F412961
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 337 | 152 | 674 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300005439|Ga0070711_100395213|Ga0070711_1003952132 |
| Length | 284 |
| Sequence | MKLVIKFAGALLEDQATVQPLSQQVAALAKQGHEILVVHGGGRVFTTTLKRLGIESRFVAGLRVTDRETRDVAVMVFAGLLNKQLAAAISLAGAPAVGISAADAQCFRAEPFVHNEVQGSLGFVGYLTGVNTELLAAFWREGIVPVAACLGLGSDGELYNINADHMAAACAEYIQADHLIYLTDVNGVLAGEKILSGVSCDEIETLVQKKIISGGMVLKLEAAKRALEGGVRGVHIVGGALPESLLAVVRAAESAANNFTDNIPGTRVLREPIAIGVPAARSAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 3 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 4 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 6 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 10 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 20 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 21 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 22 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 26 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 27 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 28 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 29 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 30 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 31 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 32 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 33 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 34 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 35 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 38 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 41 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 61 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 62 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 63 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 64 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 65 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 66 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 67 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 68 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 69 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 70 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 71 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 72 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 73 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 74 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 75 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 76 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 77 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 78 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 79 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 80 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 81 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 82 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 83 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 84 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 85 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 86 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 87 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 88 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 89 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 90 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 91 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 92 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 93 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 94 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 95 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 96 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 97 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 98 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 99 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 100 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 101 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 102 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 103 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 104 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 105 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 106 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 107 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 108 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 109 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 141 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 142 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 143 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 144 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 147 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.11 |
