F412921

General Info

Members Datasets Scaffolds Average Seq Length
337 177 674 113

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_10045649|Ga0070658_100456493
Length 106
Sequence VTSAPRPTGITLHRASHVLEVEFDSGQTFRLPCEYLRTHSPSAEVKRNVNIDEIVSVGNYGVLLKFDDGHQTGIFSWDTLHDLGTRQAENWKAYLDAMEAAGLSRG

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
118 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
121 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
129 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
130 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
131 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
132 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
133 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
134 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
135 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
136 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
137 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
138 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
142 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
143 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
144 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
145 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
146 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
161 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
162 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
163 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
173 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
174 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
175 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
176 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
177 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 5.64
Rhizosphere 90.8
Stem 0
Stem Tuber 0
Unclassified 5.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10045649 3300005327 Bacteria 3543
2 Ga0070658_10738159 3300005327 Bacteria 855
3 Ga0070676_10027404 3300005328 Bacteria 3231
4 Ga0070676_10267640 3300005328 Bacteria 1147
5 Ga0070690_100004513 3300005330 Bacteria 7741
6 Ga0070690_100395124 3300005330 Bacteria 1014
7 Ga0070690_100760371 3300005330 Unclassified 749
8 Ga0070670_100133139 3300005331 Bacteria 2147
9 Ga0070670_101746592 3300005331 Bacteria 573
10 Ga0070677_10022861 3300005333 Bacteria 2308
11 Ga0070677_10049279 3300005333 Bacteria 1696
12 Ga0068869_100075759 3300005334 Bacteria 2500
13 Ga0068869_100077983 3300005334 Bacteria 2466
14 Ga0068869_100241826 3300005334 Bacteria 1438
15 Ga0070682_100025164 3300005337 Bacteria 3550
16 Ga0070682_100230058 3300005337 Bacteria 1325
17 Ga0070682_100339278 3300005337 Bacteria 1116
18 Ga0070682_100708648 3300005337 Bacteria 808
19 Ga0070682_101246394 3300005337 Bacteria 629
20 Ga0068868_100388733 3300005338 Bacteria 1202
21 Ga0068868_100879248 3300005338 Bacteria 813
22 Ga0070689_100019917 3300005340 Bacteria 4969
23 Ga0070689_100305158 3300005340 Bacteria 1326
24 Ga0070691_10060331 3300005341 Bacteria 1823
25 Ga0070687_100040843 3300005343 Bacteria 2340
26 Ga0070687_100332300 3300005343 Bacteria 975
27 Ga0070687_100949794 3300005343 Bacteria 620
28 Ga0070661_100273953 3300005344 Bacteria 1308
29 Ga0070661_101146327 3300005344 Bacteria 649
30 Ga0070668_100040732 3300005347 Bacteria 3555
31 Ga0070668_100135714 3300005347 Bacteria 1979
32 Ga0070669_100195366 3300005353 Bacteria 1589
33 Ga0070669_100411710 3300005353 Bacteria 1108
