F412961

General Info

Members Datasets Scaffolds Average Seq Length
337 152 674 276

Family's Representative Sequence

Representative Sequence 3300005439|Ga0070711_100395213|Ga0070711_1003952132
Length 284
Sequence MKLVIKFAGALLEDQATVQPLSQQVAALAKQGHEILVVHGGGRVFTTTLKRLGIESRFVAGLRVTDRETRDVAVMVFAGLLNKQLAAAISLAGAPAVGISAADAQCFRAEPFVHNEVQGSLGFVGYLTGVNTELLAAFWREGIVPVAACLGLGSDGELYNINADHMAAACAEYIQADHLIYLTDVNGVLAGEKILSGVSCDEIETLVQKKIISGGMVLKLEAAKRALEGGVRGVHIVGGALPESLLAVVRAAESAANNFTDNIPGTRVLREPIAIGVPAARSAA

Samples

Sample ID Description Type Environment
1 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
2 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
3 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
4 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
5 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
10 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
11 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
12 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
13 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
14 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
15 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
16 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
17 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
18 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
19 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
20 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
25 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
28 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
29 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
30 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
31 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
32 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
33 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
34 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
35 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
36 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
37 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
40 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
41 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
59 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
63 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
64 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
65 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
66 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
67 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
68 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
69 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
70 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
71 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
72 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
73 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
74 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
75 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
76 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
77 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
78 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
79 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
80 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
81 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
82 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
85 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
86 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
87 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
92 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
93 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
96 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
97 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
98 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
99 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
100 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