| Metatranscriptomes | 0.89 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.97 |
| Rhizosphere | 96.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070711_100395213 | 3300005439 | Bacteria | 1121 |
| 2 | Ga0068868_100342649 | 3300005338 | Bacteria | 1278 |
| 3 | Ga0070709_10020114 | 3300005434 | Unclassified | 3869 |
| 4 | Ga0070709_10025388 | 3300005434 | Bacteria | 3501 |
| 5 | Ga0070709_10115364 | 3300005434 | Bacteria | 1811 |
| 6 | Ga0070709_10143885 | 3300005434 | Bacteria | 1641 |
| 7 | Ga0070709_10258989 | 3300005434 | Unclassified | 1256 |
| 8 | Ga0070714_100609673 | 3300005435 | Unclassified | 1049 |
| 9 | Ga0070713_100012860 | 3300005436 | Bacteria | 6157 |
| 10 | Ga0070711_100018249 | 3300005439 | Bacteria | 4476 |
| 11 | Ga0070711_100059877 | 3300005439 | Bacteria | 2645 |
| 12 | Ga0070711_100239940 | 3300005439 | Bacteria | 1417 |
| 13 | Ga0070711_100276850 | 3300005439 | Bacteria | 1326 |
| 14 | Ga0070705_100002179 | 3300005440 | Bacteria | 9947 |
| 15 | Ga0070694_100008779 | 3300005444 | Bacteria | 6192 |
| 16 | Ga0070708_100020640 | 3300005445 | Bacteria | 5560 |
| 17 | Ga0070708_100021802 | 3300005445 | Bacteria | 5424 |
| 18 | Ga0070708_100097275 | 3300005445 | Unclassified | 2691 |
| 19 | Ga0070708_100104669 | 3300005445 | Bacteria | 2595 |
| 20 | Ga0070708_100193182 | 3300005445 | Bacteria | 1904 |
| 21 | Ga0070708_100241162 | 3300005445 | Bacteria | 1697 |
| 22 | Ga0068867_100262265 | 3300005459 | Bacteria | 1409 |
| 23 | Ga0070706_100004548 | 3300005467 | Bacteria | 13342 |
| 24 | Ga0070706_100084115 | 3300005467 | Bacteria | 2948 |
| 25 | Ga0070707_100000588 | 3300005468 | Bacteria | 36572 |
| 26 | Ga0070707_100013280 | 3300005468 | Bacteria | 7703 |
| 27 | Ga0070707_100044441 | 3300005468 | Unclassified | 4253 |
| 28 | Ga0070707_100050095 | 3300005468 | Bacteria | 4003 |
| 29 | Ga0070707_100061326 | 3300005468 | Bacteria | 3607 |
| 30 | Ga0070707_100193354 | 3300005468 | Bacteria | 1984 |
| 31 | Ga0070707_100291950 | 3300005468 | Unclassified | 1584 |
| 32 | Ga0070707_100369237 | 3300005468 | Bacteria | 1394 |
| 33 | Ga0070698_100001273 | 3300005471 | Bacteria | 28147 |
| 34 | Ga0070698_100022939 | 3300005471 | Bacteria | 6526 |
| 35 | Ga0070698_100032855 | 3300005471 | Bacteria | 5374 |
| 36 | Ga0070698_100052213 | 3300005471 | Bacteria | 4160 |
| 37 | Ga0070699_100077297 | 3300005518 | Unclassified | 2897 |
| 38 | Ga0070699_100159702 | 3300005518 | Bacteria | 1995 |
| 39 | Ga0070697_100000776 | 3300005536 | Bacteria | 23935 |
| 40 | Ga0070697_100027109 | 3300005536 | Bacteria | 4582 |
| 41 | Ga0070697_100172064 | 3300005536 | Bacteria | 1833 |
| 42 | Ga0070686_100178475 | 3300005544 | Bacteria | 1507 |
| 43 | Ga0070693_100000238 | 3300005547 | Bacteria | 25712 |
| 44 | Ga0070665_100002678 | 3300005548 | Bacteria | 19354 |
| 45 | Ga0070704_100377039 | 3300005549 | Unclassified | 1204 |
| 46 | Ga0068863_100004876 | 3300005841 | Bacteria | 13217 |
| 47 | Ga0068858_100026995 | 3300005842 | Bacteria | 5334 |
| 48 | Ga0068860_100208606 | 3300005843 | Bacteria | 1895 |
| 49 | Ga0070717_10102117 | 3300006028 | Unclassified | 2436 |
| 50 | Ga0070716_100000610 | 3300006173 | Bacteria | 15125 |
| 51 | Ga0070716_100052041 | 3300006173 | Bacteria | 2331 |
| 52 | Ga0070712_100031106 | 3300006175 | Bacteria | 3593 |
| 53 | Ga0097621_100004124 | 3300006237 | Bacteria | 10075 |
| 54 | Ga0075434_100071421 | 3300006871 | Unclassified | 3463 |
| 55 | Ga0068865_100298781 | 3300006881 | Bacteria | 1288 |
| 56 | Ga0068865_100510482 | 3300006881 | Bacteria | 1004 |
| 57 | Ga0075436_100000533 | 3300006914 | Bacteria | 24780 |
| 58 | Ga0075436_100028589 | 3300006914 | Bacteria | 3835 |
| 59 | Ga0075436_100083295 | 3300006914 | Bacteria | 2219 |
| 60 | Ga0075435_100011449 | 3300007076 | Bacteria | 6528 |
| 61 | Ga0075435_100059317 | 3300007076 | Bacteria | 3102 |
| 62 | Ga0075435_100211398 | 3300007076 | Bacteria | 1646 |
| 63 | Ga0075435_100261801 | 3300007076 | Bacteria | 1474 |
| 64 | Ga0099794_10001843 | 3300007265 | Bacteria | 7581 |
| 65 | Ga0099794_10005581 | 3300007265 | Bacteria | 5056 |
| 66 | Ga0099794_10007477 | 3300007265 | Bacteria | 4492 |
| 67 | Ga0099794_10053312 | 3300007265 | Bacteria | 1950 |
| 68 | Ga0099794_10063983 | 3300007265 | Bacteria | 1791 |
| 69 | Ga0099794_10065618 | 3300007265 | Bacteria | 1770 |
| 70 | Ga0099794_10066862 | 3300007265 | Bacteria | 1754 |
| 71 | Ga0099794_10072859 | 3300007265 | Bacteria | 1685 |
| 72 | Ga0099794_10107803 | 3300007265 | Bacteria | 1394 |
| 73 | Ga0099794_10182979 | 3300007265 | Bacteria | 1070 |
| 74 | Ga0099795_10003256 | 3300007788 | Bacteria | 3995 |
| 75 | Ga0105240_10024692 | 3300009093 | Bacteria | 7917 |
| 76 | Ga0105240_10043822 | 3300009093 | Bacteria | 5690 |
| 77 | Ga0105245_10614593 | 3300009098 | Bacteria | 1114 |