34 Ga0070675_100010064 3300005354 Bacteria 7375
35 Ga0070675_100043602 3300005354 Bacteria 3667
36 Ga0070675_100089294 3300005354 Bacteria 2580
37 Ga0070671_100297446 3300005355 Bacteria 1374
38 Ga0070674_100478058 3300005356 Bacteria 1033
39 Ga0070673_100021022 3300005364 Bacteria 4721
40 Ga0070673_100021042 3300005364 Bacteria 4719
41 Ga0070673_100128845 3300005364 Bacteria 2120
42 Ga0070688_100121881 3300005365 Bacteria 1748
43 Ga0070688_100428443 3300005365 Bacteria 985
44 Ga0070659_100890141 3300005366 Bacteria 778
45 Ga0070667_100149939 3300005367 Bacteria 2048
46 Ga0070667_100553936 3300005367 Bacteria 1057
47 Ga0070667_101530912 3300005367 Unclassified 626
48 Ga0070701_10041906 3300005438 Bacteria 2334
49 Ga0070701_10134302 3300005438 Bacteria 1408
50 Ga0070705_100015579 3300005440 Bacteria 3935
51 Ga0070700_100146150 3300005441 Bacteria 1612
52 Ga0070700_100183610 3300005441 Bacteria 1457
53 Ga0070700_100322283 3300005441 Bacteria 1136
54 Ga0070694_100018874 3300005444 Bacteria 4382
55 Ga0070663_100078749 3300005455 Bacteria 2416
56 Ga0070663_100181649 3300005455 Bacteria 1632
57 Ga0070678_100014668 3300005456 Bacteria 4954
58 Ga0070678_100023225 3300005456 Bacteria 4128
59 Ga0070678_100066106 3300005456 Bacteria 2687
60 Ga0070678_100462286 3300005456 Bacteria 1113
61 Ga0070678_100926742 3300005456 Bacteria 797
62 Ga0070678_101946113 3300005456 Bacteria 556
63 Ga0070662_100717577 3300005457 Bacteria 846
64 Ga0068867_100101201 3300005459 Bacteria 2201
65 Ga0068867_100226988 3300005459 Bacteria 1508
66 Ga0068867_100660809 3300005459 Bacteria 918
67 Ga0068867_102202926 3300005459 Unclassified 523
68 Ga0070685_10180489 3300005466 Bacteria 1358
69 Ga0070685_11078909 3300005466 Bacteria 606
70 Ga0070698_100927252 3300005471 Bacteria 817
71 Ga0070672_100005094 3300005543 Bacteria 8668
72 Ga0070672_100035581 3300005543 Bacteria 3786
73 Ga0070672_100187944 3300005543 Bacteria 1723
74 Ga0070672_100194262 3300005543 Bacteria 1696
75 Ga0070686_100095554 3300005544 Bacteria 1997
76 Ga0070686_100570464 3300005544 Bacteria 888
77 Ga0070686_100732731 3300005544 Unclassified 791
78 Ga0070686_100830971 3300005544 Bacteria 747
79 Ga0070696_100024017 3300005546 Bacteria 4143
80 Ga0070696_100289063 3300005546 Bacteria 1252
81 Ga0070665_100030627 3300005548 Bacteria 5413
82 Ga0070665_100074552 3300005548 Bacteria 3399
83 Ga0070665_100156601 3300005548 Bacteria 2280
84 Ga0070665_100813206 3300005548 Bacteria 947
85 Ga0070665_102304035 3300005548 Bacteria 541
86 Ga0070664_100005240 3300005564 Bacteria 10406
87 Ga0070664_100546762 3300005564 Bacteria 1070
88 Ga0068857_100491670 3300005577 Bacteria 1151
89 Ga0070702_100110610 3300005615 Bacteria 1703
90 Ga0068859_100049603 3300005617 Bacteria 4216
91 Ga0068859_100863115 3300005617 Bacteria 991
92 Ga0068864_100074541 3300005618 Bacteria 2961
93 Ga0068864_100723931 3300005618 Bacteria 973
94 Ga0068866_10650972 3300005718 Bacteria 717
95 Ga0068861_100021265 3300005719 Bacteria 4662
96 Ga0068861_100040797 3300005719 Bacteria 3473
97 Ga0068861_100099334 3300005719 Bacteria 2312
98 Ga0068861_100112345 3300005719 Bacteria 2184
99 Ga0068861_100258429 3300005719 Bacteria 1490
100 Ga0068861_102056041 3300005719 Unclassified 570
101 Ga0068851_10669362 3300005834 Bacteria 637
102 Ga0068870_10013484 3300005840 Bacteria 3841
103 Ga0068870_10104710 3300005840 Bacteria 1606
104 Ga0068863_100113219 3300005841 Bacteria 2584
105 Ga0068863_100150979 3300005841 Bacteria 2223
106 Ga0068863_100335849 3300005841 Bacteria 1469
