F412769
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 336 | 235 | 297 | 185 |
Family's Representative Sequence
| Representative Sequence | 3300044684|Ga0466966_0263322|Ga0466966_0263322_366_1019 |
| Length | 210 |
| Sequence | MKNLSGTNFDARERGPRDSGGEAQEGASNSVLRPAIALLILMTAITGIAYPKVLFPGQADGSLVVRDGKPVGSRLIGQPFSDPKDFWSRPSATSPQPYNGLASGGSNLGPLNSALTDAVKARIAALQSADPGNHAPIPVDLVTASASGLDPDISLAAAYYQADRIARIRHLSPDRVRALIAAHARGRVLGVIGEPRVNVLELNLALDAMK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 2 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 3 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 4 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 5 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 6 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 7 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 8 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 9 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 10 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 11 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 12 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 13 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 14 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 15 | 2919166419 | Agrobacterium cavarae 2074 | Isolate | Unclassified |
| 16 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 17 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 18 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 19 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 20 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 21 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 22 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 23 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 24 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 25 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 26 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 27 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 28 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 29 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 30 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 31 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 32 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 33 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 34 | 2978969890 | Agrobacterium sp. SORGH_AS 787 | Isolate | Unclassified |
| 35 | 2984587000 | Agrobacterium larrymoorei SORGH_AS974 | Isolate | Aerial Root |
| 36 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 37 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 43 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 46 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 59 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 72 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 73 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 74 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 80 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 83 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 105 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 106 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 154 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 156 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 157 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 160 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 161 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 167 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 173 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 176 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 177 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 178 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 181 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 191 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 193 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 198 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 201 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 202 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 203 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 206 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 207 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 208 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 225 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 226 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 228 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 229 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 230 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 232 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 233 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 234 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 235 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.39 |
| Metatranscriptomes | 0 |
| Isolates | 11.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.3 |
| Bulb | 0 |
| Endosphere | 2.08 |
| Nodule | 12.2 |
| Rhizoplane | 4.76 |
| Rhizosphere | 73.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.85 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootH1_10073072 | 3300003323 | Bacteria | 1321 |
| 2 | rootH1_10211231 | 3300003323 | Bacteria | 2232 |
| 3 | rootH1_10306602 | 3300003323 | Bacteria | 3536 |
| 4 | Ga0055531_10021549 | 3300003794 | Bacteria | 2494 |
| 5 | Ga0070676_10015637 | 3300005328 | Bacteria | 4188 |
| 6 | Ga0070683_100000007 | 3300005329 | Bacteria | 342155 |
| 7 | Ga0070683_100007866 | 3300005329 | Bacteria | 9030 |
| 8 | Ga0070683_100041760 | 3300005329 | Bacteria | 4221 |
| 9 | Ga0070690_100079218 | 3300005330 | Bacteria | 2148 |
| 10 | Ga0070670_100026369 | 3300005331 | Bacteria | 5002 |
| 11 | Ga0068869_100098125 | 3300005334 | Bacteria | 2213 |
| 12 | Ga0068869_100175022 | 3300005334 | Bacteria | 1679 |
| 13 | Ga0070666_10007357 | 3300005335 | Bacteria | 6784 |
| 14 | Ga0070680_100011576 | 3300005336 | Bacteria | 6832 |
| 15 | Ga0070680_100100777 | 3300005336 | Bacteria | 2397 |
