F412793

General Info

Members Datasets Scaffolds Average Seq Length
336 192 672 248

Family's Representative Sequence

Representative Sequence 3300046511|Ga0495608_0089048|Ga0495608_0089048_767_1573
Length 268
Sequence MRPANRFLPCAATRIHGMVDPMDTPPPLEPLPEDWSRALAIVAHPDDMEFGSAAAVARWTGQGKEVVYCMVTSGEAGIDGLAPDECRRVREAEQVESARIVGVDVVEFLGQPDGILEYGVPLRRLIASVVRRHRPEIVLTGNFHETFGGRNLNQADHIATGRAVLDAVRDSGNRWVFPEQLLDGVEPWGGVRAVWAGGSPRAEHGVDTTGTFDRGVESLAAHAAYIDGLGWENWDPREFLEGFGRQTGQRMGVAFAASFEVFPLGWGE

Samples

Sample ID Description Type Environment
1 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
43 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
73 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
108 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
109 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
110 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
111 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
112 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
115 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
116 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
117 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
118 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
119 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
120 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
121 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
122 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
123 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
124 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
125 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
128 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
131 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
132 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
133 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
134 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
135 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
136 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
137 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
141 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
142 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
143 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
144 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
145 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
146 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
147 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
148 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
157 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
158 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
159 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
160 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
161 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
162 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
165 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
166 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
167 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
168 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
169 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
173 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 2643221617 Nocardioides sp. Root79 Isolate Unclassified
189 2643221620 Nocardioides sp. Root240 Isolate Unclassified
190 2738541305 Nocardioides sp. CF167 Isolate Unclassified
191 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
192 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.21
Metatranscriptomes 0.3
Isolates 1.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.52