101 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
102 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
103 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
104 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
105 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
106 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
107 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
108 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
109 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
110 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
111 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
112 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
113 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
114 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
115 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
116 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
117 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
118 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
119 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
120 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
121 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
122 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
123 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
124 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
125 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
126 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
127 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
128 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
131 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
132 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
133 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
148 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
149 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
150 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
151 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
152 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.11
Metatranscriptomes 0.89
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.97
Rhizosphere 96.14
Stem 0
Stem Tuber 0
Unclassified 13.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070711_100395213 3300005439 Bacteria 1121
2 Ga0068868_100342649 3300005338 Bacteria 1278
3 Ga0070709_10020114 3300005434 Unclassified 3869
4 Ga0070709_10025388 3300005434 Bacteria 3501
5 Ga0070709_10115364 3300005434 Bacteria 1811
6 Ga0070709_10143885 3300005434 Bacteria 1641
7 Ga0070709_10258989 3300005434 Unclassified 1256
8 Ga0070714_100609673 3300005435 Unclassified 1049
9 Ga0070713_100012860 3300005436 Bacteria 6157
10 Ga0070711_100018249 3300005439 Bacteria 4476
11 Ga0070711_100059877 3300005439 Bacteria 2645
12 Ga0070711_100239940 3300005439 Bacteria 1417
13 Ga0070711_100276850 3300005439 Bacteria 1326
14 Ga0070705_100002179 3300005440 Bacteria 9947
15 Ga0070694_100008779 3300005444 Bacteria 6192
16 Ga0070708_100020640 3300005445 Bacteria 5560
17 Ga0070708_100021802 3300005445 Bacteria 5424
18 Ga0070708_100097275 3300005445 Unclassified 2691
19 Ga0070708_100104669 3300005445 Bacteria 2595
20 Ga0070708_100193182 3300005445 Bacteria 1904
21 Ga0070708_100241162 3300005445 Bacteria 1697
22 Ga0068867_100262265 3300005459 Bacteria 1409
23 Ga0070706_100004548 3300005467 Bacteria 13342
24 Ga0070706_100084115 3300005467 Bacteria 2948
25 Ga0070707_100000588 3300005468 Bacteria 36572
26 Ga0070707_100013280 3300005468 Bacteria 7703
27 Ga0070707_100044441 3300005468 Unclassified 4253
28 Ga0070707_100050095 3300005468 Bacteria 4003
29 Ga0070707_100061326 3300005468 Bacteria 3607
30 Ga0070707_100193354 3300005468 Bacteria 1984
31 Ga0070707_100291950 3300005468 Unclassified 1584
32 Ga0070707_100369237 3300005468 Bacteria 1394
33 Ga0070698_100001273 3300005471 Bacteria 28147
34 Ga0070698_100022939 3300005471 Bacteria 6526
35 Ga0070698_100032855 3300005471 Bacteria 5374