| 78 | Ga0105247_10011839 | 3300009101 | Bacteria | 5245 |
| 79 | Ga0105243_10539449 | 3300009148 | Unclassified | 1112 |
| 80 | Ga0105248_10029093 | 3300009177 | Bacteria | 6159 |
| 81 | Ga0099796_10003426 | 3300010159 | Bacteria | 3677 |
| 82 | Ga0157378_10000458 | 3300013297 | Bacteria | 38993 |
| 83 | Ga0157378_10001382 | 3300013297 | Bacteria | 21800 |
| 84 | Ga0157378_10003982 | 3300013297 | Bacteria | 13053 |
| 85 | Ga0157379_10107329 | 3300014968 | Bacteria | 2507 |
| 86 | Ga0157379_10183948 | 3300014968 | Bacteria | 1888 |
| 87 | Ga0157376_10000005 | 3300014969 | Bacteria | 443695 |
| 88 | Ga0157376_10001871 | 3300014969 | Bacteria | 14037 |
| 89 | Ga0207692_10133962 | 3300025898 | Bacteria | 1402 |
| 90 | Ga0207710_10014224 | 3300025900 | Bacteria | 3353 |
| 91 | Ga0207685_10060171 | 3300025905 | Bacteria | 1501 |
| 92 | Ga0207699_10012592 | 3300025906 | Bacteria | 4306 |
| 93 | Ga0207699_10030060 | 3300025906 | Bacteria | 3036 |
| 94 | Ga0207699_10092456 | 3300025906 | Bacteria | 1902 |
| 95 | Ga0207684_10181398 | 3300025910 | Bacteria | 1815 |
| 96 | Ga0207695_10099310 | 3300025913 | Unclassified | 2909 |
| 97 | Ga0207693_10019137 | 3300025915 | Bacteria | 5449 |
| 98 | Ga0207693_10093924 | 3300025915 | Bacteria | 2351 |
| 99 | Ga0207693_10308726 | 3300025915 | Unclassified | 1239 |
| 100 | Ga0207663_10030157 | 3300025916 | Bacteria | 3195 |
| 101 | Ga0207663_10059312 | 3300025916 | Unclassified | 2420 |
| 102 | Ga0207663_10059596 | 3300025916 | Bacteria | 2416 |
| 103 | Ga0207646_10000122 | 3300025922 | Bacteria | 105908 |
| 104 | Ga0207646_10000983 | 3300025922 | Bacteria | 36619 |
| 105 | Ga0207646_10002654 | 3300025922 | Bacteria | 20972 |
| 106 | Ga0207646_10048067 | 3300025922 | Bacteria | 3825 |
| 107 | Ga0207646_10056009 | 3300025922 | Bacteria | 3525 |
| 108 | Ga0207646_10136724 | 3300025922 | Bacteria | 2207 |
| 109 | Ga0207646_10190965 | 3300025922 | Unclassified | 1850 |
| 110 | Ga0207646_10226448 | 3300025922 | Unclassified | 1689 |
| 111 | Ga0207700_10005799 | 3300025928 | Bacteria | 7418 |
| 112 | Ga0207700_10029281 | 3300025928 | Bacteria | 3884 |
| 113 | Ga0207700_10108386 | 3300025928 | Bacteria | 2230 |
| 114 | Ga0207664_10331026 | 3300025929 | Unclassified | 1345 |
| 115 | Ga0207704_10083896 | 3300025938 | Bacteria | 2069 |
| 116 | Ga0207665_10000034 | 3300025939 | Bacteria | 88735 |
| 117 | Ga0207665_10003682 | 3300025939 | Bacteria | 10234 |
| 118 | Ga0207665_10030842 | 3300025939 | Bacteria | 3545 |
| 119 | Ga0207665_10039928 | 3300025939 | Bacteria | 3130 |
| 120 | Ga0207689_10220337 | 3300025942 | Bacteria | 1568 |
| 121 | Ga0207677_10304919 | 3300026023 | Bacteria | 1317 |
| 122 | Ga0207641_10006955 | 3300026088 | Bacteria | 9469 |
| 123 | Ga0209179_1028942 | 3300027512 | Bacteria | 1125 |
| 124 | Ga0209588_1003440 | 3300027671 | Bacteria | 4391 |
| 125 | Ga0209588_1015948 | 3300027671 | Bacteria | 2315 |
| 126 | Ga0209588_1021179 | 3300027671 | Bacteria | 2040 |
| 127 | Ga0209588_1039687 | 3300027671 | Bacteria | 1518 |
| 128 | Ga0209588_1060746 | 3300027671 | Unclassified | 1222 |
| 129 | Ga0268266_10000416 | 3300028379 | Bacteria | 64671 |
| 130 | Ga0265326_10038928 | 3300028558 | Unclassified | 1351 |
| 131 | Ga0265318_10000151 | 3300028577 | Bacteria | 62611 |
| 132 | Ga0265338_10041806 | 3300028800 | Bacteria | 4282 |
| 133 | Ga0265338_10181690 | 3300028800 | Unclassified | 1603 |
| 134 | Ga0265760_10000016 | 3300031090 | Bacteria | 89697 |
| 135 | Ga0265760_10016742 | 3300031090 | Unclassified | 2105 |
| 136 | Ga0265760_10063327 | 3300031090 | Bacteria | 1126 |
| 137 | Ga0265330_10063838 | 3300031235 | Bacteria | 1600 |
| 138 | Ga0265332_10011263 | 3300031238 | Unclassified | 3977 |
| 139 | Ga0265328_10006536 | 3300031239 | Bacteria | 4919 |
| 140 | Ga0265320_10000105 | 3300031240 | Bacteria | 72088 |
| 141 | Ga0265320_10147036 | 3300031240 | Bacteria | 1065 |
| 142 | Ga0265325_10030835 | 3300031241 | Bacteria | 2874 |
| 143 | Ga0265325_10039524 | 3300031241 | Unclassified | 2484 |
| 144 | Ga0265329_10000054 | 3300031242 | Bacteria | 49499 |
| 145 | Ga0265329_10038541 | 3300031242 | Bacteria | 1537 |
| 146 | Ga0265340_10000230 | 3300031247 | Bacteria | 28747 |
| 147 | Ga0265340_10119271 | 3300031247 | Bacteria | 1215 |
| 148 | Ga0265331_10000189 | 3300031250 | Bacteria | 75772 |
| 149 | Ga0265331_10002335 | 3300031250 | Bacteria | 12894 |
| 150 | Ga0265316_10005454 | 3300031344 | Bacteria | 12352 |
| 151 | Ga0265316_10021159 | 3300031344 | Bacteria | 5518 |
| 152 | Ga0265313_10011242 | 3300031595 | Bacteria | 5578 |
| 153 | Ga0265314_10003781 | 3300031711 | Bacteria | 14465 |
| 154 | Ga0265314_10065413 | 3300031711 | Bacteria | 2456 |
| 155 | Ga0265342_10000382 | 3300031712 | Bacteria | 49009 |