| 16 | Ga0070680_100212683 | 3300005336 | Bacteria | 1631 |
| 17 | Ga0068868_100019389 | 3300005338 | Bacteria | 5096 |
| 18 | Ga0068868_100146218 | 3300005338 | Bacteria | 1944 |
| 19 | Ga0070660_100042504 | 3300005339 | Bacteria | 3469 |
| 20 | Ga0070691_10009196 | 3300005341 | Bacteria | 4517 |
| 21 | Ga0070669_100000007 | 3300005353 | Bacteria | 233709 |
| 22 | Ga0070671_100034370 | 3300005355 | Bacteria | 4196 |
| 23 | Ga0070667_100066711 | 3300005367 | Bacteria | 3058 |
| 24 | Ga0070667_100083420 | 3300005367 | Bacteria | 2738 |
| 25 | Ga0070667_100107310 | 3300005367 | Bacteria | 2418 |
| 26 | Ga0070709_10598330 | 3300005434 | Bacteria | 849 |
| 27 | Ga0070714_100222822 | 3300005435 | Bacteria | 1734 |
| 28 | Ga0070714_100931169 | 3300005435 | Bacteria | 844 |
| 29 | Ga0070713_100002189 | 3300005436 | Bacteria | 12653 |
| 30 | Ga0070710_10008578 | 3300005437 | Bacteria | 4975 |
| 31 | Ga0070711_100027053 | 3300005439 | Bacteria | 3762 |
| 32 | Ga0070711_100546848 | 3300005439 | Bacteria | 960 |
| 33 | Ga0070663_100450562 | 3300005455 | Bacteria | 1061 |
| 34 | Ga0070678_100003645 | 3300005456 | Bacteria | 8596 |
| 35 | Ga0070681_10004054 | 3300005458 | Bacteria | 13830 |
| 36 | Ga0070681_10174440 | 3300005458 | Bacteria | 2071 |
| 37 | Ga0068867_100100186 | 3300005459 | Bacteria | 2212 |
| 38 | Ga0068867_100263027 | 3300005459 | Bacteria | 1407 |
| 39 | Ga0070679_100036783 | 3300005530 | Bacteria | 4859 |
| 40 | Ga0070684_100000021 | 3300005535 | Bacteria | 132928 |
| 41 | Ga0070684_100042361 | 3300005535 | Bacteria | 3930 |
| 42 | Ga0068853_100764942 | 3300005539 | Bacteria | 924 |
| 43 | Ga0070672_100291816 | 3300005543 | Bacteria | 1381 |
| 44 | Ga0070686_100129001 | 3300005544 | Bacteria | 1746 |
| 45 | Ga0070665_100036805 | 3300005548 | Bacteria | 4921 |
| 46 | Ga0070665_100084818 | 3300005548 | Bacteria | 3173 |
| 47 | Ga0068855_100001240 | 3300005563 | Bacteria | 31649 |
| 48 | Ga0068855_100013474 | 3300005563 | Bacteria | 9856 |
| 49 | Ga0068855_100040675 | 3300005563 | Bacteria | 5516 |
| 50 | Ga0068855_100226400 | 3300005563 | Bacteria | 2095 |
| 51 | Ga0068857_100040227 | 3300005577 | Bacteria | 4146 |
| 52 | Ga0068857_100126840 | 3300005577 | Bacteria | 2300 |
| 53 | Ga0068856_100166618 | 3300005614 | Bacteria | 2214 |
| 54 | Ga0068856_100285160 | 3300005614 | Bacteria | 1668 |
| 55 | Ga0068856_100286029 | 3300005614 | Bacteria | 1666 |
| 56 | Ga0068856_100368610 | 3300005614 | Bacteria | 1455 |
| 57 | Ga0068859_100019247 | 3300005617 | Bacteria | 6858 |
| 58 | Ga0068859_100098763 | 3300005617 | Bacteria | 2974 |
| 59 | Ga0068866_10008057 | 3300005718 | Bacteria | 4426 |
| 60 | Ga0068870_10040148 | 3300005840 | Bacteria | 2425 |
| 61 | Ga0068863_100013514 | 3300005841 | Bacteria | 7875 |
| 62 | Ga0068863_100025565 | 3300005841 | Bacteria | 5629 |
| 63 | Ga0068858_100019933 | 3300005842 | Bacteria | 6270 |
| 64 | Ga0068858_100090130 | 3300005842 | Bacteria | 2853 |
| 65 | Ga0068860_100010201 | 3300005843 | Bacteria | 9297 |
| 66 | Ga0070715_10010850 | 3300006163 | Bacteria | 3259 |
| 67 | Ga0070712_100042372 | 3300006175 | Bacteria | 3130 |
| 68 | Ga0097621_100214480 | 3300006237 | Bacteria | 1675 |
| 69 | Ga0097621_100322510 | 3300006237 | Bacteria | 1369 |
| 70 | Ga0068871_100270121 | 3300006358 | Bacteria | 1485 |
| 71 | Ga0068865_100024111 | 3300006881 | Bacteria | 3988 |
| 72 | Ga0068865_100140738 | 3300006881 | Bacteria | 1819 |
| 73 | Ga0075436_100064683 | 3300006914 | Bacteria | 2529 |
| 74 | Ga0097620_100019247 | 3300006931 | Bacteria | 6858 |
| 75 | Ga0097620_100098761 | 3300006931 | Bacteria | 2974 |
| 76 | Ga0079104_1003013 | 3300006946 | Bacteria | 8270 |
| 77 | Ga0105250_10058157 | 3300009092 | Bacteria | 1552 |
| 78 | Ga0105240_10005746 | 3300009093 | Bacteria | 18400 |
| 79 | Ga0105240_10008007 | 3300009093 | Bacteria | 15222 |
| 80 | Ga0105240_10116497 | 3300009093 | Bacteria | 3223 |
| 81 | Ga0105240_10354300 | 3300009093 | Bacteria | 1664 |
| 82 | Ga0105240_10581970 | 3300009093 | Bacteria | 1235 |
| 83 | Ga0105245_10020265 | 3300009098 | Bacteria | 5829 |
| 84 | Ga0105247_10011794 | 3300009101 | Bacteria | 5255 |
| 85 | Ga0105247_10711486 | 3300009101 | Bacteria | 757 |
| 86 | Ga0105241_10005253 | 3300009174 | Bacteria | 9564 |
| 87 | Ga0105242_10006532 | 3300009176 | Bacteria | 8976 |
| 88 | Ga0105248_10044969 | 3300009177 | Bacteria | 4951 |
| 89 | Ga0105237_10026415 | 3300009545 | Bacteria | 5934 |
| 90 | Ga0105237_10272911 | 3300009545 | Bacteria | 1694 |
| 91 | Ga0105237_10586043 | 3300009545 | Bacteria | 1122 |
| 92 | Ga0105238_10128763 | 3300009551 | Bacteria | 2510 |
| 93 | Ga0105238_10152591 | 3300009551 | Bacteria | 2285 |
| 94 | Ga0105238_10161023 | 3300009551 | Bacteria | 2220 |
| 95 | Ga0105238_10313720 | 3300009551 | Bacteria | 1553 |
| 96 | Ga0105238_10526451 | 3300009551 | Bacteria | 1185 |
| 97 | Ga0105249_10428581 | 3300009553 | Bacteria | 1358 |
| 98 | Ga0105249_10601079 | 3300009553 | Bacteria | 1155 |
| 99 | Ga0105239_10015203 | 3300010375 | Bacteria | 8530 |
| 100 | Ga0105239_10067355 | 3300010375 | Bacteria | 3933 |
| 101 | Ga0105239_10208439 | 3300010375 | Bacteria | 2190 |
| 102 | Ga0105239_10559925 | 3300010375 | Bacteria | 1302 |
| 103 | Ga0105239_11271523 | 3300010375 | Bacteria | 849 |
| 104 | Ga0157371_10844572 | 3300013102 | Unclassified | 692 |
| 105 | Ga0157370_10121672 | 3300013104 | Bacteria | 2437 |
| 106 | Ga0157369_10017860 | 3300013105 | Bacteria | 7962 |
| 107 | Ga0157369_10223891 | 3300013105 | Bacteria | 1968 |
| 108 | Ga0157374_10100515 | 3300013296 | Bacteria | 2772 |
| 109 | Ga0157378_10008652 | 3300013297 | Bacteria | 8860 |
| 110 | Ga0163162_11336637 | 3300013306 | Bacteria | 815 |
| 111 | Ga0157372_10222451 | 3300013307 | Bacteria | 2188 |
| 112 | Ga0157372_10636133 | 3300013307 | Bacteria | 1243 |
| 113 | Ga0157375_10105434 | 3300013308 | Bacteria | 2909 |
| 114 | Ga0157375_10192195 | 3300013308 | Bacteria | 2196 |
| 115 | Ga0157375_10895751 | 3300013308 | Bacteria | 1031 |
| 116 | Ga0163163_10089102 | 3300014325 | Bacteria | 3097 |