36 Ga0070698_100052213 3300005471 Bacteria 4160
37 Ga0070699_100077297 3300005518 Unclassified 2897
38 Ga0070699_100159702 3300005518 Bacteria 1995
39 Ga0070697_100000776 3300005536 Bacteria 23935
40 Ga0070697_100027109 3300005536 Bacteria 4582
41 Ga0070697_100172064 3300005536 Bacteria 1833
42 Ga0070686_100178475 3300005544 Bacteria 1507
43 Ga0070693_100000238 3300005547 Bacteria 25712
44 Ga0070665_100002678 3300005548 Bacteria 19354
45 Ga0070704_100377039 3300005549 Unclassified 1204
46 Ga0068863_100004876 3300005841 Bacteria 13217
47 Ga0068858_100026995 3300005842 Bacteria 5334
48 Ga0068860_100208606 3300005843 Bacteria 1895
49 Ga0070717_10102117 3300006028 Unclassified 2436
50 Ga0070716_100000610 3300006173 Bacteria 15125
51 Ga0070716_100052041 3300006173 Bacteria 2331
52 Ga0070712_100031106 3300006175 Bacteria 3593
53 Ga0097621_100004124 3300006237 Bacteria 10075
54 Ga0075434_100071421 3300006871 Unclassified 3463
55 Ga0068865_100298781 3300006881 Bacteria 1288
56 Ga0068865_100510482 3300006881 Bacteria 1004
57 Ga0075436_100000533 3300006914 Bacteria 24780
58 Ga0075436_100028589 3300006914 Bacteria 3835
59 Ga0075436_100083295 3300006914 Bacteria 2219
60 Ga0075435_100011449 3300007076 Bacteria 6528
61 Ga0075435_100059317 3300007076 Bacteria 3102
62 Ga0075435_100211398 3300007076 Bacteria 1646
63 Ga0075435_100261801 3300007076 Bacteria 1474
64 Ga0099794_10001843 3300007265 Bacteria 7581
65 Ga0099794_10005581 3300007265 Bacteria 5056
66 Ga0099794_10007477 3300007265 Bacteria 4492
67 Ga0099794_10053312 3300007265 Bacteria 1950
68 Ga0099794_10063983 3300007265 Bacteria 1791
69 Ga0099794_10065618 3300007265 Bacteria 1770
70 Ga0099794_10066862 3300007265 Bacteria 1754
71 Ga0099794_10072859 3300007265 Bacteria 1685
72 Ga0099794_10107803 3300007265 Bacteria 1394
73 Ga0099794_10182979 3300007265 Bacteria 1070
74 Ga0099795_10003256 3300007788 Bacteria 3995
75 Ga0105240_10024692 3300009093 Bacteria 7917
76 Ga0105240_10043822 3300009093 Bacteria 5690
77 Ga0105245_10614593 3300009098 Bacteria 1114
78 Ga0105247_10011839 3300009101 Bacteria 5245
79 Ga0105243_10539449 3300009148 Unclassified 1112
80 Ga0105248_10029093 3300009177 Bacteria 6159
81 Ga0099796_10003426 3300010159 Bacteria 3677
82 Ga0157378_10000458 3300013297 Bacteria 38993
83 Ga0157378_10001382 3300013297 Bacteria 21800
84 Ga0157378_10003982 3300013297 Bacteria 13053
85 Ga0157379_10107329 3300014968 Bacteria 2507
86 Ga0157379_10183948 3300014968 Bacteria 1888
87 Ga0157376_10000005 3300014969 Bacteria 443695
88 Ga0157376_10001871 3300014969 Bacteria 14037
89 Ga0207692_10133962 3300025898 Bacteria 1402
90 Ga0207710_10014224 3300025900 Bacteria 3353
91 Ga0207685_10060171 3300025905 Bacteria 1501
92 Ga0207699_10012592 3300025906 Bacteria 4306
93 Ga0207699_10030060 3300025906 Bacteria 3036
94 Ga0207699_10092456 3300025906 Bacteria 1902
95 Ga0207684_10181398 3300025910 Bacteria 1815
96 Ga0207695_10099310 3300025913 Unclassified 2909
97 Ga0207693_10019137 3300025915 Bacteria 5449
98 Ga0207693_10093924 3300025915 Bacteria 2351
99 Ga0207693_10308726 3300025915 Unclassified 1239
100 Ga0207663_10030157 3300025916 Bacteria 3195
101 Ga0207663_10059312 3300025916 Unclassified 2420
102 Ga0207663_10059596 3300025916 Bacteria 2416
103 Ga0207646_10000122 3300025922 Bacteria 105908
104 Ga0207646_10000983 3300025922 Bacteria 36619
105 Ga0207646_10002654 3300025922 Bacteria 20972
106 Ga0207646_10048067 3300025922 Bacteria 3825
107 Ga0207646_10056009 3300025922 Bacteria 3525
108 Ga0207646_10136724 3300025922 Bacteria 2207
109 Ga0207646_10190965 3300025922 Unclassified 1850
110 Ga0207646_10226448 3300025922 Unclassified 1689
111 Ga0207700_10005799 3300025928 Bacteria 7418
112 Ga0207700_10029281 3300025928 Bacteria 3884
113 Ga0207700_10108386 3300025928 Bacteria 2230
114 Ga0207664_10331026 3300025929 Unclassified 1345
115 Ga0207704_10083896 3300025938 Bacteria 2069
116 Ga0207665_10000034 3300025939 Bacteria 88735
117 Ga0207665_10003682 3300025939 Bacteria 10234