107 Ga0068863_100337021 3300005841 Bacteria 1467
108 Ga0068858_100177572 3300005842 Bacteria 2010
109 Ga0068858_100570127 3300005842 Bacteria 1097
110 Ga0068860_100041965 3300005843 Bacteria 4371
111 Ga0068862_100001728 3300005844 Bacteria 19748
112 Ga0068862_100855478 3300005844 Bacteria 891
113 Ga0081455_10005137 3300005937 Bacteria 14426
114 Ga0097621_100013851 3300006237 Bacteria 6020
115 Ga0097621_100524638 3300006237 Bacteria 1075
116 Ga0097621_101433779 3300006237 Unclassified 654
117 Ga0097621_101477560 3300006237 Bacteria 644
118 Ga0068871_100197933 3300006358 Bacteria 1734
119 Ga0068871_100438902 3300006358 Bacteria 1168
120 Ga0075428_101202798 3300006844 Bacteria 799
121 Ga0075431_100076115 3300006847 Bacteria 3463
122 Ga0075429_100551217 3300006880 Bacteria 1010
123 Ga0068865_100049973 3300006881 Bacteria 2886
124 Ga0068865_100429324 3300006881 Bacteria 1088
125 Ga0068865_100631457 3300006881 Bacteria 908
126 Ga0068865_101167223 3300006881 Unclassified 680
127 Ga0097620_100049603 3300006931 Bacteria 4216
128 Ga0097620_100862978 3300006931 Bacteria 991
129 Ga0111539_11080152 3300009094 Bacteria 933
130 Ga0105245_10852423 3300009098 Bacteria 951
131 Ga0114129_10004544 3300009147 Bacteria 19590
132 Ga0105243_10341383 3300009148 Bacteria 1372
133 Ga0105243_10488759 3300009148 Bacteria 1163
134 Ga0105243_11778397 3300009148 Bacteria 647
135 Ga0105243_12851200 3300009148 Unclassified 524
136 Ga0105242_10029647 3300009176 Bacteria 4363
137 Ga0105242_10380501 3300009176 Bacteria 1312
138 Ga0105248_10229085 3300009177 Bacteria 2092
139 Ga0105248_10672185 3300009177 Bacteria 1168
140 Ga0105238_11041425 3300009551 Bacteria 840
141 Ga0105249_10219512 3300009553 Bacteria 1870
142 Ga0157370_10632410 3300013104 Unclassified 979
143 Ga0157374_10384102 3300013296 Bacteria 1399
144 Ga0163162_11003092 3300013306 Unclassified 944
145 Ga0157375_10063559 3300013308 Bacteria 3673
146 Ga0157375_10348186 3300013308 Bacteria 1647
147 Ga0157375_10985169 3300013308 Bacteria 983
148 Ga0163163_10913253 3300014325 Bacteria 941
149 Ga0163163_10933098 3300014325 Bacteria 931
150 Ga0163163_11235030 3300014325 Bacteria 810
151 Ga0157380_10177910 3300014326 Bacteria 1866
152 Ga0157380_10220861 3300014326 Bacteria 1695
153 Ga0157380_10507079 3300014326 Bacteria 1173
154 Ga0157380_10876945 3300014326 Bacteria 921
155 Ga0157380_12356836 3300014326 Bacteria 597
156 Ga0157377_10395007 3300014745 Bacteria 940
157 Ga0157379_10024288 3300014968 Bacteria 5382
158 Ga0157379_10891551 3300014968 Bacteria 843
159 Ga0157376_10086759 3300014969 Bacteria 2699
160 Ga0157376_10218248 3300014969 Bacteria 1765
161 Ga0157376_10366727 3300014969 Bacteria 1383
162 Ga0163161_10315371 3300017792 Unclassified 1235
163 Ga0207697_10207405 3300025315 Bacteria 863
164 Ga0207697_10462028 3300025315 Bacteria 562
165 Ga0207656_10478703 3300025321 Bacteria 631
166 Ga0207682_10002678 3300025893 Bacteria 7935
167 Ga0207682_10004866 3300025893 Bacteria 5543
168 Ga0207642_10213077 3300025899 Bacteria 1075
169 Ga0207642_10595108 3300025899 Bacteria 688
170 Ga0207688_10107094 3300025901 Bacteria 1620
171 Ga0207645_10016848 3300025907 Bacteria 4830
172 Ga0207645_10301201 3300025907 Bacteria 1067
173 Ga0207643_10015216 3300025908 Bacteria 4186
174 Ga0207643_10025559 3300025908 Bacteria 3264
175 Ga0207643_10027179 3300025908 Bacteria 3171
176 Ga0207662_10062580 3300025918 Bacteria 2236
177 Ga0207662_10186779 3300025918 Bacteria 1336
178 Ga0207662_10206353 3300025918 Bacteria 1274