Nodule 0
Rhizoplane 12.5
Rhizosphere 75.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495608_0089048 3300046511 Bacteria 1998
2 LJQas_1004906 3300000549 Bacteria 1719
3 JGI24735J21928_10053870 3300002067 Bacteria 1159
4 Ga0006562J51391_1065907 3300003578 Bacteria 1170
5 Ga0070658_10071908 3300005327 Bacteria 2834
6 Ga0070658_10265001 3300005327 Bacteria 1460
7 Ga0070683_100006201 3300005329 Bacteria 10023
8 Ga0070683_100129501 3300005329 Bacteria 2387
9 Ga0070683_100458338 3300005329 Bacteria 1217
10 Ga0070682_100060271 3300005337 Bacteria 2400
11 Ga0070660_100239108 3300005339 Bacteria 1479
12 Ga0070668_100096220 3300005347 Bacteria 2340
13 Ga0070669_100489075 3300005353 Bacteria 1019
14 Ga0070671_100443883 3300005355 Bacteria 1113
15 Ga0070674_100097225 3300005356 Bacteria 2138
16 Ga0070674_100098137 3300005356 Bacteria 2129
17 Ga0070673_100008758 3300005364 Bacteria 6754
18 Ga0070659_100635316 3300005366 Bacteria 919
19 Ga0070667_100015259 3300005367 Bacteria 6349
20 Ga0070714_100032496 3300005435 Bacteria 4356
21 Ga0070701_10010498 3300005438 Bacteria 4097
22 Ga0070700_100018310 3300005441 Bacteria 4025
23 Ga0070678_100173041 3300005456 Bacteria 1760
24 Ga0068867_100018090 3300005459 Bacteria 5007
25 Ga0070684_100005537 3300005535 Bacteria 9691
26 Ga0070684_100009712 3300005535 Bacteria 7592
27 Ga0070672_100037720 3300005543 Bacteria 3688
28 Ga0070686_100021026 3300005544 Bacteria 3872
29 Ga0070686_100039886 3300005544 Bacteria 2928
30 Ga0070665_100000582 3300005548 Bacteria 50895
31 Ga0068855_100728920 3300005563 Bacteria 1059
32 Ga0070664_100067979 3300005564 Bacteria 3046
33 Ga0068857_100068120 3300005577 Bacteria 3168
34 Ga0068854_100271782 3300005578 Bacteria 1361
35 Ga0068856_100708721 3300005614 Bacteria 1027
36 Ga0070702_100321892 3300005615 Bacteria 1078
37 Ga0068852_100020010 3300005616 Bacteria 5314
38 Ga0068852_100209125 3300005616 Bacteria 1850
39 Ga0068852_100443535 3300005616 Bacteria 1284
40 Ga0068864_100603020 3300005618 Bacteria 1066
41 Ga0068866_10023371 3300005718 Bacteria 2875
42 Ga0068861_100176243 3300005719 Bacteria 1776
43 Ga0068851_10273271 3300005834 Bacteria 964
44 Ga0068870_10024831 3300005840 Bacteria 2968
45 Ga0068858_100112871 3300005842 Bacteria 2538
46 Ga0068860_100448990 3300005843 Bacteria 1282
47 Ga0068862_100165290 3300005844 Bacteria 1978
48 Ga0081455_10000202 3300005937 Bacteria 76003
49 Ga0081455_10001806 3300005937 Bacteria 25821
50 Ga0081538_10002421 3300005981 Bacteria 18292
51 Ga0081539_10035301 3300005985 Bacteria 3008
52 Ga0075365_10041167 3300006038 Bacteria 3017
53 Ga0075365_10052556 3300006038 Bacteria 2695
54 Ga0075365_10101647 3300006038 Bacteria 1969
55 Ga0075365_10125279 3300006038 Bacteria 1775
56 Ga0075365_10377199 3300006038 Bacteria 1000
57 Ga0075368_10001199 3300006042 Bacteria 8190
58 Ga0075363_100062343 3300006048 Bacteria 2010
59 Ga0075363_100078054 3300006048 Bacteria 1807
60 Ga0075363_100135218 3300006048 Bacteria 1385
61 Ga0075364_10125659 3300006051 Bacteria 1719
62 Ga0075364_10189450 3300006051 Bacteria 1393
63 Ga0075362_10023341 3300006177 Bacteria 2615
64 Ga0075367_10110314 3300006178 Bacteria 1688
65 Ga0075370_10003756 3300006353 Bacteria 7266
66 Ga0075370_10007577 3300006353 Bacteria 5533
67 Ga0075370_10021868 3300006353 Bacteria 3507
68 Ga0075428_100000429 3300006844 Bacteria 41658
69 Ga0075430_100008160 3300006846 Bacteria 8851
70 Ga0075430_100026398 3300006846 Bacteria 4942
71 Ga0075431_100000416 3300006847 Bacteria 34675
72 Ga0075431_100004407 3300006847 Bacteria 13800
73 Ga0075431_100040231 3300006847 Bacteria 4817
74 Ga0075431_100051343 3300006847 Bacteria 4253
75 Ga0075433_10164614 3300006852 Bacteria 1974