118 Ga0207665_10030842 3300025939 Bacteria 3545
119 Ga0207665_10039928 3300025939 Bacteria 3130
120 Ga0207689_10220337 3300025942 Bacteria 1568
121 Ga0207677_10304919 3300026023 Bacteria 1317
122 Ga0207641_10006955 3300026088 Bacteria 9469
123 Ga0209179_1028942 3300027512 Bacteria 1125
124 Ga0209588_1003440 3300027671 Bacteria 4391
125 Ga0209588_1015948 3300027671 Bacteria 2315
126 Ga0209588_1021179 3300027671 Bacteria 2040
127 Ga0209588_1039687 3300027671 Bacteria 1518
128 Ga0209588_1060746 3300027671 Unclassified 1222
129 Ga0268266_10000416 3300028379 Bacteria 64671
130 Ga0265326_10038928 3300028558 Unclassified 1351
131 Ga0265318_10000151 3300028577 Bacteria 62611
132 Ga0265338_10041806 3300028800 Bacteria 4282
133 Ga0265338_10181690 3300028800 Unclassified 1603
134 Ga0265760_10000016 3300031090 Bacteria 89697
135 Ga0265760_10016742 3300031090 Unclassified 2105
136 Ga0265760_10063327 3300031090 Bacteria 1126
137 Ga0265330_10063838 3300031235 Bacteria 1600
138 Ga0265332_10011263 3300031238 Unclassified 3977
139 Ga0265328_10006536 3300031239 Bacteria 4919
140 Ga0265320_10000105 3300031240 Bacteria 72088
141 Ga0265320_10147036 3300031240 Bacteria 1065
142 Ga0265325_10030835 3300031241 Bacteria 2874
143 Ga0265325_10039524 3300031241 Unclassified 2484
144 Ga0265329_10000054 3300031242 Bacteria 49499
145 Ga0265329_10038541 3300031242 Bacteria 1537
146 Ga0265340_10000230 3300031247 Bacteria 28747
147 Ga0265340_10119271 3300031247 Bacteria 1215
148 Ga0265331_10000189 3300031250 Bacteria 75772
149 Ga0265331_10002335 3300031250 Bacteria 12894
150 Ga0265316_10005454 3300031344 Bacteria 12352
151 Ga0265316_10021159 3300031344 Bacteria 5518
152 Ga0265313_10011242 3300031595 Bacteria 5578
153 Ga0265314_10003781 3300031711 Bacteria 14465
154 Ga0265314_10065413 3300031711 Bacteria 2456
155 Ga0265342_10000382 3300031712 Bacteria 49009
156 Ga0316212_1000843 3300033547 Unclassified 3981
157 Ga0316212_1005687 3300033547 Unclassified 1810
158 Ga0373926_0002562 3300035083 Bacteria 5775
159 Ga0373926_0004026 3300035083 Bacteria 4798
160 Ga0373934_0001428 3300035086 Bacteria 8747
161 Ga0373934_0145177 3300035086 Bacteria 971
162 Ga0373940_0013864 3300035088 Bacteria 1958
163 Ga0373954_0001767 3300035118 Bacteria 8883
164 Ga0373954_0002259 3300035118 Bacteria 8024
165 Ga0373954_0041468 3300035118 Bacteria 2146
166 Ga0373954_0127918 3300035118 Bacteria 1235
167 Ga0373956_0004919 3300035119 Bacteria 5351
168 Ga0373956_0080829 3300035119 Bacteria 1491
169 Ga0373946_0004291 3300035171 Bacteria 5094
170 Ga0373955_0000433 3300035172 Bacteria 17685
171 Ga0373955_0000876 3300035172 Bacteria 12905
172 Ga0373924_0006329 3300035410 Bacteria 4238
173 Ga0373931_0028669 3300035691 Bacteria 2853
174 Ga0373931_0328214 3300035691 Unclassified 952
175 Ga0373935_0011557 3300035692 Bacteria 5300
176 Ga0373927_0012776 3300035695 Bacteria 5586
177 Ga0373927_0056448 3300035695 Bacteria 2539
178 Ga0373933_0000541 3300035724 Bacteria 23493
179 Ga0373933_0004022 3300035724 Bacteria 8105
180 Ga0373933_0031292 3300035724 Bacteria 3087
181 Ga0373933_0148722 3300035724 Bacteria 1482
182 Ga0373947_0012087 3300035725 Bacteria 4945
183 Ga0373937_0000001 3300036401 Bacteria 478903
184 Ga0373937_0000735 3300036401 Bacteria 28345
185 Ga0373937_0013568 3300036401 Bacteria 7178
186 Ga0373937_0225339 3300036401 Unclassified 1765
187 Ga0373925_0001733 3300037068 Bacteria 18312
188 Ga0373925_0084088 3300037068 Bacteria 2425
189 Ga0373925_0118290 3300037068 Bacteria 2055
190 Ga0373925_0229809 3300037068 Bacteria 1483
191 Ga0395900_0471628 3300037418 Bacteria 1209
192 Ga0436365_0231817 3300039437 Bacteria 4566
193 Ga0451577_0031810 3300042876 Bacteria 4759
194 Ga0451577_0124932 3300042876 Bacteria 2305
195 Ga0453683_0005685 3300044673 Bacteria 8662
196 Ga0453683_0018092 3300044673 Bacteria 4527
197 Ga0453683_0052711 3300044673 Bacteria 2546
198 Ga0453684_0005333 3300044712 Bacteria 25613
199 Ga0453684_0086578 3300044712 Bacteria 3887
200 Ga0451576_0006924 3300045051 Bacteria 13730