179 Ga0207649_11524773 3300025920 Bacteria 529
180 Ga0207681_10089702 3300025923 Bacteria 2192
181 Ga0207681_10122950 3300025923 Bacteria 1906
182 Ga0207681_10615914 3300025923 Bacteria 898
183 Ga0207694_10809102 3300025924 Bacteria 792
184 Ga0207650_10237401 3300025925 Bacteria 1472
185 Ga0207650_11714074 3300025925 Bacteria 532
186 Ga0207659_10029326 3300025926 Bacteria 3749
187 Ga0207659_10132773 3300025926 Bacteria 1924
188 Ga0207659_10135199 3300025926 Bacteria 1908
189 Ga0207659_10275148 3300025926 Bacteria 1375
190 Ga0207644_10538226 3300025931 Bacteria 966
191 Ga0207644_10564353 3300025931 Bacteria 943
192 Ga0207706_10450336 3300025933 Bacteria 1113
193 Ga0207706_10939822 3300025933 Bacteria 729
194 Ga0207686_10019724 3300025934 Bacteria 3841
195 Ga0207670_10010870 3300025936 Bacteria 5254
196 Ga0207670_11875618 3300025936 Bacteria 510
197 Ga0207669_10056469 3300025937 Bacteria 2384
198 Ga0207704_10111079 3300025938 Bacteria 1853
199 Ga0207704_10228463 3300025938 Bacteria 1382
200 Ga0207691_10006516 3300025940 Bacteria 11267
201 Ga0207691_10020864 3300025940 Bacteria 6191
202 Ga0207691_10032746 3300025940 Bacteria 4845
203 Ga0207691_10049421 3300025940 Bacteria 3853
204 Ga0207691_10110299 3300025940 Bacteria 2447
205 Ga0207689_10031231 3300025942 Bacteria 4436
206 Ga0207689_10123272 3300025942 Bacteria 2131
207 Ga0207689_10222317 3300025942 Bacteria 1560
208 Ga0207661_10469592 3300025944 Bacteria 1148
209 Ga0207679_11736997 3300025945 Bacteria 571
210 Ga0207651_10121119 3300025960 Bacteria 1984
211 Ga0207651_10178959 3300025960 Bacteria 1680
212 Ga0207651_10367833 3300025960 Bacteria 1215
213 Ga0207651_10536327 3300025960 Bacteria 1016
214 Ga0207712_10429944 3300025961 Bacteria 1116
215 Ga0207668_10061991 3300025972 Bacteria 2632
216 Ga0207668_10183020 3300025972 Bacteria 1654
217 Ga0207668_11346435 3300025972 Bacteria 643
218 Ga0207658_10070732 3300025986 Bacteria 2641
219 Ga0207658_11457062 3300025986 Unclassified 626
220 Ga0207677_11163382 3300026023 Bacteria 705
221 Ga0207703_10157409 3300026035 Bacteria 1987
222 Ga0207678_10103107 3300026067 Bacteria 2435
223 Ga0207678_10116997 3300026067 Bacteria 2274
224 Ga0207678_10275990 3300026067 Bacteria 1442
225 Ga0207708_10211433 3300026075 Bacteria 1551
226 Ga0207708_10386312 3300026075 Bacteria 1155
227 Ga0207641_10199851 3300026088 Bacteria 1842
228 Ga0207641_10228711 3300026088 Bacteria 1727
229 Ga0207641_10418663 3300026088 Bacteria 1289
230 Ga0207641_10560213 3300026088 Bacteria 1115
231 Ga0207641_10723534 3300026088 Bacteria 981
232 Ga0207648_10063248 3300026089 Bacteria 3226
233 Ga0207648_10076095 3300026089 Bacteria 2926
234 Ga0207648_10192047 3300026089 Bacteria 1810
235 Ga0207648_10230621 3300026089 Bacteria 1647
236 Ga0207676_10055024 3300026095 Bacteria 3121
237 Ga0207674_10334454 3300026116 Bacteria 1464
238 Ga0207675_100006146 3300026118 Bacteria 11412
239 Ga0207675_100052085 3300026118 Bacteria 3820
240 Ga0207675_100178291 3300026118 Bacteria 2034
241 Ga0207675_100502392 3300026118 Bacteria 1207
242 Ga0207683_10024101 3300026121 Bacteria 5237
243 Ga0207683_10104410 3300026121 Bacteria 2532
244 Ga0207683_11624040 3300026121 Unclassified 596
245 Ga0268266_10031770 3300028379 Bacteria 4486
246 Ga0268266_10111949 3300028379 Bacteria 2419
247 Ga0268266_10267351 3300028379 Unclassified 1586
248 Ga0268266_10923577 3300028379 Bacteria 844
249 Ga0268266_10979446 3300028379 Bacteria 818
250 Ga0268265_10033879 3300028380 Bacteria 3717