| 117 | Ga0157379_10116649 | 3300014968 | Bacteria | 2401 |
| 118 | Ga0157379_10204577 | 3300014968 | Bacteria | 1786 |
| 119 | Ga0228711_1021821 | 3300022739 | Bacteria | 5168 |
| 120 | Ga0228710_1000227 | 3300022740 | Bacteria | 59028 |
| 121 | Ga0209050_1014699 | 3300025298 | Bacteria | 3348 |
| 122 | Ga0209257_1000428 | 3300025304 | Bacteria | 80856 |
| 123 | Ga0207642_10008703 | 3300025899 | Bacteria | 3497 |
| 124 | Ga0207710_10004536 | 3300025900 | Bacteria | 6035 |
| 125 | Ga0207710_10048276 | 3300025900 | Bacteria | 1905 |
| 126 | Ga0207680_10070035 | 3300025903 | Bacteria | 2169 |
| 127 | Ga0207680_10100622 | 3300025903 | Bacteria | 1856 |
| 128 | Ga0207685_10015362 | 3300025905 | Bacteria | 2424 |
| 129 | Ga0207699_10124564 | 3300025906 | Bacteria | 1672 |
| 130 | Ga0207645_10003439 | 3300025907 | Bacteria | 12030 |
| 131 | Ga0207643_10045654 | 3300025908 | Bacteria | 2475 |
| 132 | Ga0207654_10100748 | 3300025911 | Bacteria | 1779 |
| 133 | Ga0207654_10244390 | 3300025911 | Bacteria | 1201 |
| 134 | Ga0207707_10006539 | 3300025912 | Bacteria | 10172 |
| 135 | Ga0207707_10042225 | 3300025912 | Bacteria | 3981 |
| 136 | Ga0207695_10004642 | 3300025913 | Bacteria | 18615 |
| 137 | Ga0207695_10134164 | 3300025913 | Bacteria | 2430 |
| 138 | Ga0207671_10082062 | 3300025914 | Bacteria | 2419 |
| 139 | Ga0207671_10304914 | 3300025914 | Bacteria | 1258 |
| 140 | Ga0207671_10358042 | 3300025914 | Bacteria | 1158 |
| 141 | Ga0207671_10526162 | 3300025914 | Bacteria | 943 |
| 142 | Ga0207693_10000554 | 3300025915 | Bacteria | 33783 |
| 143 | Ga0207663_10012405 | 3300025916 | Bacteria | 4608 |
| 144 | Ga0207660_10078262 | 3300025917 | Bacteria | 2423 |
| 145 | Ga0207660_10133459 | 3300025917 | Bacteria | 1892 |
| 146 | Ga0207657_10112449 | 3300025919 | Bacteria | 2247 |
| 147 | Ga0207649_10935946 | 3300025920 | Bacteria | 680 |
| 148 | Ga0207652_10290353 | 3300025921 | Bacteria | 1475 |
| 149 | Ga0207681_10000017 | 3300025923 | Bacteria | 294161 |
| 150 | Ga0207694_10134393 | 3300025924 | Bacteria | 1985 |
| 151 | Ga0207694_10248108 | 3300025924 | Bacteria | 1456 |
| 152 | Ga0207659_10005510 | 3300025926 | Bacteria | 7680 |
| 153 | Ga0207664_10346727 | 3300025929 | Bacteria | 1314 |
| 154 | Ga0207644_10048516 | 3300025931 | Bacteria | 3036 |
| 155 | Ga0207644_10345886 | 3300025931 | Bacteria | 1207 |
| 156 | Ga0207686_10032638 | 3300025934 | Bacteria | 3100 |
| 157 | Ga0207709_10169591 | 3300025935 | Bacteria | 1530 |
| 158 | Ga0207704_10006560 | 3300025938 | Bacteria | 5437 |
| 159 | Ga0207665_10072596 | 3300025939 | Bacteria | 2351 |
| 160 | Ga0207711_10059110 | 3300025941 | Bacteria | 3300 |
| 161 | Ga0207711_10390947 | 3300025941 | Bacteria | 1291 |
| 162 | Ga0207661_10000010 | 3300025944 | Bacteria | 375338 |
| 163 | Ga0207661_10250683 | 3300025944 | Bacteria | 1573 |
| 164 | Ga0207667_10002349 | 3300025949 | Bacteria | 23706 |
| 165 | Ga0207667_10034005 | 3300025949 | Bacteria | 5476 |
| 166 | Ga0207667_10421995 | 3300025949 | Bacteria | 1357 |
| 167 | Ga0207651_10107937 | 3300025960 | Bacteria | 2082 |
| 168 | Ga0207712_10053786 | 3300025961 | Bacteria | 2826 |
| 169 | Ga0207658_10021511 | 3300025986 | Bacteria | 4480 |
| 170 | Ga0207658_10201864 | 3300025986 | Bacteria | 1660 |
| 171 | Ga0207658_10210150 | 3300025986 | Bacteria | 1630 |
| 172 | Ga0207677_10006577 | 3300026023 | Bacteria | 6377 |
| 173 | Ga0207703_10007874 | 3300026035 | Bacteria | 8427 |
| 174 | Ga0207703_10510164 | 3300026035 | Bacteria | 1130 |
| 175 | Ga0207678_10068230 | 3300026067 | Bacteria | 3052 |
| 176 | Ga0207702_10176356 | 3300026078 | Bacteria | 1964 |
| 177 | Ga0207702_10732395 | 3300026078 | Bacteria | 975 |
| 178 | Ga0207641_10001021 | 3300026088 | Bacteria | 28410 |
| 179 | Ga0207641_10248839 | 3300026088 | Bacteria | 1659 |
| 180 | Ga0207648_10145871 | 3300026089 | Bacteria | 2087 |
| 181 | Ga0207648_10384810 | 3300026089 | Bacteria | 1269 |
| 182 | Ga0207676_10370273 | 3300026095 | Bacteria | 1331 |
| 183 | Ga0207674_10100246 | 3300026116 | Bacteria | 2877 |
| 184 | Ga0207674_10195424 | 3300026116 | Bacteria | 1973 |
| 185 | Ga0207683_10017678 | 3300026121 | Bacteria | 6080 |
| 186 | Ga0209281_1000348 | 3300027111 | Bacteria | 76877 |
| 187 | Ga0209282_1000070 | 3300027666 | Bacteria | 85274 |
| 188 | Ga0268266_10012190 | 3300028379 | Bacteria | 7441 |
| 189 | Ga0268266_10063202 | 3300028379 | Bacteria | 3196 |
| 190 | Ga0268266_10881443 | 3300028379 | Bacteria | 865 |
| 191 | Ga0268264_10000200 | 3300028381 | Bacteria | 122063 |
| 192 | Ga0307515_10031623 | 3300028794 | Bacteria | 8813 |
| 193 | Ga0265338_10117159 | 3300028800 | Bacteria | 2132 |
| 194 | Ga0265331_10042757 | 3300031250 | Bacteria | 2197 |
| 195 | Ga0307508_10166722 | 3300031616 | Bacteria | 1806 |
| 196 | Ga0315914_1000082 | 3300031967 | Bacteria | 78317 |
| 197 | Ga0307510_10009306 | 3300033180 | Bacteria | 11707 |
| 198 | Ga0315913_1000028 | 3300033430 | Bacteria | 78319 |
| 199 | Ga0315915_1000004 | 3300033464 | Bacteria | 403083 |
| 200 | Ga0373951_0000658 | 3300035091 | Bacteria | 9500 |
| 201 | Ga0373954_0143484 | 3300035118 | Bacteria | 1165 |
| 202 | Ga0373946_0163667 | 3300035171 | Bacteria | 1046 |
| 203 | Ga0373955_0141097 | 3300035172 | Bacteria | 1413 |
| 204 | Ga0373927_0038327 | 3300035695 | Bacteria | 3112 |
| 205 | Ga0373947_0546736 | 3300035725 | Bacteria | 788 |
| 206 | Ga0373937_0021134 | 3300036401 | Bacteria | 5841 |
| 207 | Ga0373937_0324813 | 3300036401 | Bacteria | 1456 |
| 208 | Ga0373925_0341941 | 3300037068 | Bacteria | 1214 |
| 209 | Ga0373925_0450525 | 3300037068 | Bacteria | 1054 |
| 210 | Ga0395900_0141676 | 3300037418 | Bacteria | 2461 |
| 211 | Ga0395905_0000510 | 3300037471 | Bacteria | 53278 |
| 212 | Ga0395905_0004003 | 3300037471 | Bacteria | 15481 |
| 213 | Ga0395905_0055159 | 3300037471 | Bacteria | 3719 |
| 214 | Ga0436360_1204672 | 3300039438 | Bacteria | 2177 |
| 215 | Ga0451577_0000196 | 3300042876 | Bacteria | 126516 |
| 216 | Ga0466969_0003786 | 3300044656 | Bacteria | 8036 |
| 217 | Ga0466965_0029582 | 3300044683 | Bacteria | 2666 |