201 Ga0451576_0812636 3300045051 Unclassified 982
202 Ga0495592_0059704 3300046454 Bacteria 2807
203 Ga0495603_0103884 3300046455 Unclassified 1658
204 Ga0495629_0056114 3300046459 Bacteria 2754
205 Ga0495651_0000163 3300046462 Bacteria 48965
206 Ga0495651_0001261 3300046462 Bacteria 19615
207 Ga0495651_0008562 3300046462 Bacteria 7840
208 Ga0495651_0015315 3300046462 Bacteria 5928
209 Ga0495651_0019827 3300046462 Bacteria 5213
210 Ga0495653_0041708 3300046463 Unclassified 3581
211 Ga0495653_0041995 3300046463 Bacteria 3566
212 Ga0495653_0052765 3300046463 Bacteria 3115
213 Ga0495653_0186453 3300046463 Bacteria 1419
214 Ga0495580_0004157 3300046472 Bacteria 12173
215 Ga0495580_0011919 3300046472 Bacteria 6699
216 Ga0495580_0033170 3300046472 Bacteria 3721
217 Ga0495580_0066403 3300046472 Bacteria 2525
218 Ga0495580_0078669 3300046472 Bacteria 2300
219 Ga0495580_0162413 3300046472 Bacteria 1546
220 Ga0495580_0176882 3300046472 Bacteria 1474
221 Ga0495582_0017532 3300046473 Bacteria 3918
222 Ga0495582_0018270 3300046473 Unclassified 3836
223 Ga0495582_0042336 3300046473 Bacteria 2508
224 Ga0495639_0055713 3300046475 Unclassified 1803
225 Ga0495662_0018285 3300046476 Bacteria 3392
226 Ga0495594_0007011 3300046499 Bacteria 5793
227 Ga0495608_0019066 3300046511 Bacteria 4728
228 Ga0495608_0020580 3300046511 Bacteria 4535
229 Ga0495608_0053595 3300046511 Bacteria 2668
230 Ga0495608_0125282 3300046511 Unclassified 1646
231 Ga0495618_0006387 3300046514 Bacteria 7157
232 Ga0495618_0026100 3300046514 Bacteria 3629
233 Ga0495618_0033409 3300046514 Unclassified 3226
234 Ga0495618_0226766 3300046514 Bacteria 1177
235 Ga0495628_0000057 3300046516 Bacteria 89094
236 Ga0495628_0013611 3300046516 Bacteria 6840
237 Ga0495628_0014892 3300046516 Bacteria 6503
238 Ga0495628_0062578 3300046516 Bacteria 2916
239 Ga0495628_0076628 3300046516 Bacteria 2602
240 Ga0495628_0122597 3300046516 Unclassified 1993
241 Ga0495628_0191535 3300046516 Unclassified 1544
242 Ga0495630_0000659 3300046517 Bacteria 24979
243 Ga0495630_0051366 3300046517 Bacteria 3086
244 Ga0495630_0057091 3300046517 Bacteria 2925
245 Ga0495630_0069275 3300046517 Bacteria 2653
246 Ga0495666_0004154 3300046526 Bacteria 7304
247 Ga0495652_0000290 3300046529 Bacteria 59672
248 Ga0495652_0050338 3300046529 Bacteria 3561
249 Ga0495652_0072900 3300046529 Bacteria 2861
250 Ga0495665_0011673 3300046531 Bacteria 4759
251 Ga0495665_0052077 3300046531 Bacteria 2167
252 Ga0495640_0007620 3300046533 Bacteria 8506
253 Ga0495640_0018090 3300046533 Bacteria 5236
254 Ga0495586_0003212 3300046535 Bacteria 8783
255 Ga0495586_0030580 3300046535 Bacteria 2881
256 Ga0495587_0000237 3300046536 Bacteria 40856
257 Ga0495587_0000760 3300046536 Bacteria 21498
258 Ga0495587_0019315 3300046536 Bacteria 4220
259 Ga0495587_0058057 3300046536 Bacteria 2274
260 Ga0495645_0003888 3300046543 Bacteria 10177
261 Ga0495645_0004081 3300046543 Bacteria 9973
262 Ga0495645_0025043 3300046543 Bacteria 4330
263 Ga0495645_0037461 3300046543 Bacteria 3535
264 Ga0495667_0006657 3300046559 Bacteria 7843
265 Ga0495667_0030564 3300046559 Bacteria 3619
266 Ga0495667_0066356 3300046559 Bacteria 2359
267 Ga0495667_0226125 3300046559 Unclassified 1193
268 Ga0495634_0006981 3300046642 Bacteria 8522
269 Ga0495635_0014452 3300046663 Bacteria 5523
270 Ga0495635_0031689 3300046663 Unclassified 3669
271 Ga0495657_0005697 3300046675 Bacteria 9811
272 Ga0495657_0034994 3300046675 Bacteria 3485
273 Ga0495599_0012932 3300046678 Bacteria 5152
274 Ga0495623_0010122 3300046679 Bacteria 6104
275 Ga0495623_0015368 3300046679 Bacteria 4946
276 Ga0495623_0080090 3300046679 Bacteria 2022
277 Ga0495646_0001709 3300046680 Bacteria 13161
278 Ga0495646_0061034 3300046680 Bacteria 2246
279 Ga0495658_0017785 3300046683 Bacteria 3680
280 Ga0495658_0138663 3300046683 Bacteria 1486
281 Ga0495613_0051718 3300046689 Bacteria 3027
282 Ga0495613_0059181 3300046689 Bacteria 2809
283 Ga0495624_0012460 3300046690 Bacteria 5809