251 Ga0268265_10063625 3300028380 Bacteria 2839
252 Ga0268265_10633115 3300028380 Bacteria 1026
253 Ga0268264_10239629 3300028381 Bacteria 1679
254 Ga0265338_10027853 3300028800 Bacteria 5655
255 Ga0307513_10026003 3300031456 Bacteria 6760
256 Ga0307509_10255709 3300031507 Bacteria 1531
257 Ga0307408_100234177 3300031548 Bacteria 1506
258 Ga0265314_10626725 3300031711 Bacteria 551
259 Ga0307516_10185151 3300031730 Bacteria 1813
260 Ga0307405_10053416 3300031731 Bacteria 2517
261 Ga0307405_10374496 3300031731 Bacteria 1106
262 Ga0307413_10001102 3300031824 Bacteria 9867
263 Ga0307413_10162944 3300031824 Bacteria 1569
264 Ga0307407_10007516 3300031903 Bacteria 4940
265 Ga0307407_10509143 3300031903 Bacteria 884
266 Ga0307412_10450787 3300031911 Bacteria 1060
267 Ga0307409_100100252 3300031995 Bacteria 2400
268 Ga0307416_100104557 3300032002 Bacteria 2476
269 Ga0307416_100120523 3300032002 Bacteria 2336
270 Ga0307416_100850867 3300032002 Bacteria 1010
271 Ga0307411_10000178 3300032005 Bacteria 20399
272 Ga0439438_099029 3300041405 Bacteria 708
273 Ga0439461_0163103 3300041410 Bacteria 582
274 Ga0451787_530728 3300041441 Bacteria 1175
275 Ga0451789_0390811 3300041443 Bacteria 523
276 Ga0451789_0867131 3300041443 Bacteria 863
277 Ga0451791_0291712 3300041451 Bacteria 515
278 Ga0451791_0795182 3300041451 Bacteria 2423
279 Ga0451791_1034168 3300041451 Bacteria 552
280 Ga0451793_0113777 3300041452 Bacteria 814
281 Ga0451795_0553940 3300041456 Bacteria 959
282 Ga0451798_0841838 3300041458 Bacteria 1059
283 Ga0451800_1170937 3300041459 Bacteria 567
284 Ga0451800_1430756 3300041459 Bacteria 1084
285 Ga0451802_0139048 3300041460 Bacteria 1198
286 Ga0451802_0139520 3300041460 Bacteria 2507
287 Ga0451802_0964208 3300041460 Unclassified 511
288 Ga0451804_0671957 3300041463 Bacteria 1264
289 Ga0451807_0214414 3300041486 Bacteria 2626
290 Ga0451807_0385758 3300041486 Bacteria 771
291 Ga0451807_0614660 3300041486 Bacteria 3790
292 Ga0451807_0698023 3300041486 Unclassified 697
293 Ga0451833_0331949 3300041491 Bacteria 1480
294 Ga0451835_0244814 3300041492 Unclassified 682
295 Ga0451837_0402802 3300041494 Bacteria 1128
296 Ga0451841_0614164 3300041498 Bacteria 505
297 Ga0451847_0219049 3300041503 Bacteria 754
298 Ga0451853_1741296 3300041512 Unclassified 726
299 Ga0451853_2107667 3300041512 Bacteria 2445
300 Ga0451853_2294812 3300041512 Bacteria 947
301 Ga0439434_0151527 3300042435 Bacteria 768
302 Ga0451576_1780712 3300045051 Bacteria 637
303 Ga0495638_0007170 3300046460 Bacteria 8025
304 Ga0495616_0003562 3300046513 Bacteria 9948
305 Ga0495625_0063309 3300046660 Bacteria 2612
306 Ga0495649_0007172 3300046694 Bacteria 6844
307 Ga0495681_0141139 3300047470 Bacteria 1017
308 Ga0495686_0231944 3300047472 Bacteria 1045
309 Ga0501032_0382807 3300049569 Bacteria 905
310 Ga0501036_0837892 3300049572 Bacteria 756
311 Ga0501036_1099814 3300049572 Bacteria 649
312 Ga0501037_0729599 3300049573 Bacteria 658
313 Ga0501040_0210966 3300049576 Bacteria 1381
314 Ga0501040_0488276 3300049576 Bacteria 888
315 Ga0501042_0214024 3300049578 Bacteria 1390
316 Ga0501042_1250388 3300049578 Bacteria 541
317 Ga0501042_1269663 3300049578 Bacteria 537
318 Ga0501048_0777540 3300049582 Bacteria 688
319 Ga0501067_0073763 3300049583 Bacteria 1890
320 Ga0501068_0007964 3300049584 Bacteria 5875
321 Ga0501070_0659130 3300049586 Bacteria 830
322 Ga0501071_0040467 3300049587 Bacteria 3335
323 Ga0501073_0125843 3300049589 Bacteria 1776
324 Ga0501074_0002065 3300049590 Bacteria 13883