76 Ga0075434_100157856 3300006871 Bacteria 2288
77 Ga0075429_100001766 3300006880 Bacteria 17897
78 Ga0075429_100020600 3300006880 Bacteria 5723
79 Ga0068865_100058403 3300006881 Bacteria 2694
80 Ga0111539_10023467 3300009094 Bacteria 7579
81 Ga0111539_10082335 3300009094 Bacteria 3785
82 Ga0105245_10538499 3300009098 Bacteria 1188
83 Ga0114129_10420224 3300009147 Bacteria 1758
84 Ga0114129_11054632 3300009147 Bacteria 1020
85 Ga0114129_11139059 3300009147 Bacteria 975
86 Ga0105243_10025669 3300009148 Bacteria 4505
87 Ga0105242_10058442 3300009176 Bacteria 3161
88 Ga0105242_11137065 3300009176 Bacteria 797
89 Ga0105248_10059664 3300009177 Bacteria 4286
90 Ga0105248_10532572 3300009177 Bacteria 1325
91 Ga0105237_10103742 3300009545 Bacteria 2835
92 Ga0105238_10472366 3300009551 Bacteria 1253
93 Ga0105249_10102120 3300009553 Bacteria 2698
94 Ga0105246_10005107 3300011119 Bacteria 7984
95 Ga0157369_10882056 3300013105 Bacteria 918
96 Ga0163162_10061685 3300013306 Bacteria 3787
97 Ga0163162_10620610 3300013306 Bacteria 1206
98 Ga0157372_10027066 3300013307 Bacteria 6241
99 Ga0157372_10070586 3300013307 Bacteria 3931
100 Ga0157372_10122558 3300013307 Bacteria 2988
101 Ga0157372_10192592 3300013307 Bacteria 2362
102 Ga0157372_10333963 3300013307 Bacteria 1765
103 Ga0157375_10015822 3300013308 Bacteria 6760
104 Ga0157375_10110863 3300013308 Bacteria 2842
105 Ga0157375_10112319 3300013308 Bacteria 2825
106 Ga0157375_10353436 3300013308 Bacteria 1635
107 Ga0157375_10775316 3300013308 Bacteria 1109
108 Ga0157375_10839746 3300013308 Bacteria 1066
109 Ga0163163_10114847 3300014325 Bacteria 2724
110 Ga0163163_10126742 3300014325 Bacteria 2591
111 Ga0157380_10023916 3300014326 Bacteria 4616
112 Ga0157380_10154811 3300014326 Bacteria 1986
113 Ga0157380_10733439 3300014326 Bacteria 997
114 Ga0157377_10038934 3300014745 Bacteria 2628
115 Ga0157379_10041364 3300014968 Bacteria 4115
116 Ga0163161_10017278 3300017792 Bacteria 5048
117 Ga0207643_10012579 3300025908 Bacteria 4571
118 Ga0207705_10354134 3300025909 Bacteria 1131
119 Ga0207671_10249140 3300025914 Bacteria 1396
120 Ga0207660_10448877 3300025917 Bacteria 1043
121 Ga0207657_10071212 3300025919 Bacteria 2944
122 Ga0207649_10429198 3300025920 Bacteria 994
123 Ga0207694_10052666 3300025924 Bacteria 3155
124 Ga0207687_10008443 3300025927 Bacteria 6738
125 Ga0207687_10106967 3300025927 Bacteria 2069
126 Ga0207687_10375650 3300025927 Bacteria 1163
127 Ga0207664_10010583 3300025929 Bacteria 6517
128 Ga0207690_10151472 3300025932 Bacteria 1720
129 Ga0207706_10178951 3300025933 Bacteria 1863
130 Ga0207706_10289414 3300025933 Bacteria 1428
131 Ga0207686_10194926 3300025934 Bacteria 1447
132 Ga0207709_10067231 3300025935 Bacteria 2261
133 Ga0207691_10009263 3300025940 Bacteria 9449
134 Ga0207691_10307824 3300025940 Bacteria 1360
135 Ga0207711_10037710 3300025941 Bacteria 4107
136 Ga0207689_10070998 3300025942 Bacteria 2860
137 Ga0207661_10151257 3300025944 Bacteria 2006
138 Ga0207661_10278541 3300025944 Bacteria 1494
139 Ga0207661_10501938 3300025944 Bacteria 1108
140 Ga0207679_10113672 3300025945 Bacteria 2142
141 Ga0207651_10008459 3300025960 Bacteria 5561
142 Ga0207712_10009279 3300025961 Bacteria 6223
143 Ga0207712_10141900 3300025961 Bacteria 1844
144 Ga0207640_10336899 3300025981 Bacteria 1207
145 Ga0207708_10003865 3300026075 Bacteria 11022
146 Ga0207648_10006600 3300026089 Bacteria 11519
147 Ga0207676_10249732 3300026095 Bacteria 1596
148 Ga0207676_10379967 3300026095 Bacteria 1315
149 Ga0207674_10022503 3300026116 Bacteria 6767
150 Ga0207675_100011338 3300026118 Bacteria 8342
151 Ga0207675_100317415 3300026118 Bacteria 1521