284 Ga0495624_0040776 3300046690 Bacteria 2972
285 Ga0495624_0063399 3300046690 Bacteria 2310
286 Ga0495624_0190407 3300046690 Bacteria 1248
287 Ga0495600_0001410 3300046809 Bacteria 13264
288 Ga0495600_0010735 3300046809 Bacteria 5694
289 Ga0495581_0052149 3300047315 Bacteria 2362
290 Ga0495604_0002417 3300047317 Bacteria 14939
291 Ga0495604_0004065 3300047317 Bacteria 11629
292 Ga0495604_0006112 3300047317 Bacteria 9557
293 Ga0495604_0007783 3300047317 Bacteria 8485
294 Ga0495604_0466496 3300047317 Unclassified 823
295 Ga0495674_0007592 3300047319 Bacteria 10362
296 Ga0495674_0022731 3300047319 Bacteria 5780
297 Ga0495674_0095727 3300047319 Bacteria 2531
298 Ga0495674_0210505 3300047319 Bacteria 1610
299 Ga0495674_0232058 3300047319 Bacteria 1523
300 Ga0495676_0054517 3300047321 Bacteria 3178
301 Ga0495680_0000089 3300047322 Bacteria 82003
302 Ga0495680_0005218 3300047322 Bacteria 12264
303 Ga0495680_0031671 3300047322 Bacteria 4300
304 Ga0495680_0050991 3300047322 Bacteria 3234
305 Ga0495675_0000011 3300047444 Bacteria 152733
306 Ga0495675_0004735 3300047444 Bacteria 8261
307 Ga0495675_0097139 3300047444 Bacteria 1846
308 Ga0495684_0000531 3300047471 Bacteria 30929
309 Ga0495684_0002425 3300047471 Bacteria 14852
310 Ga0495684_0003730 3300047471 Bacteria 11877
311 Ga0495593_0023344 3300047673 Bacteria 3438
312 Ga0495593_0111455 3300047673 Unclassified 1397
313 Ga0495602_0000583 3300048088 Bacteria 34067
314 Ga0495602_0001700 3300048088 Bacteria 21889
315 Ga0495602_0009596 3300048088 Bacteria 10061
316 Ga0495602_0021503 3300048088 Bacteria 6347
317 Ga0495614_0022252 3300048089 Bacteria 2736
318 Ga0495614_0038420 3300048089 Bacteria 2054
319 Ga0496100_0054731 3300048903 Unclassified 2604
320 Ga0496102_0002266 3300048905 Bacteria 16457
321 Ga0496104_0058212 3300048907 Unclassified 3658
322 Ga0496104_0738694 3300048907 Bacteria 891
323 Ga0496105_0096758 3300048908 Bacteria 2438
324 Ga0496106_0086138 3300048909 Unclassified 2419
325 Ga0496112_0023955 3300048915 Bacteria 5841
326 Ga0496115_0001844 3300048918 Bacteria 15158
327 Ga0496115_0049707 3300048918 Bacteria 3357
328 Ga0496115_0512393 3300048918 Unclassified 963
329 nmdc:mga0n895_50047_c1 3300050512 Bacteria 4096
330 nmdc:mga0rr50_16575_c1 3300050513 Bacteria 4899
331 nmdc:mga0rr50_206593_c1 3300050513 Bacteria 1616
332 nmdc:mga08x19_387_c1 3300050514 Bacteria 30954
333 nmdc:mga08x19_437_c1 3300050514 Bacteria 28606
334 Ga0495601_0007504 3300053077 Bacteria 6398
335 Ga0495612_0009620 3300053078 Bacteria 3914
336 Ga0495619_0037790 3300053085 Bacteria 3149
337 Ga0495619_0452989 3300053085 Unclassified 884
338 Ga0070711_100395213
339 Ga0068868_100342649
340 Ga0070709_10020114
341 Ga0070709_10025388
342 Ga0070709_10115364
343 Ga0070709_10143885
344 Ga0070709_10258989
345 Ga0070714_100609673
346 Ga0070713_100012860
347 Ga0070711_100018249
348 Ga0070711_100059877
349 Ga0070711_100239940
350 Ga0070711_100276850
351 Ga0070705_100002179
352 Ga0070694_100008779
353 Ga0070708_100020640
354 Ga0070708_100021802
355 Ga0070708_100097275
356 Ga0070708_100104669
357 Ga0070708_100193182
358 Ga0070708_100241162
359 Ga0068867_100262265
360 Ga0070706_100004548
361 Ga0070706_100084115
362 Ga0070707_100000588
363 Ga0070707_100013280
364 Ga0070707_100044441
365 Ga0070707_100050095
366 Ga0070707_100061326
367 Ga0070707_100193354
368 Ga0070707_100291950
369 Ga0070707_100369237
370 Ga0070698_100001273
371 Ga0070698_100022939
372 Ga0070698_100032855
373 Ga0070698_100052213
374 Ga0070699_100077297
375 Ga0070699_100159702
376 Ga0070697_100000776
377 Ga0070697_100027109
378 Ga0070697_100172064
379 Ga0070686_100178475
380 Ga0070693_100000238
381 Ga0070665_100002678
382 Ga0070704_100377039
383 Ga0068863_100004876
384 Ga0068858_100026995
385 Ga0068860_100208606
386 Ga0070717_10102117
387 Ga0070716_100000610
388 Ga0070716_100052041
389 Ga0070712_100031106
390 Ga0097621_100004124
391 Ga0075434_100071421
392 Ga0068865_100298781
393 Ga0068865_100510482
394 Ga0075436_100000533