325 Ga0501075_0105471 3300049591 Bacteria 2142
326 Ga0501077_0087054 3300049593 Bacteria 1980
327 Ga0501079_0106230 3300049741 Bacteria 2178
328 Ga0501080_0152211 3300049742 Bacteria 2137
329 Ga0501081_0162790 3300049743 Bacteria 1608
330 Ga0501083_0207894 3300049744 Bacteria 1276
331 nmdc:mga09592_1255887_c1 3300050508 Bacteria 610
332 nmdc:mga09592_39532_c1 3300050508 Bacteria 3962
333 nmdc:mga06r32_3405_c1 3300050510 Bacteria 14228
334 nmdc:mga08y16_1303651_c1 3300050511 Bacteria 693
335 Ga0500611_021914 3300053727 Bacteria 1225
336 Ga0501084_0155793 3300054114 Bacteria 1926
337 Ga0530510_0509220 3300061734 Bacteria 913
338 Ga0070658_10045649
339 Ga0070658_10738159
340 Ga0070676_10027404
341 Ga0070676_10267640
342 Ga0070690_100004513
343 Ga0070690_100395124
344 Ga0070690_100760371
345 Ga0070670_100133139
346 Ga0070670_101746592
347 Ga0070677_10022861
348 Ga0070677_10049279
349 Ga0068869_100075759
350 Ga0068869_100077983
351 Ga0068869_100241826
352 Ga0070682_100025164
353 Ga0070682_100230058
354 Ga0070682_100339278
355 Ga0070682_100708648
356 Ga0070682_101246394
357 Ga0068868_100388733
358 Ga0068868_100879248
359 Ga0070689_100019917
360 Ga0070689_100305158
361 Ga0070691_10060331
362 Ga0070687_100040843
363 Ga0070687_100332300
364 Ga0070687_100949794
365 Ga0070661_100273953
366 Ga0070661_101146327
367 Ga0070668_100040732
368 Ga0070668_100135714
369 Ga0070669_100195366
370 Ga0070669_100411710
371 Ga0070675_100010064
372 Ga0070675_100043602
373 Ga0070675_100089294
374 Ga0070671_100297446
375 Ga0070674_100478058
376 Ga0070673_100021022
377 Ga0070673_100021042
378 Ga0070673_100128845
379 Ga0070688_100121881
380 Ga0070688_100428443
381 Ga0070659_100890141
382 Ga0070667_100149939
383 Ga0070667_100553936
384 Ga0070667_101530912
385 Ga0070701_10041906
386 Ga0070701_10134302
387 Ga0070705_100015579
388 Ga0070700_100146150
389 Ga0070700_100183610
390 Ga0070700_100322283
391 Ga0070694_100018874
392 Ga0070663_100078749
393 Ga0070663_100181649
394 Ga0070678_100014668
395 Ga0070678_100023225
396 Ga0070678_100066106
397 Ga0070678_100462286
398 Ga0070678_100926742
399 Ga0070678_101946113
400 Ga0070662_100717577
401 Ga0068867_100101201
402 Ga0068867_100226988
403 Ga0068867_100660809
404 Ga0068867_102202926
405 Ga0070685_10180489
406 Ga0070685_11078909
407 Ga0070698_100927252
408 Ga0070672_100005094
409 Ga0070672_100035581
410 Ga0070672_100187944
411 Ga0070672_100194262
412 Ga0070686_100095554
413 Ga0070686_100570464
414 Ga0070686_100732731
415 Ga0070686_100830971
416 Ga0070696_100024017
417 Ga0070696_100289063
418 Ga0070665_100030627
419 Ga0070665_100074552
420 Ga0070665_100156601
421 Ga0070665_100813206
422 Ga0070665_102304035
423 Ga0070664_100005240
424 Ga0070664_100546762
425 Ga0068857_100491670
426 Ga0070702_100110610
427 Ga0068859_100049603
428 Ga0068859_100863115
429 Ga0068864_100074541
430 Ga0068864_100723931
431 Ga0068866_10650972
432 Ga0068861_100021265
433 Ga0068861_100040797
434 Ga0068861_100099334
435 Ga0068861_100112345
436 Ga0068861_100258429
437 Ga0068861_102056041
438 Ga0068851_10669362
439 Ga0068870_10013484
440 Ga0068870_10104710
441 Ga0068863_100113219
442 Ga0068863_100150979
443 Ga0068863_100335849
444 Ga0068863_100337021
445 Ga0068858_100177572
446 Ga0068858_100570127
447 Ga0068860_100041965
448 Ga0068862_100001728
449 Ga0068862_100855478
450 Ga0081455_10005137
451 Ga0097621_100013851
452 Ga0097621_100524638
453 Ga0097621_101433779
454 Ga0097621_101477560
455 Ga0068871_100197933
456 Ga0068871_100438902
457 Ga0075428_101202798