| 156 | Ga0316212_1000843 | 3300033547 | Unclassified | 3981 |
| 157 | Ga0316212_1005687 | 3300033547 | Unclassified | 1810 |
| 158 | Ga0373926_0002562 | 3300035083 | Bacteria | 5775 |
| 159 | Ga0373926_0004026 | 3300035083 | Bacteria | 4798 |
| 160 | Ga0373934_0001428 | 3300035086 | Bacteria | 8747 |
| 161 | Ga0373934_0145177 | 3300035086 | Bacteria | 971 |
| 162 | Ga0373940_0013864 | 3300035088 | Bacteria | 1958 |
| 163 | Ga0373954_0001767 | 3300035118 | Bacteria | 8883 |
| 164 | Ga0373954_0002259 | 3300035118 | Bacteria | 8024 |
| 165 | Ga0373954_0041468 | 3300035118 | Bacteria | 2146 |
| 166 | Ga0373954_0127918 | 3300035118 | Bacteria | 1235 |
| 167 | Ga0373956_0004919 | 3300035119 | Bacteria | 5351 |
| 168 | Ga0373956_0080829 | 3300035119 | Bacteria | 1491 |
| 169 | Ga0373946_0004291 | 3300035171 | Bacteria | 5094 |
| 170 | Ga0373955_0000433 | 3300035172 | Bacteria | 17685 |
| 171 | Ga0373955_0000876 | 3300035172 | Bacteria | 12905 |
| 172 | Ga0373924_0006329 | 3300035410 | Bacteria | 4238 |
| 173 | Ga0373931_0028669 | 3300035691 | Bacteria | 2853 |
| 174 | Ga0373931_0328214 | 3300035691 | Unclassified | 952 |
| 175 | Ga0373935_0011557 | 3300035692 | Bacteria | 5300 |
| 176 | Ga0373927_0012776 | 3300035695 | Bacteria | 5586 |
| 177 | Ga0373927_0056448 | 3300035695 | Bacteria | 2539 |
| 178 | Ga0373933_0000541 | 3300035724 | Bacteria | 23493 |
| 179 | Ga0373933_0004022 | 3300035724 | Bacteria | 8105 |
| 180 | Ga0373933_0031292 | 3300035724 | Bacteria | 3087 |
| 181 | Ga0373933_0148722 | 3300035724 | Bacteria | 1482 |
| 182 | Ga0373947_0012087 | 3300035725 | Bacteria | 4945 |
| 183 | Ga0373937_0000001 | 3300036401 | Bacteria | 478903 |
| 184 | Ga0373937_0000735 | 3300036401 | Bacteria | 28345 |
| 185 | Ga0373937_0013568 | 3300036401 | Bacteria | 7178 |
| 186 | Ga0373937_0225339 | 3300036401 | Unclassified | 1765 |
| 187 | Ga0373925_0001733 | 3300037068 | Bacteria | 18312 |
| 188 | Ga0373925_0084088 | 3300037068 | Bacteria | 2425 |
| 189 | Ga0373925_0118290 | 3300037068 | Bacteria | 2055 |
| 190 | Ga0373925_0229809 | 3300037068 | Bacteria | 1483 |
| 191 | Ga0395900_0471628 | 3300037418 | Bacteria | 1209 |
| 192 | Ga0436365_0231817 | 3300039437 | Bacteria | 4566 |
| 193 | Ga0451577_0031810 | 3300042876 | Bacteria | 4759 |
| 194 | Ga0451577_0124932 | 3300042876 | Bacteria | 2305 |
| 195 | Ga0453683_0005685 | 3300044673 | Bacteria | 8662 |
| 196 | Ga0453683_0018092 | 3300044673 | Bacteria | 4527 |
| 197 | Ga0453683_0052711 | 3300044673 | Bacteria | 2546 |
| 198 | Ga0453684_0005333 | 3300044712 | Bacteria | 25613 |
| 199 | Ga0453684_0086578 | 3300044712 | Bacteria | 3887 |
| 200 | Ga0451576_0006924 | 3300045051 | Bacteria | 13730 |
| 201 | Ga0451576_0812636 | 3300045051 | Unclassified | 982 |
| 202 | Ga0495592_0059704 | 3300046454 | Bacteria | 2807 |
| 203 | Ga0495603_0103884 | 3300046455 | Unclassified | 1658 |
| 204 | Ga0495629_0056114 | 3300046459 | Bacteria | 2754 |
| 205 | Ga0495651_0000163 | 3300046462 | Bacteria | 48965 |
| 206 | Ga0495651_0001261 | 3300046462 | Bacteria | 19615 |
| 207 | Ga0495651_0008562 | 3300046462 | Bacteria | 7840 |
| 208 | Ga0495651_0015315 | 3300046462 | Bacteria | 5928 |
| 209 | Ga0495651_0019827 | 3300046462 | Bacteria | 5213 |
| 210 | Ga0495653_0041708 | 3300046463 | Unclassified | 3581 |
| 211 | Ga0495653_0041995 | 3300046463 | Bacteria | 3566 |
| 212 | Ga0495653_0052765 | 3300046463 | Bacteria | 3115 |
| 213 | Ga0495653_0186453 | 3300046463 | Bacteria | 1419 |
| 214 | Ga0495580_0004157 | 3300046472 | Bacteria | 12173 |
| 215 | Ga0495580_0011919 | 3300046472 | Bacteria | 6699 |
| 216 | Ga0495580_0033170 | 3300046472 | Bacteria | 3721 |
| 217 | Ga0495580_0066403 | 3300046472 | Bacteria | 2525 |
| 218 | Ga0495580_0078669 | 3300046472 | Bacteria | 2300 |
| 219 | Ga0495580_0162413 | 3300046472 | Bacteria | 1546 |
| 220 | Ga0495580_0176882 | 3300046472 | Bacteria | 1474 |
| 221 | Ga0495582_0017532 | 3300046473 | Bacteria | 3918 |
| 222 | Ga0495582_0018270 | 3300046473 | Unclassified | 3836 |
| 223 | Ga0495582_0042336 | 3300046473 | Bacteria | 2508 |
| 224 | Ga0495639_0055713 | 3300046475 | Unclassified | 1803 |
| 225 | Ga0495662_0018285 | 3300046476 | Bacteria | 3392 |
| 226 | Ga0495594_0007011 | 3300046499 | Bacteria | 5793 |
| 227 | Ga0495608_0019066 | 3300046511 | Bacteria | 4728 |
| 228 | Ga0495608_0020580 | 3300046511 | Bacteria | 4535 |
| 229 | Ga0495608_0053595 | 3300046511 | Bacteria | 2668 |
| 230 | Ga0495608_0125282 | 3300046511 | Unclassified | 1646 |
| 231 | Ga0495618_0006387 | 3300046514 | Bacteria | 7157 |
| 232 | Ga0495618_0026100 | 3300046514 | Bacteria | 3629 |
| 233 | Ga0495618_0033409 | 3300046514 | Unclassified | 3226 |
| 234 | Ga0495618_0226766 | 3300046514 | Bacteria | 1177 |