152 Ga0207683_10120020 3300026121 Bacteria 2360
153 Ga0207683_10182379 3300026121 Bacteria 1904
154 Ga0207683_10203785 3300026121 Bacteria 1799
155 Ga0207698_10011867 3300026142 Bacteria 5672
156 Ga0207698_10172593 3300026142 Bacteria 1906
157 Ga0268266_10009210 3300028379 Bacteria 8711
158 Ga0268265_10146354 3300028380 Bacteria 1986
159 Ga0268264_10326375 3300028381 Bacteria 1453
160 Ga0307410_10334617 3300031852 Bacteria 1205
161 Ga0307409_100005743 3300031995 Bacteria 7193
162 Ga0307409_100358254 3300031995 Bacteria 1379
163 Ga0307416_100004393 3300032002 Bacteria 8494
164 Ga0307416_100236932 3300032002 Bacteria 1765
165 Ga0307415_100001194 3300032126 Bacteria 12157
166 Ga0395898_0070127 3300037466 Bacteria 3389
167 Ga0451833_0362662 3300041491 Bacteria 887
168 Ga0451853_3718179 3300041512 Bacteria 2034
169 Ga0466972_0019803 3300044658 Bacteria 3364
170 Ga0466965_0008452 3300044683 Bacteria 4765
171 Ga0466965_0016678 3300044683 Bacteria 3500
172 Ga0466966_0125227 3300044684 Bacteria 1576
173 Ga0466961_0051138 3300044693 Bacteria 2639
174 Ga0466963_0088970 3300044694 Bacteria 2100
175 Ga0466963_0152686 3300044694 Bacteria 1604
176 Ga0466963_0285988 3300044694 Bacteria 1159
177 Ga0466964_0026396 3300044706 Bacteria 2273
178 Ga0466964_0051471 3300044706 Bacteria 1691
179 Ga0466964_0212190 3300044706 Bacteria 936
180 Ga0466970_0047664 3300044765 Bacteria 2284
181 Ga0466970_0127810 3300044765 Bacteria 1394
182 Ga0466957_0028086 3300044842 Bacteria 3348
183 Ga0466957_0041766 3300044842 Bacteria 2773
184 Ga0466960_0038581 3300044901 Bacteria 2247
185 Ga0466960_0126324 3300044901 Bacteria 1345
186 Ga0466960_0131455 3300044901 Bacteria 1321
187 Ga0466960_0354158 3300044901 Bacteria 838
188 Ga0466958_0009073 3300045836 Bacteria 5526
189 Ga0466967_0001989 3300045976 Bacteria 12417
190 Ga0466967_0004382 3300045976 Bacteria 9504
191 Ga0466967_0054002 3300045976 Bacteria 3534
192 Ga0466967_0068604 3300045976 Bacteria 3167
193 Ga0466967_0161871 3300045976 Bacteria 2101
194 Ga0466967_0175542 3300045976 Bacteria 2018
195 Ga0466967_0353120 3300045976 Bacteria 1423
196 Ga0466967_0366131 3300045976 Bacteria 1397
197 Ga0466967_0379396 3300045976 Bacteria 1372
198 Ga0466967_0412152 3300045976 Bacteria 1316
199 Ga0466967_0696616 3300045976 Bacteria 1006
200 Ga0495629_0073371 3300046459 Bacteria 2390
201 Ga0495641_0091626 3300046461 Bacteria 1358
202 Ga0495657_0147946 3300046675 Bacteria 1460
203 Ga0495647_0052235 3300046681 Bacteria 1591
204 Ga0495600_0063096 3300046809 Bacteria 2421
205 Ga0496101_0048510 3300048904 Bacteria 3052
206 Ga0496101_0163256 3300048904 Bacteria 1709
207 Ga0496101_0170002 3300048904 Bacteria 1675
208 Ga0496102_0034098 3300048905 Bacteria 4577
209 Ga0496102_0246945 3300048905 Bacteria 1683
210 Ga0496102_0483577 3300048905 Bacteria 1160
211 Ga0496102_0572275 3300048905 Bacteria 1052
212 Ga0496103_0263795 3300048906 Bacteria 1108
213 Ga0496103_0443030 3300048906 Bacteria 833
214 Ga0496104_0126290 3300048907 Bacteria 2456
215 Ga0496104_0656130 3300048907 Bacteria 958
216 Ga0496105_0012767 3300048908 Bacteria 6653
217 Ga0496105_0054975 3300048908 Bacteria 3287
218 Ga0496105_0388799 3300048908 Bacteria 1109
219 Ga0496106_0062171 3300048909 Bacteria 2834
220 Ga0496106_0296911 3300048909 Bacteria 1295
221 Ga0496107_0012923 3300048910 Bacteria 5834
222 Ga0496107_0032715 3300048910 Bacteria 3717
223 Ga0496107_0211906 3300048910 Bacteria 1441
224 Ga0496108_0386960 3300048911 Bacteria 1221
225 Ga0496109_0004432 3300048912 Bacteria 11725
226 Ga0496109_0007610 3300048912 Bacteria 9186
227 Ga0496109_0044262 3300048912 Bacteria 4038
228 Ga0496109_0055708 3300048912 Bacteria 3607