| 218 | Ga0466966_0019917 | 3300044684 | Bacteria | 4413 |
| 219 | Ga0466966_0050104 | 3300044684 | Bacteria | 2657 |
| 220 | Ga0466966_0263322 | 3300044684 | Bacteria | 1038 |
| 221 | Ga0453684_0000821 | 3300044712 | Bacteria | 105082 |
| 222 | Ga0466970_0231143 | 3300044765 | Bacteria | 1033 |
| 223 | Ga0466959_0007582 | 3300045049 | Bacteria | 7627 |
| 224 | Ga0466959_0018816 | 3300045049 | Bacteria | 5074 |
| 225 | Ga0466959_0042176 | 3300045049 | Bacteria | 3366 |
| 226 | Ga0466959_0156511 | 3300045049 | Bacteria | 1604 |
| 227 | Ga0451576_0351435 | 3300045051 | Bacteria | 1543 |
| 228 | Ga0451576_1141344 | 3300045051 | Bacteria | 815 |
| 229 | Ga0466958_0313340 | 3300045836 | Bacteria | 1008 |
| 230 | Ga0495580_0003847 | 3300046472 | Bacteria | 12702 |
| 231 | Ga0495580_0076034 | 3300046472 | Bacteria | 2342 |
| 232 | Ga0495652_0341180 | 3300046529 | Bacteria | 1076 |
| 233 | Ga0495652_0709418 | 3300046529 | Bacteria | 676 |
| 234 | Ga0495657_0015759 | 3300046675 | Bacteria | 5523 |
| 235 | Ga0495672_0007702 | 3300047320 | Bacteria | 8062 |
| 236 | Ga0495676_0518650 | 3300047321 | Bacteria | 781 |
| 237 | Ga0495683_0173684 | 3300047323 | Bacteria | 989 |
| 238 | Ga0495687_000121 | 3300047443 | Bacteria | 120336 |
| 239 | Ga0495686_0347753 | 3300047472 | Bacteria | 807 |
| 240 | Ga0495602_0560393 | 3300048088 | Unclassified | 791 |
| 241 | Ga0496100_0161561 | 3300048903 | Bacteria | 1606 |
| 242 | Ga0496101_0017712 | 3300048904 | Bacteria | 4831 |
| 243 | Ga0496101_0425233 | 3300048904 | Bacteria | 1047 |
| 244 | Ga0496102_0095929 | 3300048905 | Bacteria | 2749 |
| 245 | Ga0496103_0188592 | 3300048906 | Bacteria | 1325 |
| 246 | Ga0496104_0112226 | 3300048907 | Bacteria | 2614 |
| 247 | Ga0496104_0607760 | 3300048907 | Bacteria | 1003 |
| 248 | Ga0496105_0459813 | 3300048908 | Bacteria | 1003 |
| 249 | Ga0496108_0010699 | 3300048911 | Bacteria | 7444 |
| 250 | Ga0496109_0118312 | 3300048912 | Bacteria | 2466 |
| 251 | Ga0496110_0018270 | 3300048913 | Bacteria | 5878 |
| 252 | Ga0496112_0388878 | 3300048915 | Bacteria | 1335 |
| 253 | Ga0496114_0016930 | 3300048917 | Bacteria | 5878 |
| 254 | Ga0496115_0001057 | 3300048918 | Bacteria | 19957 |
| 255 | Ga0496115_0009395 | 3300048918 | Bacteria | 7267 |
| 256 | Ga0496115_0273357 | 3300048918 | Bacteria | 1388 |
| 257 | Ga0496116_0000100 | 3300048919 | Bacteria | 194740 |
| 258 | Ga0496117_0079828 | 3300048920 | Bacteria | 2154 |
| 259 | Ga0496118_0015405 | 3300048921 | Bacteria | 7078 |
| 260 | Ga0496118_0036776 | 3300048921 | Bacteria | 3952 |
| 261 | Ga0496118_0041597 | 3300048921 | Bacteria | 3636 |
| 262 | Ga0496121_0002328 | 3300048924 | Bacteria | 29355 |
| 263 | Ga0496121_0271667 | 3300048924 | Bacteria | 1165 |
| 264 | Ga0496122_0004142 | 3300048925 | Bacteria | 18314 |
| 265 | Ga0496123_0053744 | 3300048926 | Bacteria | 2659 |
| 266 | Ga0496124_0393861 | 3300048927 | Bacteria | 964 |
| 267 | Ga0496125_0004854 | 3300048928 | Bacteria | 15263 |
| 268 | Ga0496126_0000311 | 3300048929 | Bacteria | 103353 |
| 269 | Ga0496126_0004169 | 3300048929 | Bacteria | 17445 |
| 270 | Ga0496126_0186186 | 3300048929 | Bacteria | 1761 |
| 271 | Ga0501032_0914289 | 3300049569 | Bacteria | 552 |
| 272 | Ga0501034_0000056 | 3300049571 | Bacteria | 202540 |
| 273 | Ga0501034_0002152 | 3300049571 | Bacteria | 24462 |
| 274 | Ga0501034_0095817 | 3300049571 | Bacteria | 2964 |
| 275 | Ga0501043_0177978 | 3300049579 | Bacteria | 1658 |
| 276 | Ga0501043_0639831 | 3300049579 | Bacteria | 782 |
| 277 | Ga0501046_0215452 | 3300049580 | Bacteria | 1424 |
| 278 | Ga0501047_0003323 | 3300049581 | Bacteria | 15230 |
| 279 | Ga0501068_0000394 | 3300049584 | Bacteria | 22113 |
| 280 | Ga0501069_0000211 | 3300049585 | Bacteria | 25989 |
| 281 | Ga0501070_0596913 | 3300049586 | Bacteria | 880 |
| 282 | Ga0501072_0000016 | 3300049588 | Bacteria | 165259 |
| 283 | Ga0501079_0005386 | 3300049741 | Bacteria | 9528 |
| 284 | Ga0501083_0005162 | 3300049744 | Bacteria | 9239 |
| 285 | Ga0501035_0165847 | 3300049822 | Bacteria | 1910 |
| 286 | Ga0501044_0128847 | 3300049823 | Bacteria | 2525 |
| 287 | Ga0501044_0350853 | 3300049823 | Bacteria | 1395 |
| 288 | Ga0501044_0514509 | 3300049823 | Bacteria | 1097 |
| 289 | nmdc:mga0n895_384342_c1 | 3300050512 | Bacteria | 1420 |
| 290 | nmdc:mga08x19_168393_c1 | 3300050514 | Bacteria | 1491 |
| 291 | Ga0495595_0080202 | 3300053084 | Bacteria | 1553 |
| 292 | Ga0500616_0060331 | 3300053153 | Bacteria | 1966 |
| 293 | Ga0500636_0000011 | 3300053177 | Bacteria | 140769 |
| 294 | Ga0500637_0225735 | 3300053178 | Bacteria | 1057 |
| 295 | Ga0500637_0239413 | 3300053178 | Bacteria | 1018 |
| 296 | Ga0501084_0000028 | 3300054114 | Bacteria | 124129 |
| 297 | Ga0530510_0030502 | 3300061734 | Bacteria | 3873 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009092 | Ga0105250_10058157 | Ga0105250_100581572 | 155 |
| 2 | 3300009101 | Ga0105247_10011794 | Ga0105247_100117943 | 155 |
| 3 | 3300009176 | Ga0105242_10006532 | Ga0105242_100065323 | 155 |
| 4 | 3300009553 | Ga0105249_10428581 | Ga0105249_104285812 | 155 |
| 5 | 3300013296 | Ga0157374_10100515 | Ga0157374_101005152 | 155 |
| 6 | 3300013308 | Ga0157375_10192195 | Ga0157375_101921951 | 155 |
| 7 | 3300035118 | Ga0373954_0143484 | Ga0373954_0143484_457_987 | 155 |
| 8 | 3300035171 | Ga0373946_0163667 | Ga0373946_0163667_86_616 | 155 |
| 9 | 3300035172 | Ga0373955_0141097 | Ga0373955_0141097_707_1237 | 155 |
| 10 | 3300035695 | Ga0373927_0038327 | Ga0373927_0038327_2090_2620 | 155 |
| 11 | 3300036401 | Ga0373937_0021134 | Ga0373937_0021134_2122_2652 | 155 |
| 12 | 3300037068 | Ga0373925_0450525 | Ga0373925_0450525_394_924 | 155 |
| 13 | 3300046472 | Ga0495580_0076034 | Ga0495580_0076034_1124_1654 | 155 |
| 14 | 3300046529 | Ga0495652_0341180 | Ga0495652_0341180_238_768 | 155 |
| 15 | 3300048906 | Ga0496103_0188592 | Ga0496103_0188592_525_1055 | 155 |
| 16 | 3300048907 | Ga0496104_0607760 | Ga0496104_0607760_53_583 | 155 |
| 17 | 3300048908 | Ga0496105_0459813 | Ga0496105_0459813_181_711 | 155 |
| 18 | 3300048911 | Ga0496108_0010699 | Ga0496108_0010699_3321_3851 | 155 |