| 235 | Ga0495628_0000057 | 3300046516 | Bacteria | 89094 |
| 236 | Ga0495628_0013611 | 3300046516 | Bacteria | 6840 |
| 237 | Ga0495628_0014892 | 3300046516 | Bacteria | 6503 |
| 238 | Ga0495628_0062578 | 3300046516 | Bacteria | 2916 |
| 239 | Ga0495628_0076628 | 3300046516 | Bacteria | 2602 |
| 240 | Ga0495628_0122597 | 3300046516 | Unclassified | 1993 |
| 241 | Ga0495628_0191535 | 3300046516 | Unclassified | 1544 |
| 242 | Ga0495630_0000659 | 3300046517 | Bacteria | 24979 |
| 243 | Ga0495630_0051366 | 3300046517 | Bacteria | 3086 |
| 244 | Ga0495630_0057091 | 3300046517 | Bacteria | 2925 |
| 245 | Ga0495630_0069275 | 3300046517 | Bacteria | 2653 |
| 246 | Ga0495666_0004154 | 3300046526 | Bacteria | 7304 |
| 247 | Ga0495652_0000290 | 3300046529 | Bacteria | 59672 |
| 248 | Ga0495652_0050338 | 3300046529 | Bacteria | 3561 |
| 249 | Ga0495652_0072900 | 3300046529 | Bacteria | 2861 |
| 250 | Ga0495665_0011673 | 3300046531 | Bacteria | 4759 |
| 251 | Ga0495665_0052077 | 3300046531 | Bacteria | 2167 |
| 252 | Ga0495640_0007620 | 3300046533 | Bacteria | 8506 |
| 253 | Ga0495640_0018090 | 3300046533 | Bacteria | 5236 |
| 254 | Ga0495586_0003212 | 3300046535 | Bacteria | 8783 |
| 255 | Ga0495586_0030580 | 3300046535 | Bacteria | 2881 |
| 256 | Ga0495587_0000237 | 3300046536 | Bacteria | 40856 |
| 257 | Ga0495587_0000760 | 3300046536 | Bacteria | 21498 |
| 258 | Ga0495587_0019315 | 3300046536 | Bacteria | 4220 |
| 259 | Ga0495587_0058057 | 3300046536 | Bacteria | 2274 |
| 260 | Ga0495645_0003888 | 3300046543 | Bacteria | 10177 |
| 261 | Ga0495645_0004081 | 3300046543 | Bacteria | 9973 |
| 262 | Ga0495645_0025043 | 3300046543 | Bacteria | 4330 |
| 263 | Ga0495645_0037461 | 3300046543 | Bacteria | 3535 |
| 264 | Ga0495667_0006657 | 3300046559 | Bacteria | 7843 |
| 265 | Ga0495667_0030564 | 3300046559 | Bacteria | 3619 |
| 266 | Ga0495667_0066356 | 3300046559 | Bacteria | 2359 |
| 267 | Ga0495667_0226125 | 3300046559 | Unclassified | 1193 |
| 268 | Ga0495634_0006981 | 3300046642 | Bacteria | 8522 |
| 269 | Ga0495635_0014452 | 3300046663 | Bacteria | 5523 |
| 270 | Ga0495635_0031689 | 3300046663 | Unclassified | 3669 |
| 271 | Ga0495657_0005697 | 3300046675 | Bacteria | 9811 |
| 272 | Ga0495657_0034994 | 3300046675 | Bacteria | 3485 |
| 273 | Ga0495599_0012932 | 3300046678 | Bacteria | 5152 |
| 274 | Ga0495623_0010122 | 3300046679 | Bacteria | 6104 |
| 275 | Ga0495623_0015368 | 3300046679 | Bacteria | 4946 |
| 276 | Ga0495623_0080090 | 3300046679 | Bacteria | 2022 |
| 277 | Ga0495646_0001709 | 3300046680 | Bacteria | 13161 |
| 278 | Ga0495646_0061034 | 3300046680 | Bacteria | 2246 |
| 279 | Ga0495658_0017785 | 3300046683 | Bacteria | 3680 |
| 280 | Ga0495658_0138663 | 3300046683 | Bacteria | 1486 |
| 281 | Ga0495613_0051718 | 3300046689 | Bacteria | 3027 |
| 282 | Ga0495613_0059181 | 3300046689 | Bacteria | 2809 |
| 283 | Ga0495624_0012460 | 3300046690 | Bacteria | 5809 |
| 284 | Ga0495624_0040776 | 3300046690 | Bacteria | 2972 |
| 285 | Ga0495624_0063399 | 3300046690 | Bacteria | 2310 |
| 286 | Ga0495624_0190407 | 3300046690 | Bacteria | 1248 |
| 287 | Ga0495600_0001410 | 3300046809 | Bacteria | 13264 |
| 288 | Ga0495600_0010735 | 3300046809 | Bacteria | 5694 |
| 289 | Ga0495581_0052149 | 3300047315 | Bacteria | 2362 |
| 290 | Ga0495604_0002417 | 3300047317 | Bacteria | 14939 |
| 291 | Ga0495604_0004065 | 3300047317 | Bacteria | 11629 |
| 292 | Ga0495604_0006112 | 3300047317 | Bacteria | 9557 |
| 293 | Ga0495604_0007783 | 3300047317 | Bacteria | 8485 |
| 294 | Ga0495604_0466496 | 3300047317 | Unclassified | 823 |
| 295 | Ga0495674_0007592 | 3300047319 | Bacteria | 10362 |
| 296 | Ga0495674_0022731 | 3300047319 | Bacteria | 5780 |
| 297 | Ga0495674_0095727 | 3300047319 | Bacteria | 2531 |
| 298 | Ga0495674_0210505 | 3300047319 | Bacteria | 1610 |
| 299 | Ga0495674_0232058 | 3300047319 | Bacteria | 1523 |
| 300 | Ga0495676_0054517 | 3300047321 | Bacteria | 3178 |
| 301 | Ga0495680_0000089 | 3300047322 | Bacteria | 82003 |
| 302 | Ga0495680_0005218 | 3300047322 | Bacteria | 12264 |
| 303 | Ga0495680_0031671 | 3300047322 | Bacteria | 4300 |
| 304 | Ga0495680_0050991 | 3300047322 | Bacteria | 3234 |
| 305 | Ga0495675_0000011 | 3300047444 | Bacteria | 152733 |
| 306 | Ga0495675_0004735 | 3300047444 | Bacteria | 8261 |
| 307 | Ga0495675_0097139 | 3300047444 | Bacteria | 1846 |
| 308 | Ga0495684_0000531 | 3300047471 | Bacteria | 30929 |
| 309 | Ga0495684_0002425 | 3300047471 | Bacteria | 14852 |
| 310 | Ga0495684_0003730 | 3300047471 | Bacteria | 11877 |
| 311 | Ga0495593_0023344 | 3300047673 | Bacteria | 3438 |
| 312 | Ga0495593_0111455 | 3300047673 | Unclassified | 1397 |
| 313 | Ga0495602_0000583 | 3300048088 | Bacteria | 34067 |
| 314 | Ga0495602_0001700 | 3300048088 | Bacteria | 21889 |
