683_10005118
575 Ga0207428_10000139
576 Ga0207428_10003891
577 Ga0207428_10029278
578 Ga0207428_10048438
579 Ga0268266_10001170
580 Ga0268266_10015893
581 Ga0268265_10372150
582 Ga0307406_10294474
583 Ga0373950_0005123
584 Ga0373958_0001012
585 Ga0373959_0000473
586 Ga0373938_0000817
587 Ga0373940_0000834
588 Ga0373949_0001796
589 Ga0373951_0001409
590 Ga0373939_0000198
591 Ga0373941_0000490
592 Ga0373941_0090536
593 Ga0373960_0000078
594 Ga0373943_0080228
595 Ga0373942_0000908
596 Ga0373961_0001270
597 Ga0373947_0055630
598 Ga0373947_0137952
599 Ga0373947_0172884
600 Ga0373925_0069438
601 Ga0436364_0863544
602 Ga0451577_0050454
603 Ga0451577_0108689
604 Ga0451577_0250495
605 Ga0453684_0187054
606 Ga0451576_0004084
607 Ga0451576_0019071
608 Ga0451576_0026561
609 Ga0451576_0235549
610 Ga0495629_0192369
611 Ga0495580_0016183
612 Ga0495580_0107944
613 Ga0495664_0044428
614 Ga0495594_0177917
615 Ga0495608_0166235
616 Ga0495642_0016470
617 Ga0495621_0031266
618 Ga0495645_0077472
619 Ga0495667_0021701
620 Ga0495659_0001533
621 Ga0495647_0036992
622 Ga0495658_0072688
623 Ga0495613_0087497
624 Ga0495670_0085494
625 Ga0495581_0258160
626 Ga0495674_0008422
627 Ga0495674_0020611
628 Ga0495674_0077672
629 Ga0495674_0096750
630 Ga0495674_0115754
631 Ga0495680_0028347
632 Ga0495684_0002068
633 Ga0496106_0225516
634 Ga0496108_0031780
635 Ga0496110_0549561
636 Ga0496112_0336234
637 Ga0496113_0062748
638 Ga0496115_0304697
639 nmdc:mga00v17_41658_c1
640 nmdc:mga0yw44_41821_c1
641 nmdc:mga06z11_2964_c1
642 nmdc:mga05p37_112655_c1
643 nmdc:mga05p37_15679_c1
644 nmdc:mga05p37_26224_c1
645 nmdc:mga05p37_26654_c1
646 nmdc:mga05p37_338420_c1
647 nmdc:mga05p37_3603_c1
648 nmdc:mga05p37_535769_c1
649 nmdc:mga05p37_54383_c1
650 nmdc:mga09592_124039_c1
651 nmdc:mga09592_207468_c1
652 nmdc:mga09592_8853_c1
653 nmdc:mga08y16_11001_c1
654 nmdc:mga08y16_20064_c1
655 nmdc:mga08y16_368780_c1
656 nmdc:mga08y16_763_c1
657 nmdc:mga08y16_96691_c1
658 nmdc:mga0n895_142405_c1
659 nmdc:mga0n895_226860_c1
660 nmdc:mga0n895_555_c1
661 nmdc:mga0rr50_12347_c1
662 nmdc:mga0rr50_13_c1
663 nmdc:mga0rr50_225412_c1
664 nmdc:mga0rr50_227246_c1
665 nmdc:mga0rr50_355914_c1
666 nmdc:mga0rr50_70481_c1
667 nmdc:mga08x19_97_c1
668 nmdc:mga0a205_123201_c1
669 nmdc:mga0a205_44599_c1
670 nmdc:mga0a205_463802_c1
671 nmdc:mga0a205_61004_c1
672 nmdc:mga0a205_80042_c1
673 Ga0495595_0050339
674 Ga0500646_0010727

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06283

ThuA

Trehalose utilisation

76

309

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.7747 26 273
4pxy-assembly1.cif.gz_A crystal structure of a putative thua-like protein (bacuni_01602) from bacteroides uniformis atcc 8492 at 1.50 a resolution 0.7401 26 273
4e5v-assembly2.cif.gz_B crystal structure of a putative thua-like protein (parmer_02418) from parabacteroides merdae atcc 43184 at 1.75 a resolution 0.696 37 289
5xb7-assembly2.cif.gz_F gh42 alpha-l-arabinopyranosidase from bifidobacterium animalis subsp. lactis bl-04 0.6699 37 276
5t11-assembly1.cif.gz_J pelc l103m dodecamer from paraburkholderia phytofirmans, space group c2 0.6645 37 78
ID Description Score Start End Superfamily
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7967 26 273 3.40.50.880
4pxyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.7602 26 273 3.40.50.880
af_Q9VDS9_1_73_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7059 39 79 3.40.50.450
af_I1LRI7_119_456_3.40.630.10 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7037 37 80 3.40.630.10
4e5vA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.6803 37 289 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A2V5WWS4-F1-model_v4 ThuA domain-containing protein 0.9716 117 284
AF-A0A832G9U0-F1-model_v4 ThuA domain-containing protein 0.964 102 276
AF-A0A2V5XVZ3-F1-model_v4 ThuA domain-containing protein 0.9625 140 286
AF-A0A3N5ZG97-F1-model_v4 ThuA domain-containing protein 0.9623 102 283
AF-A0A7X2PHR8-F1-model_v4 ThuA domain-containing protein 0.9577 157 286

Map