458 Ga0075431_100076115
459 Ga0075429_100551217
460 Ga0068865_100049973
461 Ga0068865_100429324
462 Ga0068865_100631457
463 Ga0068865_101167223
464 Ga0097620_100049603
465 Ga0097620_100862978
466 Ga0111539_11080152
467 Ga0105245_10852423
468 Ga0114129_10004544
469 Ga0105243_10341383
470 Ga0105243_10488759
471 Ga0105243_11778397
472 Ga0105243_12851200
473 Ga0105242_10029647
474 Ga0105242_10380501
475 Ga0105248_10229085
476 Ga0105248_10672185
477 Ga0105238_11041425
478 Ga0105249_10219512
479 Ga0157370_10632410
480 Ga0157374_10384102
481 Ga0163162_11003092
482 Ga0157375_10063559
483 Ga0157375_10348186
484 Ga0157375_10985169
485 Ga0163163_10913253
486 Ga0163163_10933098
487 Ga0163163_11235030
488 Ga0157380_10177910
489 Ga0157380_10220861
490 Ga0157380_10507079
491 Ga0157380_10876945
492 Ga0157380_12356836
493 Ga0157377_10395007
494 Ga0157379_10024288
495 Ga0157379_10891551
496 Ga0157376_10086759
497 Ga0157376_10218248
498 Ga0157376_10366727
499 Ga0163161_10315371
500 Ga0207697_10207405
501 Ga0207697_10462028
502 Ga0207656_10478703
503 Ga0207682_10002678
504 Ga0207682_10004866
505 Ga0207642_10213077
506 Ga0207642_10595108
507 Ga0207688_10107094
508 Ga0207645_10016848
509 Ga0207645_10301201
510 Ga0207643_10015216
511 Ga0207643_10025559
512 Ga0207643_10027179
513 Ga0207662_10062580
514 Ga0207662_10186779
515 Ga0207662_10206353
516 Ga0207649_11524773
517 Ga0207681_10089702
518 Ga0207681_10122950
519 Ga0207681_10615914
520 Ga0207694_10809102
521 Ga0207650_10237401
522 Ga0207650_11714074
523 Ga0207659_10029326
524 Ga0207659_10132773
525 Ga0207659_10135199
526 Ga0207659_10275148
527 Ga0207644_10538226
528 Ga0207644_10564353
529 Ga0207706_10450336
530 Ga0207706_10939822
531 Ga0207686_10019724
532 Ga0207670_10010870
533 Ga0207670_11875618
534 Ga0207669_10056469
535 Ga0207704_10111079
536 Ga0207704_10228463
537 Ga0207691_10006516
538 Ga0207691_10020864
539 Ga0207691_10032746
540 Ga0207691_10049421
541 Ga0207691_10110299
542 Ga0207689_10031231
543 Ga0207689_10123272
544 Ga0207689_10222317
545 Ga0207661_10469592
546 Ga0207679_11736997
547 Ga0207651_10121119
548 Ga0207651_10178959
549 Ga0207651_10367833
550 Ga0207651_10536327
551 Ga0207712_10429944
552 Ga0207668_10061991
553 Ga0207668_10183020
554 Ga0207668_11346435
555 Ga0207658_10070732
556 Ga0207658_11457062
557 Ga0207677_11163382
558 Ga0207703_10157409
559 Ga0207678_10103107
560 Ga0207678_10116997
561 Ga0207678_10275990
562 Ga0207708_10211433
563 Ga0207708_10386312
564 Ga0207641_10199851
565 Ga0207641_10228711
566 Ga0207641_10418663
567 Ga0207641_10560213
568 Ga0207641_10723534
569 Ga0207648_10063248
570 Ga0207648_10076095
571 Ga0207648_10192047
572 Ga0207648_10230621
573 Ga0207676_10055024
574 Ga0207674_10334454
575 Ga0207675_100006146
576 Ga0207675_100052085
577 Ga0207675_100178291
578 Ga0207675_100502392
579 Ga0207683_10024101
580 Ga0207683_10104410
581 Ga0207683_11624040
582 Ga0268266_10031770
583 Ga0268266_10111949
584 Ga0268266_10267351
585 Ga0268266_10923577
586 Ga0268266_10979446
587 Ga0268265_10033879
588 Ga0268265_10063625
589 Ga0268265_10633115
590 Ga0268264_10239629
591 Ga0265338_10027853
592 Ga0307513_10026003
593 Ga0307509_10255709
594 Ga0307408_100234177
595 Ga0265314_10626725
596 Ga0307516_10185151
597 Ga0307405_10053416
598 Ga0307405_10374496
599 Ga0307413_10001102
600 Ga0307413_10162944
601 Ga0307407_10007516
602 Ga0307407_10509143
603 Ga0307412_10450787
604 Ga0307409_100100252
605 Ga0307416_100104557
606 Ga0307416_100120523
607 Ga0307416_100850867