| 315 | Ga0495602_0009596 | 3300048088 | Bacteria | 10061 |
| 316 | Ga0495602_0021503 | 3300048088 | Bacteria | 6347 |
| 317 | Ga0495614_0022252 | 3300048089 | Bacteria | 2736 |
| 318 | Ga0495614_0038420 | 3300048089 | Bacteria | 2054 |
| 319 | Ga0496100_0054731 | 3300048903 | Unclassified | 2604 |
| 320 | Ga0496102_0002266 | 3300048905 | Bacteria | 16457 |
| 321 | Ga0496104_0058212 | 3300048907 | Unclassified | 3658 |
| 322 | Ga0496104_0738694 | 3300048907 | Bacteria | 891 |
| 323 | Ga0496105_0096758 | 3300048908 | Bacteria | 2438 |
| 324 | Ga0496106_0086138 | 3300048909 | Unclassified | 2419 |
| 325 | Ga0496112_0023955 | 3300048915 | Bacteria | 5841 |
| 326 | Ga0496115_0001844 | 3300048918 | Bacteria | 15158 |
| 327 | Ga0496115_0049707 | 3300048918 | Bacteria | 3357 |
| 328 | Ga0496115_0512393 | 3300048918 | Unclassified | 963 |
| 329 | nmdc:mga0n895_50047_c1 | 3300050512 | Bacteria | 4096 |
| 330 | nmdc:mga0rr50_16575_c1 | 3300050513 | Bacteria | 4899 |
| 331 | nmdc:mga0rr50_206593_c1 | 3300050513 | Bacteria | 1616 |
| 332 | nmdc:mga08x19_387_c1 | 3300050514 | Bacteria | 30954 |
| 333 | nmdc:mga08x19_437_c1 | 3300050514 | Bacteria | 28606 |
| 334 | Ga0495601_0007504 | 3300053077 | Bacteria | 6398 |
| 335 | Ga0495612_0009620 | 3300053078 | Bacteria | 3914 |
| 336 | Ga0495619_0037790 | 3300053085 | Bacteria | 3149 |
| 337 | Ga0495619_0452989 | 3300053085 | Unclassified | 884 |
| 338 | Ga0070711_100395213 | |||
| 339 | Ga0068868_100342649 | |||
| 340 | Ga0070709_10020114 | |||
| 341 | Ga0070709_10025388 | |||
| 342 | Ga0070709_10115364 | |||
| 343 | Ga0070709_10143885 | |||
| 344 | Ga0070709_10258989 | |||
| 345 | Ga0070714_100609673 | |||
| 346 | Ga0070713_100012860 | |||
| 347 | Ga0070711_100018249 | |||
| 348 | Ga0070711_100059877 | |||
| 349 | Ga0070711_100239940 | |||
| 350 | Ga0070711_100276850 | |||
| 351 | Ga0070705_100002179 | |||
| 352 | Ga0070694_100008779 | |||
| 353 | Ga0070708_100020640 | |||
| 354 | Ga0070708_100021802 | |||
| 355 | Ga0070708_100097275 | |||
| 356 | Ga0070708_100104669 | |||
| 357 | Ga0070708_100193182 | |||
| 358 | Ga0070708_100241162 | |||
| 359 | Ga0068867_100262265 | |||
| 360 | Ga0070706_100004548 | |||
| 361 | Ga0070706_100084115 | |||
| 362 | Ga0070707_100000588 | |||
| 363 | Ga0070707_100013280 | |||
| 364 | Ga0070707_100044441 | |||
| 365 | Ga0070707_100050095 | |||
| 366 | Ga0070707_100061326 | |||
| 367 | Ga0070707_100193354 | |||
| 368 | Ga0070707_100291950 | |||
| 369 | Ga0070707_100369237 | |||
| 370 | Ga0070698_100001273 | |||
| 371 | Ga0070698_100022939 | |||
| 372 | Ga0070698_100032855 | |||
| 373 | Ga0070698_100052213 | |||
| 374 | Ga0070699_100077297 | |||
| 375 | Ga0070699_100159702 | |||
| 376 | Ga0070697_100000776 | |||
| 377 | Ga0070697_100027109 | |||
| 378 | Ga0070697_100172064 | |||
| 379 | Ga0070686_100178475 | |||
| 380 | Ga0070693_100000238 | |||
| 381 | Ga0070665_100002678 | |||
| 382 | Ga0070704_100377039 | |||
| 383 | Ga0068863_100004876 | |||
| 384 | Ga0068858_100026995 | |||
| 385 | Ga0068860_100208606 | |||
| 386 | Ga0070717_10102117 | |||
| 387 | Ga0070716_100000610 | |||
| 388 | Ga0070716_100052041 | |||
| 389 | Ga0070712_100031106 | |||
| 390 | Ga0097621_100004124 | |||
| 391 | Ga0075434_100071421 | |||
| 392 | Ga0068865_100298781 | |||
| 393 | Ga0068865_100510482 | |||
| 394 | Ga0075436_100000533 | |||
| 395 | Ga0075436_100028589 | |||
| 396 | Ga0075436_100083295 | |||
| 397 | Ga0075435_100011449 | |||
| 398 | Ga0075435_100059317 | |||
| 399 | Ga0075435_100211398 | |||
| 400 | Ga0075435_100261801 | |||
| 401 | Ga0099794_10001843 | |||
| 402 | Ga0099794_10005581 | |||
| 403 | Ga0099794_10007477 | |||
| 404 | Ga0099794_10053312 | |||
| 405 | Ga0099794_10063983 | |||
| 406 | Ga0099794_10065618 | |||
| 407 | Ga0099794_10066862 | |||
| 408 | Ga0099794_10072859 | |||
| 409 | Ga0099794_10107803 | |||
| 410 | Ga0099794_10182979 | |||
| 411 | Ga0099795_10003256 | |||
| 412 | Ga0105240_10024692 | |||
| 413 | Ga0105240_10043822 | |||
| 414 | Ga0105245_10614593 | |||
| 415 | Ga0105247_10011839 | |||
| 416 | Ga0105243_10539449 | |||
| 417 | Ga0105248_10029093 | |||
| 418 | Ga0099796_10003426 | |||
| 419 | Ga0157378_10000458 | |||
| 420 | Ga0157378_10001382 | |||
| 421 | Ga0157378_10003982 | |||
| 422 | Ga0157379_10107329 | |||
| 423 | Ga0157379_10183948 | |||
| 424 | Ga0157376_10000005 | |||
| 425 | Ga0157376_10001871 | |||
| 426 | Ga0207692_10133962 | |||
| 427 | Ga0207710_10014224 | |||
| 428 | Ga0207685_10060171 | |||
| 429 | Ga0207699_10012592 | |||
| 430 | Ga0207699_10030060 | |||
| 431 | Ga0207699_10092456 | |||
| 432 | Ga0207684_10181398 | |||
| 433 | Ga0207695_10099310 | |||
| 434 | Ga0207693_10019137 | |||
| 435 | Ga0207693_10093924 | |||
| 436 | Ga0207693_10308726 | |||
| 437 | Ga0207663_10030157 | |||