395 Ga0075436_100028589
396 Ga0075436_100083295
397 Ga0075435_100011449
398 Ga0075435_100059317
399 Ga0075435_100211398
400 Ga0075435_100261801
401 Ga0099794_10001843
402 Ga0099794_10005581
403 Ga0099794_10007477
404 Ga0099794_10053312
405 Ga0099794_10063983
406 Ga0099794_10065618
407 Ga0099794_10066862
408 Ga0099794_10072859
409 Ga0099794_10107803
410 Ga0099794_10182979
411 Ga0099795_10003256
412 Ga0105240_10024692
413 Ga0105240_10043822
414 Ga0105245_10614593
415 Ga0105247_10011839
416 Ga0105243_10539449
417 Ga0105248_10029093
418 Ga0099796_10003426
419 Ga0157378_10000458
420 Ga0157378_10001382
421 Ga0157378_10003982
422 Ga0157379_10107329
423 Ga0157379_10183948
424 Ga0157376_10000005
425 Ga0157376_10001871
426 Ga0207692_10133962
427 Ga0207710_10014224
428 Ga0207685_10060171
429 Ga0207699_10012592
430 Ga0207699_10030060
431 Ga0207699_10092456
432 Ga0207684_10181398
433 Ga0207695_10099310
434 Ga0207693_10019137
435 Ga0207693_10093924
436 Ga0207693_10308726
437 Ga0207663_10030157
438 Ga0207663_10059312
439 Ga0207663_10059596
440 Ga0207646_10000122
441 Ga0207646_10000983
442 Ga0207646_10002654
443 Ga0207646_10048067
444 Ga0207646_10056009
445 Ga0207646_10136724
446 Ga0207646_10190965
447 Ga0207646_10226448
448 Ga0207700_10005799
449 Ga0207700_10029281
450 Ga0207700_10108386
451 Ga0207664_10331026
452 Ga0207704_10083896
453 Ga0207665_10000034
454 Ga0207665_10003682
455 Ga0207665_10030842
456 Ga0207665_10039928
457 Ga0207689_10220337
458 Ga0207677_10304919
459 Ga0207641_10006955
460 Ga0209179_1028942
461 Ga0209588_1003440
462 Ga0209588_1015948
463 Ga0209588_1021179
464 Ga0209588_1039687
465 Ga0209588_1060746
466 Ga0268266_10000416
467 Ga0265326_10038928
468 Ga0265318_10000151
469 Ga0265338_10041806
470 Ga0265338_10181690
471 Ga0265760_10000016
472 Ga0265760_10016742
473 Ga0265760_10063327
474 Ga0265330_10063838
475 Ga0265332_10011263
476 Ga0265328_10006536
477 Ga0265320_10000105
478 Ga0265320_10147036
479 Ga0265325_10030835
480 Ga0265325_10039524
481 Ga0265329_10000054
482 Ga0265329_10038541
483 Ga0265340_10000230
484 Ga0265340_10119271
485 Ga0265331_10000189
486 Ga0265331_10002335
487 Ga0265316_10005454
488 Ga0265316_10021159
489 Ga0265313_10011242
490 Ga0265314_10003781
491 Ga0265314_10065413
492 Ga0265342_10000382
493 Ga0316212_1000843
494 Ga0316212_1005687
495 Ga0373926_0002562
496 Ga0373926_0004026
497 Ga0373934_0001428
498 Ga0373934_0145177
499 Ga0373940_0013864
500 Ga0373954_0001767
501 Ga0373954_0002259
502 Ga0373954_0041468
503 Ga0373954_0127918
504 Ga0373956_0004919
505 Ga0373956_0080829
506 Ga0373946_0004291
507 Ga0373955_0000433
508 Ga0373955_0000876
509 Ga0373924_0006329
510 Ga0373931_0028669
511 Ga0373931_0328214
512 Ga0373935_0011557
513 Ga0373927_0012776
514 Ga0373927_0056448
515 Ga0373933_0000541
516 Ga0373933_0004022
517 Ga0373933_0031292
518 Ga0373933_0148722
519 Ga0373947_0012087
520 Ga0373937_0000001
521 Ga0373937_0000735
522 Ga0373937_0013568
523 Ga0373937_0225339
524 Ga0373925_0001733
525 Ga0373925_0084088
526 Ga0373925_0118290
527 Ga0373925_0229809
528 Ga0395900_0471628
529 Ga0436365_0231817
530 Ga0451577_0031810
531 Ga0451577_0124932
532 Ga0453683_0005685
533 Ga0453683_0018092
534 Ga0453683_0052711
535 Ga0453684_0005333
536 Ga0453684_0086578
537 Ga0451576_0006924
538 Ga0451576_0812636
539 Ga0495592_0059704
540 Ga0495603_0103884
541 Ga0495629_0056114
542 Ga0495651_0000163
543 Ga0495651_0001261
544 Ga0495651_0008562
545 Ga0495651_0015315
546 Ga0495651_0019827
547 Ga0495653_0041708
548 Ga0495653_0041995
549 Ga0495653_0052765
550 Ga0495653_0186453
551 Ga0495580_0004157
552 Ga0495580_0011919
553 Ga0495580_0033170
554 Ga0495580_0066403
555 Ga0495580_0078669
556 Ga0495580_0162413
557 Ga0495580_0176882
558 Ga0495582_0017532
559 Ga0495582_0018270
560 Ga0495582_0042336
561 Ga0495639_0055713
562 Ga0495662_0018285
563 Ga0495594_0007011
564 Ga0495608_0019066
565 Ga0495608_0020580
566 Ga0495608_0053595
567 Ga0495608_0125282
568 Ga0495618_0006387
569 Ga0495618_0026100
570 Ga0495618_0033409