229 Ga0496109_0083927 3300048912 Bacteria 2938
230 Ga0496109_0101137 3300048912 Bacteria 2675
231 Ga0496109_0230169 3300048912 Bacteria 1744
232 Ga0496110_0060528 3300048913 Bacteria 3340
233 Ga0496110_0150547 3300048913 Bacteria 2107
234 Ga0496110_0175604 3300048913 Bacteria 1944
235 Ga0496110_0371424 3300048913 Bacteria 1303
236 Ga0496111_0013744 3300048914 Bacteria 5515
237 Ga0496111_0365917 3300048914 Bacteria 1067
238 Ga0496112_0111843 3300048915 Bacteria 2701
239 Ga0496114_0010317 3300048917 Bacteria 7433
240 Ga0496114_0028173 3300048917 Bacteria 4607
241 Ga0496114_0043818 3300048917 Bacteria 3711
242 Ga0496114_0094847 3300048917 Bacteria 2538
243 Ga0496114_0277951 3300048917 Bacteria 1476
244 Ga0496114_0284233 3300048917 Bacteria 1459
245 Ga0496115_0006151 3300048918 Bacteria 8780
246 Ga0496115_0140098 3300048918 Bacteria 1995
247 Ga0496126_0068603 3300048929 Bacteria 3165
248 Ga0501031_0020365 3300049568 Bacteria 4324
249 Ga0501032_0193220 3300049569 Bacteria 1330
250 Ga0501036_0340549 3300049572 Bacteria 1252
251 Ga0501037_0237789 3300049573 Bacteria 1277
252 Ga0501038_0174827 3300049574 Bacteria 1736
253 Ga0501039_0258698 3300049575 Bacteria 1368
254 Ga0501040_0031639 3300049576 Bacteria 3577
255 Ga0501041_0007630 3300049577 Bacteria 6356
256 Ga0501041_0036441 3300049577 Bacteria 2980
257 Ga0501042_0016314 3300049578 Bacteria 5098
258 Ga0501042_0022901 3300049578 Bacteria 4365
259 Ga0501043_0308002 3300049579 Bacteria 1209
260 Ga0501048_0046552 3300049582 Bacteria 3096
261 Ga0501048_0252364 3300049582 Bacteria 1252
262 Ga0501048_0259160 3300049582 Bacteria 1235
263 Ga0501067_0000478 3300049583 Bacteria 21820
264 Ga0501067_0017033 3300049583 Bacteria 4016
265 Ga0501067_0030316 3300049583 Bacteria 3000
266 Ga0501067_0230677 3300049583 Bacteria 1030
267 Ga0501069_0006312 3300049585 Bacteria 6197
268 Ga0501070_0004621 3300049586 Bacteria 11805
269 Ga0501070_0009988 3300049586 Bacteria 8027
270 Ga0501070_0488254 3300049586 Bacteria 990
271 Ga0501071_0087569 3300049587 Bacteria 2285
272 Ga0501072_0051004 3300049588 Bacteria 3258
273 Ga0501072_0112236 3300049588 Bacteria 2170
274 Ga0501072_0268607 3300049588 Bacteria 1357
275 Ga0501072_0313307 3300049588 Bacteria 1247
276 Ga0501073_0002871 3300049589 Bacteria 12907
277 Ga0501074_0011545 3300049590 Bacteria 6423
278 Ga0501074_0055677 3300049590 Bacteria 2850
279 Ga0501075_0135078 3300049591 Bacteria 1879
280 Ga0501075_0206902 3300049591 Bacteria 1497
281 Ga0501076_0038937 3300049592 Bacteria 3732
282 Ga0501076_0138891 3300049592 Bacteria 1974
283 Ga0501077_0008004 3300049593 Bacteria 6532
284 Ga0501077_0122464 3300049593 Bacteria 1649
285 Ga0501079_0050116 3300049741 Bacteria 3223
286 Ga0501079_0077566 3300049741 Bacteria 2570
287 Ga0501079_0227054 3300049741 Bacteria 1459
288 Ga0501080_0142533 3300049742 Bacteria 2215
289 Ga0501083_0000725 3300049744 Bacteria 21473
290 Ga0501045_0012236 3300049824 Bacteria 6044
291 nmdc:mga03683_9691_c1 3300050489 Bacteria 3436
292 nmdc:mga03n38_41899_c1 3300050490 Bacteria 1999
293 nmdc:mga00v17_14708_c1 3300050491 Bacteria 4377
294 nmdc:mga00v17_263923_c1 3300050491 Bacteria 1117
295 nmdc:mga00v17_67231_c1 3300050491 Bacteria 2214
296 nmdc:mga0yw44_118110_c1 3300050492 Bacteria 1706
297 nmdc:mga0yw44_13767_c1 3300050492 Bacteria 4272
298 nmdc:mga0yw44_164098_c1 3300050492 Bacteria 1456
299 nmdc:mga0yw44_203688_c1 3300050492 Bacteria 1307
300 nmdc:mga0yw44_49028_c1 3300050492 Bacteria 2547
301 nmdc:mga06z11_133462_c1 3300050494 Bacteria 1397
302 nmdc:mga04h51_30162_c1 3300050495 Bacteria 1705
303 nmdc:mga07m45_16511_c1 3300050496 Bacteria 3953
304 nmdc:mga07m45_32376_c1 3300050496 Bacteria 2900