| 438 | Ga0207663_10059312 | |||
| 439 | Ga0207663_10059596 | |||
| 440 | Ga0207646_10000122 | |||
| 441 | Ga0207646_10000983 | |||
| 442 | Ga0207646_10002654 | |||
| 443 | Ga0207646_10048067 | |||
| 444 | Ga0207646_10056009 | |||
| 445 | Ga0207646_10136724 | |||
| 446 | Ga0207646_10190965 | |||
| 447 | Ga0207646_10226448 | |||
| 448 | Ga0207700_10005799 | |||
| 449 | Ga0207700_10029281 | |||
| 450 | Ga0207700_10108386 | |||
| 451 | Ga0207664_10331026 | |||
| 452 | Ga0207704_10083896 | |||
| 453 | Ga0207665_10000034 | |||
| 454 | Ga0207665_10003682 | |||
| 455 | Ga0207665_10030842 | |||
| 456 | Ga0207665_10039928 | |||
| 457 | Ga0207689_10220337 | |||
| 458 | Ga0207677_10304919 | |||
| 459 | Ga0207641_10006955 | |||
| 460 | Ga0209179_1028942 | |||
| 461 | Ga0209588_1003440 | |||
| 462 | Ga0209588_1015948 | |||
| 463 | Ga0209588_1021179 | |||
| 464 | Ga0209588_1039687 | |||
| 465 | Ga0209588_1060746 | |||
| 466 | Ga0268266_10000416 | |||
| 467 | Ga0265326_10038928 | |||
| 468 | Ga0265318_10000151 | |||
| 469 | Ga0265338_10041806 | |||
| 470 | Ga0265338_10181690 | |||
| 471 | Ga0265760_10000016 | |||
| 472 | Ga0265760_10016742 | |||
| 473 | Ga0265760_10063327 | |||
| 474 | Ga0265330_10063838 | |||
| 475 | Ga0265332_10011263 | |||
| 476 | Ga0265328_10006536 | |||
| 477 | Ga0265320_10000105 | |||
| 478 | Ga0265320_10147036 | |||
| 479 | Ga0265325_10030835 | |||
| 480 | Ga0265325_10039524 | |||
| 481 | Ga0265329_10000054 | |||
| 482 | Ga0265329_10038541 | |||
| 483 | Ga0265340_10000230 | |||
| 484 | Ga0265340_10119271 | |||
| 485 | Ga0265331_10000189 | |||
| 486 | Ga0265331_10002335 | |||
| 487 | Ga0265316_10005454 | |||
| 488 | Ga0265316_10021159 | |||
| 489 | Ga0265313_10011242 | |||
| 490 | Ga0265314_10003781 | |||
| 491 | Ga0265314_10065413 | |||
| 492 | Ga0265342_10000382 | |||
| 493 | Ga0316212_1000843 | |||
| 494 | Ga0316212_1005687 | |||
| 495 | Ga0373926_0002562 | |||
| 496 | Ga0373926_0004026 | |||
| 497 | Ga0373934_0001428 | |||
| 498 | Ga0373934_0145177 | |||
| 499 | Ga0373940_0013864 | |||
| 500 | Ga0373954_0001767 | |||
| 501 | Ga0373954_0002259 | |||
| 502 | Ga0373954_0041468 | |||
| 503 | Ga0373954_0127918 | |||
| 504 | Ga0373956_0004919 | |||
| 505 | Ga0373956_0080829 | |||
| 506 | Ga0373946_0004291 | |||
| 507 | Ga0373955_0000433 | |||
| 508 | Ga0373955_0000876 | |||
| 509 | Ga0373924_0006329 | |||
| 510 | Ga0373931_0028669 | |||
| 511 | Ga0373931_0328214 | |||
| 512 | Ga0373935_0011557 | |||
| 513 | Ga0373927_0012776 | |||
| 514 | Ga0373927_0056448 | |||
| 515 | Ga0373933_0000541 | |||
| 516 | Ga0373933_0004022 | |||
| 517 | Ga0373933_0031292 | |||
| 518 | Ga0373933_0148722 | |||
| 519 | Ga0373947_0012087 | |||
| 520 | Ga0373937_0000001 | |||
| 521 | Ga0373937_0000735 | |||
| 522 | Ga0373937_0013568 | |||
| 523 | Ga0373937_0225339 | |||
| 524 | Ga0373925_0001733 | |||
| 525 | Ga0373925_0084088 | |||
| 526 | Ga0373925_0118290 | |||
| 527 | Ga0373925_0229809 | |||
| 528 | Ga0395900_0471628 | |||
| 529 | Ga0436365_0231817 | |||
| 530 | Ga0451577_0031810 | |||
| 531 | Ga0451577_0124932 | |||
| 532 | Ga0453683_0005685 | |||
| 533 | Ga0453683_0018092 | |||
| 534 | Ga0453683_0052711 | |||
| 535 | Ga0453684_0005333 | |||
| 536 | Ga0453684_0086578 | |||
| 537 | Ga0451576_0006924 | |||
| 538 | Ga0451576_0812636 | |||
| 539 | Ga0495592_0059704 | |||
| 540 | Ga0495603_0103884 | |||
| 541 | Ga0495629_0056114 | |||
| 542 | Ga0495651_0000163 | |||
| 543 | Ga0495651_0001261 | |||
| 544 | Ga0495651_0008562 | |||
| 545 | Ga0495651_0015315 | |||
| 546 | Ga0495651_0019827 | |||
| 547 | Ga0495653_0041708 | |||
| 548 | Ga0495653_0041995 | |||
| 549 | Ga0495653_0052765 | |||
| 550 | Ga0495653_0186453 | |||
| 551 | Ga0495580_0004157 | |||
| 552 | Ga0495580_0011919 | |||
| 553 | Ga0495580_0033170 | |||
| 554 | Ga0495580_0066403 | |||
| 555 | Ga0495580_0078669 | |||
| 556 | Ga0495580_0162413 | |||
| 557 | Ga0495580_0176882 | |||
| 558 | Ga0495582_0017532 | |||
| 559 | Ga0495582_0018270 | |||
| 560 | Ga0495582_0042336 | |||
| 561 | Ga0495639_0055713 | |||
| 562 | Ga0495662_0018285 | |||
| 563 | Ga0495594_0007011 | |||
| 564 | Ga0495608_0019066 | |||
| 565 | Ga0495608_0020580 | |||
| 566 | Ga0495608_0053595 | |||
| 567 | Ga0495608_0125282 | |||
| 568 | Ga0495618_0006387 | |||
| 569 | Ga0495618_0026100 | |||
| 570 | Ga0495618_0033409 | |||
| 571 | Ga0495618_0226766 | |||
| 572 | Ga0495628_0000057 | |||
| 573 | Ga0495628_0013611 | |||
| 574 | Ga0495628_0014892 | |||
| 575 | Ga0495628_0062578 | |||
| 576 | Ga0495628_0076628 | |||
| 577 | Ga0495628_0122597 | |||
| 578 | Ga0495628_0191535 | |||
| 579 | Ga0495630_0000659 | |||
| 580 | Ga0495630_0051366 | |||
| 581 | Ga0495630_0057091 | |||
| 582 | Ga0495630_0069275 | |||
| 583 | Ga0495666_0004154 | |||
| 584 | Ga0495652_0000290 | |||