608 Ga0307411_10000178
609 Ga0439438_099029
610 Ga0439461_0163103
611 Ga0451787_530728
612 Ga0451789_0390811
613 Ga0451789_0867131
614 Ga0451791_0291712
615 Ga0451791_0795182
616 Ga0451791_1034168
617 Ga0451793_0113777
618 Ga0451795_0553940
619 Ga0451798_0841838
620 Ga0451800_1170937
621 Ga0451800_1430756
622 Ga0451802_0139048
623 Ga0451802_0139520
624 Ga0451802_0964208
625 Ga0451804_0671957
626 Ga0451807_0214414
627 Ga0451807_0385758
628 Ga0451807_0614660
629 Ga0451807_0698023
630 Ga0451833_0331949
631 Ga0451835_0244814
632 Ga0451837_0402802
633 Ga0451841_0614164
634 Ga0451847_0219049
635 Ga0451853_1741296
636 Ga0451853_2107667
637 Ga0451853_2294812
638 Ga0439434_0151527
639 Ga0451576_1780712
640 Ga0495638_0007170
641 Ga0495616_0003562
642 Ga0495625_0063309
643 Ga0495649_0007172
644 Ga0495681_0141139
645 Ga0495686_0231944
646 Ga0501032_0382807
647 Ga0501036_0837892
648 Ga0501036_1099814
649 Ga0501037_0729599
650 Ga0501040_0210966
651 Ga0501040_0488276
652 Ga0501042_0214024
653 Ga0501042_1250388
654 Ga0501042_1269663
655 Ga0501048_0777540
656 Ga0501067_0073763
657 Ga0501068_0007964
658 Ga0501070_0659130
659 Ga0501071_0040467
660 Ga0501073_0125843
661 Ga0501074_0002065
662 Ga0501075_0105471
663 Ga0501077_0087054
664 Ga0501079_0106230
665 Ga0501080_0152211
666 Ga0501081_0162790
667 Ga0501083_0207894
668 nmdc:mga09592_1255887_c1
669 nmdc:mga09592_39532_c1
670 nmdc:mga06r32_3405_c1
671 nmdc:mga08y16_1303651_c1
672 Ga0500611_021914
673 Ga0501084_0155793
674 Ga0530510_0509220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06155

GBBH-like_N

Gamma-butyrobetaine hydroxylase-like, N-terminal

10

81

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3luu-assembly1.cif.gz_A crystal structure of protein with unknown function which belongs to pfam duf971 family (afe_2189) from acidithiobacillus ferrooxidans atcc 23270 at 1.93 a resolution 0.8609 7 84
7o9o-assembly1.cif.gz_A crystal structure of the awp3b (adhesin-like wall protein 3b) a-domain from candida glabrata 0.8546 4 31
5hc9-assembly2.cif.gz_B thermotoga maritima cca-adding enzyme complexed with trna_cca 0.8206 6 32
6y48-assembly4.cif.gz_D baeyer-villiger monooxygenase bvmoafl210 from aspergillus flavus in complex with nadp 0.8152 5 31
7v8s-assembly1.cif.gz_B crystal structure of cyclohexanone monooxygenase from t. municipale mutant l437t complexed with nadp+ and fad in space group of p1211 0.8149 5 31
ID Description Score Start End Superfamily
af_A0A0P0WS15_683_864_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.9068 10 34 2.130.10.10
af_Q21526_18_114_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.9053 10 38 3.30.2020.30
af_Q4DMH0_336_498_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.891 7 32 2.130.10.10
af_A0A1D6N475_40_135_3.30.2020.30 Alpha Beta;2-Layer Sandwich;NE0471 N-terminal domain-like; 0.8721 18 84 3.30.2020.30
af_A0A0G2K8S4_8_185_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8622 7 31 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2S6QUE9-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.8984 1 42 GO:0046872
AF-A0A2E9PSC6-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.8918 1 84 GO:0046872
AF-A0A1G5GWK2-F1-model_v4 FeS assembly SUF system protein 0.8917 1 84 GO:0046872
AF-A0A148N972-F1-model_v4 Gamma-butyrobetaine hydroxylase-like N-terminal domain-containing protein 0.891 5 90 GO:0046872
AF-A0A699Z417-F1-model_v4 Phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase 0.8909 1 89 GO:0016853
GO:0046872

Map