305 nmdc:mga07m45_99392_c1 3300050496 Bacteria 1671
306 nmdc:mga05p37_136602_c1 3300050507 Bacteria 3006
307 nmdc:mga05p37_3012_c1 3300050507 Bacteria 19549
308 nmdc:mga05p37_765432_c1 3300050507 Bacteria 1062
309 nmdc:mga09592_290848_c1 3300050508 Bacteria 1416
310 nmdc:mga09592_4152_c1 3300050508 Bacteria 11702
311 nmdc:mga09592_5530_c1 3300050508 Bacteria 10284
312 nmdc:mga0qj67_15968_c1 3300050509 Bacteria 5686
313 nmdc:mga0qj67_2092_c1 3300050509 Bacteria 8712
314 nmdc:mga06r32_34119_c1 3300050510 Bacteria 4797
315 nmdc:mga06r32_413_c1 3300050510 Bacteria 35951
316 nmdc:mga06r32_69458_c1 3300050510 Bacteria 3405
317 nmdc:mga08y16_69831_c1 3300050511 Bacteria 3662
318 nmdc:mga08y16_720_c2 3300050511 Bacteria 13589
319 nmdc:mga0n895_188919_c1 3300050512 Bacteria 2091
320 nmdc:mga0a205_419376_c1 3300050515 Bacteria 1200
321 nmdc:mga0a205_53427_c1 3300050515 Bacteria 3899
322 Ga0495619_0006213 3300053085 Bacteria 7573
323 Ga0500568_0065435 3300053139 Bacteria 1400
324 Ga0501084_0059716 3300054114 Bacteria 3192
325 Ga0501084_0241300 3300054114 Bacteria 1525
326 Ga0501084_0259061 3300054114 Bacteria 1468
327 Ga0501082_0029976 3300060353 Bacteria 4687
328 Ga0501082_0125838 3300060353 Bacteria 2223
329 Ga0501082_0446298 3300060353 Bacteria 1130
330 Ga0501082_0490345 3300060353 Bacteria 1074
331 Ga0501082_0784863 3300060353 Bacteria 833
332 2644098701 2643221617 Bacteria 5139111
333 2644116062 2643221620 Bacteria 5134593
334 2738871558 2738541305 Bacteria 4910150
335 2855390724 2855386786 Bacteria 4752232
336 2932432022 2932431166 Bacteria 4215299
337 Ga0495608_0089048
338 LJQas_1004906
339 JGI24735J21928_10053870
340 Ga0006562J51391_1065907
341 Ga0070658_10071908
342 Ga0070658_10265001
343 Ga0070683_100006201
344 Ga0070683_100129501
345 Ga0070683_100458338
346 Ga0070682_100060271
347 Ga0070660_100239108
348 Ga0070668_100096220
349 Ga0070669_100489075
350 Ga0070671_100443883
351 Ga0070674_100097225
352 Ga0070674_100098137
353 Ga0070673_100008758
354 Ga0070659_100635316
355 Ga0070667_100015259
356 Ga0070714_100032496
357 Ga0070701_10010498
358 Ga0070700_100018310
359 Ga0070678_100173041
360 Ga0068867_100018090
361 Ga0070684_100005537
362 Ga0070684_100009712
363 Ga0070672_100037720
364 Ga0070686_100021026
365 Ga0070686_100039886
366 Ga0070665_100000582
367 Ga0068855_100728920
368 Ga0070664_100067979
369 Ga0068857_100068120
370 Ga0068854_100271782
371 Ga0068856_100708721
372 Ga0070702_100321892
373 Ga0068852_100020010
374 Ga0068852_100209125
375 Ga0068852_100443535
376 Ga0068864_100603020
377 Ga0068866_10023371
378 Ga0068861_100176243
379 Ga0068851_10273271
380 Ga0068870_10024831
381 Ga0068858_100112871
382 Ga0068860_100448990
383 Ga0068862_100165290
384 Ga0081455_10000202
385 Ga0081455_10001806
386 Ga0081538_10002421
387 Ga0081539_10035301
388 Ga0075365_10041167
389 Ga0075365_10052556
390 Ga0075365_10101647
391 Ga0075365_10125279
392 Ga0075365_10377199
393 Ga0075368_10001199
394 Ga0075363_100062343
395 Ga0075363_100078054
396 Ga0075363_100135218
397 Ga0075364_10125659
398 Ga0075364_10189450
399 Ga0075362_10023341
400 Ga0075367_10110314
401 Ga0075370_10003756
402 Ga0075370_10007577
403 Ga0075370_10021868
404 Ga0075428_100000429
405 Ga0075430_100008160
406 Ga0075430_100026398
407 Ga0075431_100000416
408 Ga0075431_100004407
409 Ga0075431_100040231
410 Ga0075431_100051343
411 Ga0075433_10164614
412 Ga0075434_100157856
413 Ga0075429_100001766
414 Ga0075429_100020600
415 Ga0068865_100058403
416 Ga0111539_10023467
417 Ga0111539_10082335
418 Ga0105245_10538499
419 Ga0114129_10420224
420 Ga0114129_11054632
421 Ga0114129_11139059
422 Ga0105243_10025669
423 Ga0105242_10058442
424 Ga0105242_11137065