| 19 | 3300048912 | Ga0496109_0118312 | Ga0496109_0118312_697_1227 | 155 |
| 20 | 3300048913 | Ga0496110_0018270 | Ga0496110_0018270_2114_2644 | 155 |
| 21 | 3300048915 | Ga0496112_0388878 | Ga0496112_0388878_69_599 | 155 |
| 22 | 3300048917 | Ga0496114_0016930 | Ga0496114_0016930_1480_2010 | 155 |
| 23 | 3300048918 | Ga0496115_0001057 | Ga0496115_0001057_14259_14789 | 155 |
| 24 | 3300005458 | Ga0070681_10004054 | Ga0070681_100040547 | 164 |
| 25 | 3300005530 | Ga0070679_100036783 | Ga0070679_1000367833 | 164 |
| 26 | 3300005563 | Ga0068855_100013474 | Ga0068855_1000134745 | 164 |
| 27 | 3300009093 | Ga0105240_10008007 | Ga0105240_100080078 | 164 |
| 28 | 3300025912 | Ga0207707_10006539 | Ga0207707_100065396 | 164 |
| 29 | 3300025921 | Ga0207652_10290353 | Ga0207652_102903532 | 164 |
| 30 | 3300025949 | Ga0207667_10421995 | Ga0207667_104219952 | 164 |
| 31 | 3300005336 | Ga0070680_100011576 | Ga0070680_1000115763 | 166 |
| 32 | 3300005614 | Ga0068856_100368610 | Ga0068856_1003686102 | 166 |
| 33 | 3300009551 | Ga0105238_10313720 | Ga0105238_103137202 | 166 |
| 34 | 3300013105 | Ga0157369_10223891 | Ga0157369_102238912 | 166 |
| 35 | 3300045049 | Ga0466959_0156511 | Ga0466959_0156511_786_1454 | 168 |
| 36 | 3300005329 | Ga0070683_100041760 | Ga0070683_1000417601 | 169 |
| 37 | 3300005335 | Ga0070666_10007357 | Ga0070666_100073572 | 169 |
| 38 | 3300005459 | Ga0068867_100263027 | Ga0068867_1002630271 | 169 |
| 39 | 3300005543 | Ga0070672_100291816 | Ga0070672_1002918162 | 169 |
| 40 | 3300005544 | Ga0070686_100129001 | Ga0070686_1001290012 | 169 |
| 41 | 3300005548 | Ga0070665_100036805 | Ga0070665_1000368053 | 169 |
| 42 | 3300005841 | Ga0068863_100025565 | Ga0068863_1000255653 | 169 |
| 43 | 3300013105 | Ga0157369_10017860 | Ga0157369_100178604 | 169 |
| 44 | 3300013307 | Ga0157372_10636133 | Ga0157372_106361331 | 169 |
| 45 | 3300025900 | Ga0207710_10048276 | Ga0207710_100482762 | 169 |
| 46 | 3300025941 | Ga0207711_10059110 | Ga0207711_100591102 | 169 |
| 47 | 3300025960 | Ga0207651_10107937 | Ga0207651_101079372 | 169 |
| 48 | 3300026035 | Ga0207703_10510164 | Ga0207703_105101642 | 169 |
| 49 | 3300026088 | Ga0207641_10248839 | Ga0207641_102488392 | 169 |
| 50 | 3300026089 | Ga0207648_10384810 | Ga0207648_103848102 | 169 |
| 51 | 3300028379 | Ga0268266_10881443 | Ga0268266_108814432 | 169 |
| 52 | 3300028794 | Ga0307515_10031623 | Ga0307515_100316238 | 170 |
| 53 | 3300048920 | Ga0496117_0079828 | Ga0496117_0079828_471_1040 | 170 |
| 54 | 3300048926 | Ga0496123_0053744 | Ga0496123_0053744_417_986 | 170 |
| 55 | 3300003323 | rootH1_10306602 | rootH1_103066021 | 171 |
| 56 | 3300005329 | Ga0070683_100007866 | Ga0070683_1000078666 | 172 |
| 57 | 3300005336 | Ga0070680_100212683 | Ga0070680_1002126832 | 172 |
| 58 | 3300005458 | Ga0070681_10174440 | Ga0070681_101744402 | 172 |
| 59 | 3300005535 | Ga0070684_100042361 | Ga0070684_1000423612 | 172 |
| 60 | 3300009551 | Ga0105238_10526451 | Ga0105238_105264512 | 172 |
| 61 | 3300025912 | Ga0207707_10042225 | Ga0207707_100422252 | 172 |
| 62 | 3300025917 | Ga0207660_10133459 | Ga0207660_101334592 | 172 |
| 63 | 3300025944 | Ga0207661_10250683 | Ga0207661_102506832 | 172 |
| 64 | 3300047320 | Ga0495672_0007702 | Ga0495672_0007702_4417_5022 | 172 |
| 65 | 3300025961 | Ga0207712_10053786 | Ga0207712_100537862 | 173 |
| 66 | 3300033180 | Ga0307510_10009306 | Ga0307510_100093063 | 173 |
| 67 | 3300037418 | Ga0395900_0141676 | Ga0395900_0141676_1151_1726 | 173 |
| 68 | 3300037471 | Ga0395905_0055159 | Ga0395905_0055159_153_728 | 173 |
| 69 | 3300049569 | Ga0501032_0914289 | Ga0501032_0914289_14_535 | 173 |
| 70 | 3300049571 | Ga0501034_0000056 | Ga0501034_0000056_105379_106017 | 173 |
| 71 | 3300009093 | Ga0105240_10116497 | Ga0105240_101164971 | 174 |
| 72 | 3300009098 | Ga0105245_10020265 | Ga0105245_100202652 | 174 |
| 73 | 3300009174 | Ga0105241_10005253 | Ga0105241_100052536 | 174 |
| 74 | 3300009177 | Ga0105248_10044969 | Ga0105248_100449693 | 174 |
| 75 | 3300009545 | Ga0105237_10026415 | Ga0105237_100264156 | 174 |
| 76 | 3300010375 | Ga0105239_10067355 | Ga0105239_100673552 | 174 |
| 77 | 3300013102 | Ga0157371_10844572 | Ga0157371_108445722 | 174 |
| 78 | 3300013297 | Ga0157378_10008652 | Ga0157378_100086525 | 174 |
| 79 | 3300046472 | Ga0495580_0003847 | Ga0495580_0003847_8168_8698 | 174 |
| 80 | 3300046529 | Ga0495652_0709418 | Ga0495652_0709418_25_549 | 174 |
| 81 | 3300047472 | Ga0495686_0347753 | Ga0495686_0347753_262_789 | 174 |
| 82 | 3300048903 | Ga0496100_0161561 | Ga0496100_0161561_785_1315 | 174 |
| 83 | 3300048904 | Ga0496101_0017712 | Ga0496101_0017712_3881_4411 | 174 |
| 84 | 3300048905 | Ga0496102_0095929 | Ga0496102_0095929_1229_1759 | 174 |
| 85 | 3300048918 | Ga0496115_0273357 | Ga0496115_0273357_46_621 | 174 |
| 86 | 3300048929 | Ga0496126_0004169 | Ga0496126_0004169_15592_16167 | 174 |
| 87 | 3300048088 | Ga0495602_0560393 | Ga0495602_0560393_55_627 | 175 |
| 88 | 3300053178 | Ga0500637_0239413 | Ga0500637_0239413_11_565 | 175 |
| 89 | 3300005455 | Ga0070663_100450562 | Ga0070663_1004505621 | 176 |
| 90 | 3300005614 | Ga0068856_100166618 | Ga0068856_1001666182 | 176 |
| 91 | 3300005841 | Ga0068863_100013514 | Ga0068863_1000135142 | 176 |
| 92 | 3300005843 | Ga0068860_100010201 | Ga0068860_1000102012 | 176 |
| 93 | 3300006237 | Ga0097621_100322510 | Ga0097621_1003225102 | 176 |
| 94 | 3300009093 | Ga0105240_10581970 | Ga0105240_105819702 | 176 |
| 95 | 3300009545 | Ga0105237_10272911 | Ga0105237_102729112 | 176 |
| 96 | 3300010375 | Ga0105239_10208439 | Ga0105239_102084392 | 176 |
| 97 | 3300025914 | Ga0207671_10526162 | Ga0207671_105261622 | 176 |
| 98 | 3300026078 | Ga0207702_10732395 | Ga0207702_107323952 | 176 |
| 99 | 3300026088 | Ga0207641_10001021 | Ga0207641_100010213 | 176 |
| 100 | 3300028381 | Ga0268264_10000200 | Ga0268264_100002002 | 176 |
| 101 | 3300048929 | Ga0496126_0186186 | Ga0496126_0186186_907_1494 | 176 |
| 102 | 3300005353 | Ga0070669_100000007 | Ga0070669_100000007142 | 177 |