| 585 | Ga0495652_0050338 | |||
| 586 | Ga0495652_0072900 | |||
| 587 | Ga0495665_0011673 | |||
| 588 | Ga0495665_0052077 | |||
| 589 | Ga0495640_0007620 | |||
| 590 | Ga0495640_0018090 | |||
| 591 | Ga0495586_0003212 | |||
| 592 | Ga0495586_0030580 | |||
| 593 | Ga0495587_0000237 | |||
| 594 | Ga0495587_0000760 | |||
| 595 | Ga0495587_0019315 | |||
| 596 | Ga0495587_0058057 | |||
| 597 | Ga0495645_0003888 | |||
| 598 | Ga0495645_0004081 | |||
| 599 | Ga0495645_0025043 | |||
| 600 | Ga0495645_0037461 | |||
| 601 | Ga0495667_0006657 | |||
| 602 | Ga0495667_0030564 | |||
| 603 | Ga0495667_0066356 | |||
| 604 | Ga0495667_0226125 | |||
| 605 | Ga0495634_0006981 | |||
| 606 | Ga0495635_0014452 | |||
| 607 | Ga0495635_0031689 | |||
| 608 | Ga0495657_0005697 | |||
| 609 | Ga0495657_0034994 | |||
| 610 | Ga0495599_0012932 | |||
| 611 | Ga0495623_0010122 | |||
| 612 | Ga0495623_0015368 | |||
| 613 | Ga0495623_0080090 | |||
| 614 | Ga0495646_0001709 | |||
| 615 | Ga0495646_0061034 | |||
| 616 | Ga0495658_0017785 | |||
| 617 | Ga0495658_0138663 | |||
| 618 | Ga0495613_0051718 | |||
| 619 | Ga0495613_0059181 | |||
| 620 | Ga0495624_0012460 | |||
| 621 | Ga0495624_0040776 | |||
| 622 | Ga0495624_0063399 | |||
| 623 | Ga0495624_0190407 | |||
| 624 | Ga0495600_0001410 | |||
| 625 | Ga0495600_0010735 | |||
| 626 | Ga0495581_0052149 | |||
| 627 | Ga0495604_0002417 | |||
| 628 | Ga0495604_0004065 | |||
| 629 | Ga0495604_0006112 | |||
| 630 | Ga0495604_0007783 | |||
| 631 | Ga0495604_0466496 | |||
| 632 | Ga0495674_0007592 | |||
| 633 | Ga0495674_0022731 | |||
| 634 | Ga0495674_0095727 | |||
| 635 | Ga0495674_0210505 | |||
| 636 | Ga0495674_0232058 | |||
| 637 | Ga0495676_0054517 | |||
| 638 | Ga0495680_0000089 | |||
| 639 | Ga0495680_0005218 | |||
| 640 | Ga0495680_0031671 | |||
| 641 | Ga0495680_0050991 | |||
| 642 | Ga0495675_0000011 | |||
| 643 | Ga0495675_0004735 | |||
| 644 | Ga0495675_0097139 | |||
| 645 | Ga0495684_0000531 | |||
| 646 | Ga0495684_0002425 | |||
| 647 | Ga0495684_0003730 | |||
| 648 | Ga0495593_0023344 | |||
| 649 | Ga0495593_0111455 | |||
| 650 | Ga0495602_0000583 | |||
| 651 | Ga0495602_0001700 | |||
| 652 | Ga0495602_0009596 | |||
| 653 | Ga0495602_0021503 | |||
| 654 | Ga0495614_0022252 | |||
| 655 | Ga0495614_0038420 | |||
| 656 | Ga0496100_0054731 | |||
| 657 | Ga0496102_0002266 | |||
| 658 | Ga0496104_0058212 | |||
| 659 | Ga0496104_0738694 | |||
| 660 | Ga0496105_0096758 | |||
| 661 | Ga0496106_0086138 | |||
| 662 | Ga0496112_0023955 | |||
| 663 | Ga0496115_0001844 | |||
| 664 | Ga0496115_0049707 | |||
| 665 | Ga0496115_0512393 | |||
| 666 | nmdc:mga0n895_50047_c1 | |||
| 667 | nmdc:mga0rr50_16575_c1 | |||
| 668 | nmdc:mga0rr50_206593_c1 | |||
| 669 | nmdc:mga08x19_387_c1 | |||
| 670 | nmdc:mga08x19_437_c1 | |||
| 671 | Ga0495601_0007504 | |||
| 672 | Ga0495612_0009620 | |||
| 673 | Ga0495619_0037790 | |||
| 674 | Ga0495619_0452989 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2buf-assembly2.cif.gz_I | arginine feed-back inhibitable acetylglutamate kinase | 0.939 | 2 | 269 |
| 2rd5-assembly1.cif.gz_B | structural basis for the regulation of n-acetylglutamate kinase by pii in arabidopsis thaliana | 0.9357 | 2 | 269 |
| 2buf-assembly1.cif.gz_E | arginine feed-back inhibitable acetylglutamate kinase | 0.9335 | 2 | 271 |
| 2buf-assembly2.cif.gz_J | arginine feed-back inhibitable acetylglutamate kinase | 0.9225 | 2 | 269 |
| 2v5h-assembly1.cif.gz_D | controlling the storage of nitrogen as arginine: the complex of pii and acetylglutamate kinase from synechococcus elongatus pcc 7942 | 0.916 | 2 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G1H6_1_252_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.93 | 2 | 269 | 3.40.1160.10 |
| af_Q2G1H6_1_252_3.40.1160.10 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9194 | 2 | 269 | 3.40.1160.10 |
| 2v5hF00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9171 | 2 | 271 | 3.40.1160.10 |
| 3l86A00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9156 | 2 | 271 | 3.40.1160.10 |
| 3l86A00 | Alpha Beta;3-Layer(aba) Sandwich;Carbamate kinase;Acetylglutamate kinase-like | 0.9012 | 2 | 271 | 3.40.1160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529SS59-F1-model_v4 | acetylglutamate kinase (EC 2.7.2.8) | 0.9775 | 2 | 93 |
GO:0003991
GO:0006526 |
| AF-A0A2V8XNJ9-F1-model_v4 | acetylglutamate kinase (EC 2.7.2.8) | 0.9684 | 1 | 155 |
GO:0003991
GO:0006526 |
| AF-A0A2V8MCZ5-F1-model_v4 | acetylglutamate kinase (EC 2.7.2.8) | 0.9671 | 2 | 99 |
GO:0003991
GO:0006526 |
| AF-A0A2E2N1K9-F1-model_v4 | acetylglutamate kinase (EC 2.7.2.8) | 0.9668 | 2 | 105 |
GO:0003991
GO:0006526 |
| AF-A0A2V8WF30-F1-model_v4 | acetylglutamate kinase (EC 2.7.2.8) | 0.9635 | 1 | 124 |
GO:0003991
GO:0006526 |