425 Ga0105248_10059664
426 Ga0105248_10532572
427 Ga0105237_10103742
428 Ga0105238_10472366
429 Ga0105249_10102120
430 Ga0105246_10005107
431 Ga0157369_10882056
432 Ga0163162_10061685
433 Ga0163162_10620610
434 Ga0157372_10027066
435 Ga0157372_10070586
436 Ga0157372_10122558
437 Ga0157372_10192592
438 Ga0157372_10333963
439 Ga0157375_10015822
440 Ga0157375_10110863
441 Ga0157375_10112319
442 Ga0157375_10353436
443 Ga0157375_10775316
444 Ga0157375_10839746
445 Ga0163163_10114847
446 Ga0163163_10126742
447 Ga0157380_10023916
448 Ga0157380_10154811
449 Ga0157380_10733439
450 Ga0157377_10038934
451 Ga0157379_10041364
452 Ga0163161_10017278
453 Ga0207643_10012579
454 Ga0207705_10354134
455 Ga0207671_10249140
456 Ga0207660_10448877
457 Ga0207657_10071212
458 Ga0207649_10429198
459 Ga0207694_10052666
460 Ga0207687_10008443
461 Ga0207687_10106967
462 Ga0207687_10375650
463 Ga0207664_10010583
464 Ga0207690_10151472
465 Ga0207706_10178951
466 Ga0207706_10289414
467 Ga0207686_10194926
468 Ga0207709_10067231
469 Ga0207691_10009263
470 Ga0207691_10307824
471 Ga0207711_10037710
472 Ga0207689_10070998
473 Ga0207661_10151257
474 Ga0207661_10278541
475 Ga0207661_10501938
476 Ga0207679_10113672
477 Ga0207651_10008459
478 Ga0207712_10009279
479 Ga0207712_10141900
480 Ga0207640_10336899
481 Ga0207708_10003865
482 Ga0207648_10006600
483 Ga0207676_10249732
484 Ga0207676_10379967
485 Ga0207674_10022503
486 Ga0207675_100011338
487 Ga0207675_100317415
488 Ga0207683_10120020
489 Ga0207683_10182379
490 Ga0207683_10203785
491 Ga0207698_10011867
492 Ga0207698_10172593
493 Ga0268266_10009210
494 Ga0268265_10146354
495 Ga0268264_10326375
496 Ga0307410_10334617
497 Ga0307409_100005743
498 Ga0307409_100358254
499 Ga0307416_100004393
500 Ga0307416_100236932
501 Ga0307415_100001194
502 Ga0395898_0070127
503 Ga0451833_0362662
504 Ga0451853_3718179
505 Ga0466972_0019803
506 Ga0466965_0008452
507 Ga0466965_0016678
508 Ga0466966_0125227
509 Ga0466961_0051138
510 Ga0466963_0088970
511 Ga0466963_0152686
512 Ga0466963_0285988
513 Ga0466964_0026396
514 Ga0466964_0051471
515 Ga0466964_0212190
516 Ga0466970_0047664
517 Ga0466970_0127810
518 Ga0466957_0028086
519 Ga0466957_0041766
520 Ga0466960_0038581
521 Ga0466960_0126324
522 Ga0466960_0131455
523 Ga0466960_0354158
524 Ga0466958_0009073
525 Ga0466967_0001989
526 Ga0466967_0004382
527 Ga0466967_0054002
528 Ga0466967_0068604
529 Ga0466967_0161871
530 Ga0466967_0175542
531 Ga0466967_0353120
532 Ga0466967_0366131
533 Ga0466967_0379396
534 Ga0466967_0412152
535 Ga0466967_0696616
536 Ga0495629_0073371
537 Ga0495641_0091626
538 Ga0495657_0147946
539 Ga0495647_0052235
540 Ga0495600_0063096
541 Ga0496101_0048510
542 Ga0496101_0163256
543 Ga0496101_0170002
544 Ga0496102_0034098
545 Ga0496102_0246945
546 Ga0496102_0483577
547 Ga0496102_0572275
548 Ga0496103_0263795
549 Ga0496103_0443030
550 Ga0496104_0126290
551 Ga0496104_0656130
552 Ga0496105_0012767
553 Ga0496105_0054975
554 Ga0496105_0388799
555 Ga0496106_0062171
556 Ga0496106_0296911
557 Ga0496107_0012923
558 Ga0496107_0032715
559 Ga0496107_0211906
560 Ga0496108_0386960
561 Ga0496109_0004432
562 Ga0496109_0007610
563 Ga0496109_0044262
564 Ga0496109_0055708
565 Ga0496109_0083927
566 Ga0496109_0101137
567 Ga0496109_0230169
568 Ga0496110_0060528
569 Ga0496110_0150547
570 Ga0496110_0175604
571 Ga0496110_0371424
572 Ga0496111_0013744
573 Ga0496111_0365917
574 Ga0496112_0111843
575 Ga0496114_0010317
576 Ga0496114_0028173
577 Ga0496114_0043818
578 Ga0496114_0094847
579 Ga0496114_0277951
580 Ga0496114_0284233
581 Ga0496115_0006151
582 Ga0496115_0140098
583 Ga0496126_0068603
584 Ga0501031_0020365
585 Ga0501032_0193220
586 Ga0501036_0340549