| 103 | 3300005539 | Ga0068853_100764942 | Ga0068853_1007649421 | 177 |
| 104 | 3300005563 | Ga0068855_100226400 | Ga0068855_1002264002 | 177 |
| 105 | 3300005617 | Ga0068859_100019247 | Ga0068859_1000192477 | 177 |
| 106 | 3300005842 | Ga0068858_100090130 | Ga0068858_1000901302 | 177 |
| 107 | 3300006931 | Ga0097620_100019247 | Ga0097620_1000192477 | 177 |
| 108 | 3300009545 | Ga0105237_10586043 | Ga0105237_105860432 | 177 |
| 109 | 3300009551 | Ga0105238_10161023 | Ga0105238_101610232 | 177 |
| 110 | 3300010375 | Ga0105239_10559925 | Ga0105239_105599252 | 177 |
| 111 | 3300010375 | Ga0105239_11271523 | Ga0105239_112715232 | 177 |
| 112 | 3300014325 | Ga0163163_10089102 | Ga0163163_100891022 | 177 |
| 113 | 3300014968 | Ga0157379_10116649 | Ga0157379_101166492 | 177 |
| 114 | 3300025900 | Ga0207710_10004536 | Ga0207710_100045362 | 177 |
| 115 | 3300025911 | Ga0207654_10244390 | Ga0207654_102443902 | 177 |
| 116 | 3300025914 | Ga0207671_10304914 | Ga0207671_103049142 | 177 |
| 117 | 3300025923 | Ga0207681_10000017 | Ga0207681_1000001759 | 177 |
| 118 | 3300025924 | Ga0207694_10248108 | Ga0207694_102481082 | 177 |
| 119 | 3300025931 | Ga0207644_10345886 | Ga0207644_103458862 | 177 |
| 120 | 3300025941 | Ga0207711_10390947 | Ga0207711_103909471 | 177 |
| 121 | 3300026035 | Ga0207703_10007874 | Ga0207703_100078743 | 177 |
| 122 | 3300026067 | Ga0207678_10068230 | Ga0207678_100682302 | 177 |
| 123 | 3300026095 | Ga0207676_10370273 | Ga0207676_103702732 | 177 |
| 124 | 3300048904 | Ga0496101_0425233 | Ga0496101_0425233_368_964 | 177 |
| 125 | 3300048921 | Ga0496118_0036776 | Ga0496118_0036776_3129_3725 | 177 |
| 126 | 3300048928 | Ga0496125_0004854 | Ga0496125_0004854_9045_9641 | 177 |
| 127 | 3300005367 | Ga0070667_100083420 | Ga0070667_1000834202 | 178 |
| 128 | 3300025986 | Ga0207658_10021511 | Ga0207658_100215112 | 178 |
| 129 | 3300031616 | Ga0307508_10166722 | Ga0307508_101667222 | 179 |
| 130 | 3300025903 | Ga0207680_10070035 | Ga0207680_100700352 | 180 |
| 131 | 3300005548 | Ga0070665_100084818 | Ga0070665_1000848182 | 181 |
| 132 | 3300028379 | Ga0268266_10063202 | Ga0268266_100632022 | 181 |
| 133 | 3300044684 | Ga0466966_0263322 | Ga0466966_0263322_366_1019 | 181 |
| 134 | 3300045836 | Ga0466958_0313340 | Ga0466958_0313340_137_790 | 181 |
| 135 | 3300046675 | Ga0495657_0015759 | Ga0495657_0015759_3469_4071 | 181 |
| 136 | 3300048919 | Ga0496116_0000100 | Ga0496116_0000100_84092_84661 | 181 |
| 137 | 3300048929 | Ga0496126_0000311 | Ga0496126_0000311_3151_3720 | 181 |
| 138 | 3300049579 | Ga0501043_0177978 | Ga0501043_0177978_393_971 | 181 |
| 139 | 3300049580 | Ga0501046_0215452 | Ga0501046_0215452_350_928 | 181 |
| 140 | 3300049822 | Ga0501035_0165847 | Ga0501035_0165847_67_645 | 181 |
| 141 | 3300049823 | Ga0501044_0128847 | Ga0501044_0128847_651_1229 | 181 |
| 142 | 3300053084 | Ga0495595_0080202 | Ga0495595_0080202_107_709 | 181 |
| 143 | 3300049571 | Ga0501034_0095817 | Ga0501034_0095817_138_740 | 182 |
| 144 | 3300049823 | Ga0501044_0350853 | Ga0501044_0350853_38_640 | 182 |
| 145 | 3300053153 | Ga0500616_0060331 | Ga0500616_0060331_675_1283 | 182 |
| 146 | 3300037471 | Ga0395905_0000510 | Ga0395905_0000510_21441_22010 | 183 |
| 147 | 3300005328 | Ga0070676_10015637 | Ga0070676_100156372 | 184 |
| 148 | 3300005331 | Ga0070670_100026369 | Ga0070670_1000263692 | 184 |
| 149 | 3300005334 | Ga0068869_100098125 | Ga0068869_1000981252 | 184 |
| 150 | 3300005338 | Ga0068868_100146218 | Ga0068868_1001462182 | 184 |
| 151 | 3300005367 | Ga0070667_100107310 | Ga0070667_1001073102 | 184 |
| 152 | 3300005459 | Ga0068867_100100186 | Ga0068867_1001001862 | 184 |
| 153 | 3300005577 | Ga0068857_100126840 | Ga0068857_1001268402 | 184 |
| 154 | 3300005840 | Ga0068870_10040148 | Ga0068870_100401482 | 184 |
| 155 | 3300006881 | Ga0068865_100140738 | Ga0068865_1001407382 | 184 |
| 156 | 3300009093 | Ga0105240_10005746 | Ga0105240_100057462 | 184 |
| 157 | 3300009551 | Ga0105238_10128763 | Ga0105238_101287632 | 184 |
| 158 | 3300013307 | Ga0157372_10222451 | Ga0157372_102224512 | 184 |
| 159 | 3300013308 | Ga0157375_10105434 | Ga0157375_101054342 | 184 |
| 160 | 3300025907 | Ga0207645_10003439 | Ga0207645_100034394 | 184 |
| 161 | 3300025908 | Ga0207643_10045654 | Ga0207643_100456542 | 184 |
| 162 | 3300025926 | Ga0207659_10005510 | Ga0207659_100055102 | 184 |
| 163 | 3300025935 | Ga0207709_10169591 | Ga0207709_101695912 | 184 |
| 164 | 3300025938 | Ga0207704_10006560 | Ga0207704_100065602 | 184 |
| 165 | 3300025986 | Ga0207658_10210150 | Ga0207658_102101502 | 184 |
| 166 | 3300026023 | Ga0207677_10006577 | Ga0207677_100065775 | 184 |
| 167 | 3300026089 | Ga0207648_10145871 | Ga0207648_101458712 | 184 |
| 168 | 3300026116 | Ga0207674_10100246 | Ga0207674_101002462 | 184 |
| 169 | 3300047321 | Ga0495676_0518650 | Ga0495676_0518650_60_665 | 184 |
| 170 | 3300013308 | Ga0157375_10895751 | Ga0157375_108957512 | 185 |
| 171 | 3300039438 | Ga0436360_1204672 | Ga0436360_1204672_538_1101 | 185 |
| 172 | iso_pu_bacteria | 2512875026 | 2512975084 | 185 |
| 173 | iso_pu_bacteria | 2513237089 | 2513605122 | 185 |
| 174 | iso_pu_bacteria | 2513237156 | 2513987580 | 185 |
| 175 | iso_pu_bacteria | 2513237160 | 2514007847 | 185 |
| 176 | iso_pu_bacteria | 2517487022 | 2517567728 | 185 |
| 177 | iso_pu_bacteria | 2802428858 | 2802721056 | 185 |
| 178 | iso_pu_bacteria | 2802428859 | 2802728145 | 185 |
| 179 | iso_pu_bacteria | 2802428860 | 2802733611 | 185 |
| 180 | iso_pu_bacteria | 2802428861 | 2802736646 | 185 |
| 181 | iso_pu_bacteria | 2802428862 | 2802746713 | 185 |
| 182 | iso_pu_bacteria | 2802428863 | 2802749789 | 185 |
| 183 | iso_pu_bacteria | 2915980308 | 2915986733 | 185 |
| 184 | iso_pu_bacteria | 2916061851 | 2916064143 | 185 |
| 185 | iso_pu_bacteria | 2919166419 | 2919166778 | 185 |
| 186 | iso_pu_bacteria | 2921250672 | 2921254061 | 185 |
| 187 | iso_pu_bacteria | 2937029754 | 2937035471 | 185 |
| 188 | iso_pu_bacteria | 2937036028 | 2937039940 | 185 |
| 189 | iso_pu_bacteria | 2937078374 | 2937078963 | 185 |
| 190 | iso_pu_bacteria | 2937084907 | 2937087497 | 185 |