571 Ga0495618_0226766
572 Ga0495628_0000057
573 Ga0495628_0013611
574 Ga0495628_0014892
575 Ga0495628_0062578
576 Ga0495628_0076628
577 Ga0495628_0122597
578 Ga0495628_0191535
579 Ga0495630_0000659
580 Ga0495630_0051366
581 Ga0495630_0057091
582 Ga0495630_0069275
583 Ga0495666_0004154
584 Ga0495652_0000290
585 Ga0495652_0050338
586 Ga0495652_0072900
587 Ga0495665_0011673
588 Ga0495665_0052077
589 Ga0495640_0007620
590 Ga0495640_0018090
591 Ga0495586_0003212
592 Ga0495586_0030580
593 Ga0495587_0000237
594 Ga0495587_0000760
595 Ga0495587_0019315
596 Ga0495587_0058057
597 Ga0495645_0003888
598 Ga0495645_0004081
599 Ga0495645_0025043
600 Ga0495645_0037461
601 Ga0495667_0006657
602 Ga0495667_0030564
603 Ga0495667_0066356
604 Ga0495667_0226125
605 Ga0495634_0006981
606 Ga0495635_0014452
607 Ga0495635_0031689
608 Ga0495657_0005697
609 Ga0495657_0034994
610 Ga0495599_0012932
611 Ga0495623_0010122
612 Ga0495623_0015368
613 Ga0495623_0080090
614 Ga0495646_0001709
615 Ga0495646_0061034
616 Ga0495658_0017785
617 Ga0495658_0138663
618 Ga0495613_0051718
619 Ga0495613_0059181
620 Ga0495624_0012460
621 Ga0495624_0040776
622 Ga0495624_0063399
623 Ga0495624_0190407
624 Ga0495600_0001410
625 Ga0495600_0010735
626 Ga0495581_0052149
627 Ga0495604_0002417
628 Ga0495604_0004065
629 Ga0495604_0006112
630 Ga0495604_0007783
631 Ga0495604_0466496
632 Ga0495674_0007592
633 Ga0495674_0022731
634 Ga0495674_0095727
635 Ga0495674_0210505
636 Ga0495674_0232058
637 Ga0495676_0054517
638 Ga0495680_0000089
639 Ga0495680_0005218
640 Ga0495680_0031671
641 Ga0495680_0050991
642 Ga0495675_0000011
643 Ga0495675_0004735
644 Ga0495675_0097139
645 Ga0495684_0000531
646 Ga0495684_0002425
647 Ga0495684_0003730
648 Ga0495593_0023344
649 Ga0495593_0111455
650 Ga0495602_0000583
651 Ga0495602_0001700
652 Ga0495602_0009596
653 Ga0495602_0021503
654 Ga0495614_0022252
655 Ga0495614_0038420
656 Ga0496100_0054731
657 Ga0496102_0002266
658 Ga0496104_0058212
659 Ga0496104_0738694
660 Ga0496105_0096758
661 Ga0496106_0086138
662 Ga0496112_0023955
663 Ga0496115_0001844
664 Ga0496115_0049707
665 Ga0496115_0512393
666 nmdc:mga0n895_50047_c1
667 nmdc:mga0rr50_16575_c1
668 nmdc:mga0rr50_206593_c1
669 nmdc:mga08x19_387_c1
670 nmdc:mga08x19_437_c1
671 Ga0495601_0007504
672 Ga0495612_0009620
673 Ga0495619_0037790
674 Ga0495619_0452989

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00696

AA_kinase

Amino acid kinase family

1

238

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2buf-assembly2.cif.gz_I arginine feed-back inhibitable acetylglutamate kinase 0.939 2 269
2rd5-assembly1.cif.gz_B structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana 0.9357 2 269
2buf-assembly1.cif.gz_E arginine feed-back inhibitable acetylglutamate kinase 0.9335 2 271
2buf-assembly2.cif.gz_J arginine feed-back inhibitable acetylglutamate kinase 0.9225 2 269
2v5h-assembly1.cif.gz_D controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 0.916 2 271
ID Description Score Start End Superfamily
af_Q2G1H6_1_252_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.93 2 269 3.40.1160.10
af_Q2G1H6_1_252_3.40.1160.10 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9194 2 269 3.40.1160.10
2v5hF00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9171 2 271 3.40.1160.10
3l86A00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9156 2 271 3.40.1160.10
3l86A00 Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like 0.9012 2 271 3.40.1160.10
ID Description Score Start End GO Terms
AF-A0A529SS59-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9775 2 93 GO:0003991
GO:0006526
AF-A0A2V8XNJ9-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9684 1 155 GO:0003991
GO:0006526
AF-A0A2V8MCZ5-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9671 2 99 GO:0003991
GO:0006526
AF-A0A2E2N1K9-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9668 2 105 GO:0003991
GO:0006526
AF-A0A2V8WF30-F1-model_v4 acetylglutamate kinase (EC 2.7.2.8) 0.9635 1 124 GO:0003991
GO:0006526

Map