587 Ga0501037_0237789
588 Ga0501038_0174827
589 Ga0501039_0258698
590 Ga0501040_0031639
591 Ga0501041_0007630
592 Ga0501041_0036441
593 Ga0501042_0016314
594 Ga0501042_0022901
595 Ga0501043_0308002
596 Ga0501048_0046552
597 Ga0501048_0252364
598 Ga0501048_0259160
599 Ga0501067_0000478
600 Ga0501067_0017033
601 Ga0501067_0030316
602 Ga0501067_0230677
603 Ga0501069_0006312
604 Ga0501070_0004621
605 Ga0501070_0009988
606 Ga0501070_0488254
607 Ga0501071_0087569
608 Ga0501072_0051004
609 Ga0501072_0112236
610 Ga0501072_0268607
611 Ga0501072_0313307
612 Ga0501073_0002871
613 Ga0501074_0011545
614 Ga0501074_0055677
615 Ga0501075_0135078
616 Ga0501075_0206902
617 Ga0501076_0038937
618 Ga0501076_0138891
619 Ga0501077_0008004
620 Ga0501077_0122464
621 Ga0501079_0050116
622 Ga0501079_0077566
623 Ga0501079_0227054
624 Ga0501080_0142533
625 Ga0501083_0000725
626 Ga0501045_0012236
627 nmdc:mga03683_9691_c1
628 nmdc:mga03n38_41899_c1
629 nmdc:mga00v17_14708_c1
630 nmdc:mga00v17_263923_c1
631 nmdc:mga00v17_67231_c1
632 nmdc:mga0yw44_118110_c1
633 nmdc:mga0yw44_13767_c1
634 nmdc:mga0yw44_164098_c1
635 nmdc:mga0yw44_203688_c1
636 nmdc:mga0yw44_49028_c1
637 nmdc:mga06z11_133462_c1
638 nmdc:mga04h51_30162_c1
639 nmdc:mga07m45_16511_c1
640 nmdc:mga07m45_32376_c1
641 nmdc:mga07m45_99392_c1
642 nmdc:mga05p37_136602_c1
643 nmdc:mga05p37_3012_c1
644 nmdc:mga05p37_765432_c1
645 nmdc:mga09592_290848_c1
646 nmdc:mga09592_4152_c1
647 nmdc:mga09592_5530_c1
648 nmdc:mga0qj67_15968_c1
649 nmdc:mga0qj67_2092_c1
650 nmdc:mga06r32_34119_c1
651 nmdc:mga06r32_413_c1
652 nmdc:mga06r32_69458_c1
653 nmdc:mga08y16_69831_c1
654 nmdc:mga08y16_720_c2
655 nmdc:mga0n895_188919_c1
656 nmdc:mga0a205_419376_c1
657 nmdc:mga0a205_53427_c1
658 Ga0495619_0006213
659 Ga0500568_0065435
660 Ga0501084_0059716
661 Ga0501084_0241300
662 Ga0501084_0259061
663 Ga0501082_0029976
664 Ga0501082_0125838
665 Ga0501082_0446298
666 Ga0501082_0490345
667 Ga0501082_0784863
668 2644098701
669 2644116062
670 2738871558
671 2855390724
672 2932432022

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02585

PIG-L

GlcNAc-PI de-N-acetylase

39

168

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.918 6 239
3we7-assembly1.cif.gz_A crystal structure of diacetylchitobiose deacetylase from pyrococcus horikoshii 0.9101 11 241
8bgo-assembly1.cif.gz_C n,n-diacetylchitobiose deacetylase from pyrococcus chitonophagus with substrate n,n-diacetylchitobiose 0.9064 11 241
4xm0-assembly1.cif.gz_C n,n'-diacetylchitobiose deacetylase (semet derivative) from pyrococcus furiosus in the absence of cadmium 0.9056 11 241
5bmo-assembly1.cif.gz_A lnmx protein, a putative glcnac-pi de-n-acetylase from streptomyces atroolivaceus 0.8923 6 239
ID Description Score Start End Superfamily
3we7B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.9031 12 241 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8996 1 239 3.40.50.10320
5bmoC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8856 1 239 3.40.50.10320
1uanB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8562 16 245 3.40.50.10320
2ixdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;LmbE-like 0.8343 14 245 3.40.50.10320
ID Description Score Start End GO Terms
AF-A0A7W0XY94-F1-model_v4 PIG-L family deacetylase 0.981 4 245 GO:0016137
GO:0016811
AF-A0A849JZC4-F1-model_v4 PIG-L family deacetylase 0.9763 1 242 GO:0016137
GO:0016811
AF-A0A4Q5T157-F1-model_v4 PIG-L family deacetylase 0.9751 39 246 GO:0016137
AF-A0A2T2QVW5-F1-model_v4 PIG-L domain-containing protein 0.9696 4 242 GO:0016811
AF-A0A1C4LZU9-F1-model_v4 N-acetylglucosaminyl deacetylase, LmbE family 0.9677 1 207 GO:0016137
GO:0016811

Map