| 191 | iso_pu_bacteria | 2957375807 | 2957376312 | 185 |
| 192 | iso_pu_bacteria | 2957437181 | 2957440486 | 185 |
| 193 | iso_pu_bacteria | 2960591022 | 2960597391 | 185 |
| 194 | iso_pu_bacteria | 2960631154 | 2960636584 | 185 |
| 195 | iso_pu_bacteria | 2960680706 | 2960686094 | 185 |
| 196 | iso_pu_bacteria | 2960693952 | 2960695798 | 185 |
| 197 | iso_pu_bacteria | 2967686174 | 2967690966 | 185 |
| 198 | iso_pu_bacteria | 2967728569 | 2967733714 | 185 |
| 199 | iso_pu_bacteria | 2970026789 | 2970029055 | 185 |
| 200 | iso_pu_bacteria | 2970122695 | 2970125149 | 185 |
| 201 | iso_pu_bacteria | 2970143518 | 2970148056 | 185 |
| 202 | iso_pu_bacteria | 2977530762 | 2977533397 | 185 |
| 203 | iso_pu_bacteria | 2977544691 | 2977548847 | 185 |
| 204 | iso_pu_bacteria | 2978969890 | 2978973194 | 185 |
| 205 | iso_pu_bacteria | 2984587000 | 2984591443 | 185 |
| 206 | iso_pu_bacteria | 8003999396 | 8004005274 | 185 |
| 207 | iso_pu_bacteria | 8018150411 | 8018150762 | 185 |
| 208 | iso_pu_bacteria | 8054460903 | 8054464528 | 185 |
| 209 | iso_pu_bacteria | 8002745576 | 8002750024 | 186 |
| 210 | 3300003794 | Ga0055531_10021549 | Ga0055531_100215492 | 187 |
| 211 | 3300005439 | Ga0070711_100546848 | Ga0070711_1005468481 | 187 |
| 212 | 3300009553 | Ga0105249_10601079 | Ga0105249_106010792 | 187 |
| 213 | 3300025298 | Ga0209050_1014699 | Ga0209050_10146992 | 187 |
| 214 | 3300025304 | Ga0209257_1000428 | Ga0209257_100042868 | 187 |
| 215 | 3300036401 | Ga0373937_0324813 | Ga0373937_0324813_129_725 | 187 |
| 216 | 3300048921 | Ga0496118_0015405 | Ga0496118_0015405_835_1422 | 187 |
| 217 | 3300048924 | Ga0496121_0002328 | Ga0496121_0002328_20022_20609 | 187 |
| 218 | 3300049571 | Ga0501034_0002152 | Ga0501034_0002152_20205_20768 | 187 |
| 219 | 3300049586 | Ga0501070_0596913 | Ga0501070_0596913_236_832 | 187 |
| 220 | 3300005330 | Ga0070690_100079218 | Ga0070690_1000792182 | 188 |
| 221 | 3300005334 | Ga0068869_100175022 | Ga0068869_1001750222 | 188 |
| 222 | 3300005336 | Ga0070680_100100777 | Ga0070680_1001007772 | 188 |
| 223 | 3300005338 | Ga0068868_100019389 | Ga0068868_1000193892 | 188 |
| 224 | 3300005355 | Ga0070671_100034370 | Ga0070671_1000343702 | 188 |
| 225 | 3300005367 | Ga0070667_100066711 | Ga0070667_1000667112 | 188 |
| 226 | 3300005434 | Ga0070709_10598330 | Ga0070709_105983302 | 188 |
| 227 | 3300005435 | Ga0070714_100222822 | Ga0070714_1002228222 | 188 |
| 228 | 3300005435 | Ga0070714_100931169 | Ga0070714_1009311692 | 188 |
| 229 | 3300005436 | Ga0070713_100002189 | Ga0070713_10000218911 | 188 |
| 230 | 3300005437 | Ga0070710_10008578 | Ga0070710_100085782 | 188 |
| 231 | 3300005439 | Ga0070711_100027053 | Ga0070711_1000270532 | 188 |
| 232 | 3300005456 | Ga0070678_100003645 | Ga0070678_1000036455 | 188 |
| 233 | 3300005563 | Ga0068855_100001240 | Ga0068855_10000124011 | 188 |
| 234 | 3300005614 | Ga0068856_100286029 | Ga0068856_1002860292 | 188 |
| 235 | 3300005617 | Ga0068859_100098763 | Ga0068859_1000987632 | 188 |
| 236 | 3300005718 | Ga0068866_10008057 | Ga0068866_100080572 | 188 |
| 237 | 3300005842 | Ga0068858_100019933 | Ga0068858_1000199332 | 188 |
| 238 | 3300006163 | Ga0070715_10010850 | Ga0070715_100108502 | 188 |
| 239 | 3300006175 | Ga0070712_100042372 | Ga0070712_1000423723 | 188 |
| 240 | 3300006237 | Ga0097621_100214480 | Ga0097621_1002144802 | 188 |
| 241 | 3300006358 | Ga0068871_100270121 | Ga0068871_1002701212 | 188 |
| 242 | 3300006881 | Ga0068865_100024111 | Ga0068865_1000241112 | 188 |
| 243 | 3300006914 | Ga0075436_100064683 | Ga0075436_1000646834 | 188 |
| 244 | 3300006931 | Ga0097620_100098761 | Ga0097620_1000987612 | 188 |
| 245 | 3300009093 | Ga0105240_10354300 | Ga0105240_103543002 | 188 |
| 246 | 3300009551 | Ga0105238_10152591 | Ga0105238_101525912 | 188 |
| 247 | 3300010375 | Ga0105239_10015203 | Ga0105239_100152033 | 188 |
| 248 | 3300025899 | Ga0207642_10008703 | Ga0207642_100087032 | 188 |
| 249 | 3300025903 | Ga0207680_10100622 | Ga0207680_101006222 | 188 |
| 250 | 3300025905 | Ga0207685_10015362 | Ga0207685_100153622 | 188 |
| 251 | 3300025906 | Ga0207699_10124564 | Ga0207699_101245642 | 188 |
| 252 | 3300025911 | Ga0207654_10100748 | Ga0207654_101007483 | 188 |
| 253 | 3300025913 | Ga0207695_10004642 | Ga0207695_100046425 | 188 |
| 254 | 3300025913 | Ga0207695_10134164 | Ga0207695_101341642 | 188 |
| 255 | 3300025914 | Ga0207671_10082062 | Ga0207671_100820622 | 188 |
| 256 | 3300025914 | Ga0207671_10358042 | Ga0207671_103580422 | 188 |
| 257 | 3300025915 | Ga0207693_10000554 | Ga0207693_100005545 | 188 |
| 258 | 3300025916 | Ga0207663_10012405 | Ga0207663_100124053 | 188 |
| 259 | 3300025920 | Ga0207649_10935946 | Ga0207649_109359461 | 188 |
| 260 | 3300025924 | Ga0207694_10134393 | Ga0207694_101343932 | 188 |
| 261 | 3300025929 | Ga0207664_10346727 | Ga0207664_103467271 | 188 |
| 262 | 3300025931 | Ga0207644_10048516 | Ga0207644_100485162 | 188 |
| 263 | 3300025934 | Ga0207686_10032638 | Ga0207686_100326382 | 188 |
| 264 | 3300025939 | Ga0207665_10072596 | Ga0207665_100725962 | 188 |
| 265 | 3300025949 | Ga0207667_10002349 | Ga0207667_1000234912 | 188 |
| 266 | 3300025986 | Ga0207658_10201864 | Ga0207658_102018642 | 188 |
| 267 | 3300026078 | Ga0207702_10176356 | Ga0207702_101763562 | 188 |
| 268 | 3300026121 | Ga0207683_10017678 | Ga0207683_100176783 | 188 |
| 269 | 3300028379 | Ga0268266_10012190 | Ga0268266_100121904 | 188 |
| 270 | 3300028800 | Ga0265338_10117159 | Ga0265338_101171592 | 188 |
| 271 | 3300031250 | Ga0265331_10042757 | Ga0265331_100427572 | 188 |
| 272 | 3300044656 | Ga0466969_0003786 | Ga0466969_0003786_187_765 | 188 |
| 273 | 3300044684 | Ga0466966_0019917 | Ga0466966_0019917_1476_2054 | 188 |
| 274 | 3300045049 | Ga0466959_0018816 | Ga0466959_0018816_750_1322 | 188 |
| 275 | 3300045049 | Ga0466959_0042176 | Ga0466959_0042176_1156_1734 | 188 |
| 276 | 3300045051 | Ga0451576_1141344 | Ga0451576_1141344_109_708 | 188 |
| 277 | 3300048907 | Ga0496104_0112226 | Ga0496104_0112226_1565_2140 | 188 |
| 278 | 3300048918 | Ga0496115_0009395 | Ga0496115_0009395_4795_5370 | 188 |
| 279 | 3300050512 | nmdc:mga0n895_384342_c1 | nmdc:mga0n895_384342_c1_420_992 | 188 |
| 280 | 3300050514 | nmdc:mga08x19_168393_c1 | nmdc:mga08x19_168393_c1_147_719 | 188 |
| 281 | 3300053178 | Ga0500637_0225735 | Ga0500637_0225735_350_922 | 188 |
| 282 | 3300003323 | rootH1_10211231 | rootH1_102112312 | 189 |
| 283 | 3300005329 | Ga0070683_100000007 | Ga0070683_10000000736 | 189 |
| 284 | 3300005339 | Ga0070660_100042504 | Ga0070660_1000425042 | 189 |
| 285 | 3300005341 | Ga0070691_10009196 | Ga0070691_100091962 | 189 |
| 286 | 3300005535 | Ga0070684_100000021 | Ga0070684_10000002182 | 189 |
| 287 | 3300005563 | Ga0068855_100040675 | Ga0068855_1000406753 | 189 |
| 288 | 3300005577 | Ga0068857_100040227 | Ga0068857_1000402272 | 189 |
| 289 | 3300005614 | Ga0068856_100285160 | Ga0068856_1002851602 | 189 |
| 290 | 3300006946 | Ga0079104_1003013 | Ga0079104_10030133 | 189 |
| 291 | 3300013104 | Ga0157370_10121672 | Ga0157370_101216722 | 189 |
| 292 | 3300022739 | Ga0228711_1021821 | Ga0228711_10218213 | 189 |
| 293 | 3300022740 | Ga0228710_1000227 | Ga0228710_10002276 | 189 |
| 294 | 3300025917 | Ga0207660_10078262 | Ga0207660_100782622 | 189 |
| 295 | 3300025919 | Ga0207657_10112449 | Ga0207657_101124492 | 189 |
| 296 | 3300025944 | Ga0207661_10000010 | Ga0207661_1000001036 | 189 |
| 297 | 3300025949 | Ga0207667_10034005 | Ga0207667_100340053 | 189 |
| 298 | 3300026116 | Ga0207674_10195424 | Ga0207674_101954243 | 189 |
| 299 | 3300027111 | Ga0209281_1000348 | Ga0209281_100034850 | 189 |
| 300 | 3300027666 | Ga0209282_1000070 | Ga0209282_100007025 | 189 |
| 301 | 3300031967 | Ga0315914_1000082 | Ga0315914_100008227 | 189 |
| 302 | 3300033430 | Ga0315913_1000028 | Ga0315913_100002826 | 189 |
| 303 | 3300033464 | Ga0315915_1000004 | Ga0315915_100000427 | 189 |
| 304 | 3300037471 | Ga0395905_0004003 | Ga0395905_0004003_4112_4681 | 189 |
| 305 | 3300042876 | Ga0451577_0000196 | Ga0451577_0000196_64237_64821 | 189 |
| 306 | 3300044683 | Ga0466965_0029582 | Ga0466965_0029582_1858_2433 | 189 |
| 307 | 3300044684 | Ga0466966_0050104 | Ga0466966_0050104_164_739 | 189 |
| 308 | 3300044712 | Ga0453684_0000821 | Ga0453684_0000821_42465_43049 | 189 |
| 309 | 3300044765 | Ga0466970_0231143 | Ga0466970_0231143_126_701 | 189 |
| 310 | 3300045049 | Ga0466959_0007582 | Ga0466959_0007582_232_807 | 189 |
| 311 | 3300045051 | Ga0451576_0351435 | Ga0451576_0351435_817_1401 | 189 |
| 312 | 3300047323 | Ga0495683_0173684 | Ga0495683_0173684_348_923 | 189 |
| 313 | 3300047443 | Ga0495687_000121 | Ga0495687_000121_111298_111873 | 189 |
| 314 | 3300048921 | Ga0496118_0041597 | Ga0496118_0041597_20_589 | 189 |
| 315 | 3300048924 | Ga0496121_0271667 | Ga0496121_0271667_346_915 | 189 |
| 316 | 3300048925 | Ga0496122_0004142 | Ga0496122_0004142_7683_8252 | 189 |
| 317 | 3300048927 | Ga0496124_0393861 | Ga0496124_0393861_18_590 | 189 |
| 318 | 3300049581 | Ga0501047_0003323 | Ga0501047_0003323_14273_14929 | 189 |
| 319 | 3300049584 | Ga0501068_0000394 | Ga0501068_0000394_14469_15125 | 189 |
| 320 | 3300049585 | Ga0501069_0000211 | Ga0501069_0000211_45_701 | 189 |
| 321 | 3300049588 | Ga0501072_0000016 | Ga0501072_0000016_80132_80788 | 189 |
| 322 | 3300049741 | Ga0501079_0005386 | Ga0501079_0005386_8789_9445 | 189 |
| 323 | 3300049744 | Ga0501083_0005162 | Ga0501083_0005162_91_747 | 189 |
| 324 | 3300049823 | Ga0501044_0514509 | Ga0501044_0514509_196_765 | 189 |
| 325 | 3300053177 | Ga0500636_0000011 | Ga0500636_0000011_37530_38099 | 189 |
| 326 | 3300054114 | Ga0501084_0000028 | Ga0501084_0000028_38877_39533 | 189 |
| 327 | 3300061734 | Ga0530510_0030502 | Ga0530510_0030502_3136_3792 | 189 |
| 328 | 3300035091 | Ga0373951_0000658 | Ga0373951_0000658_1102_1698 | 194 |
| 329 | iso_pu_bacteria | 2835312727 | 2835319114 | 195 |
| 330 | 3300009101 | Ga0105247_10711486 | Ga0105247_107114861 | 199 |
| 331 | 3300013306 | Ga0163162_11336637 | Ga0163162_113366371 | 199 |
| 332 | 3300014968 | Ga0157379_10204577 | Ga0157379_102045772 | 199 |
| 333 | 3300003323 | rootH1_10073072 | rootH1_100730722 | 200 |
| 334 | 3300035725 | Ga0373947_0546736 | Ga0373947_0546736_167_772 | 200 |
| 335 | 3300037068 | Ga0373925_0341941 | Ga0373925_0341941_385_990 | 200 |
| 336 | 3300049579 | Ga0501043_0639831 | Ga0501043_0639831_69_686 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6hra-assembly1.cif.gz_C | cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) | 0.7285 | 6 | 200 |
| 7bh2-assembly1.cif.gz_C | cryo-em structure of kdpfabc in e2pi state with bef3 and k+ | 0.7278 | 6 | 200 |
| 6hra-assembly1.cif.gz_C | cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) | 0.7216 | 6 | 200 |
| 7bh2-assembly1.cif.gz_C | cryo-em structure of kdpfabc in e2pi state with bef3 and k+ | 0.7124 | 6 | 200 |
| 6t1t-assembly1.cif.gz_A | cytochrome p450 reductase in complex with nadph from candida tropicalis | 0.6281 | 146 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6IKH7_71_178_1.10.238.200 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain | 0.6273 | 139 | 196 | 1.10.238.200 |
| 1hf0B02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like | 0.5731 | 110 | 171 | 1.10.10.60 |
| 2eqzA00 | Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A;High mobility group box domain | 0.5596 | 90 | 126 | 1.10.30.10 |
| af_Q2G2L8_2_138_1.10.1660.10 | Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; | 0.4733 | 141 | 198 | 1.10.1660.10 |
| af_Q54GP1_147_249_1.10.238.200 | Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain | 0.4665 | 104 | 196 | 1.10.238.200 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I3E0A1-F1-model_v4 | Potassium-transporting ATPase C chain | 0.9636 | 126 | 198 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A536ZNA7-F1-model_v4 | Potassium-transporting ATPase subunit C | 0.9613 | 123 | 196 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A8B3G858-F1-model_v4 | deleted | 0.961 | 142 | 196 |
|
| AF-A0A3L9ZEW8-F1-model_v4 | K+-transporting ATPase C subunit | 0.9534 | 132 | 198 |
GO:0005524
GO:0005886 GO:0008556 |
| AF-A0A4Q6CGJ9-F1-model_v4 | deleted | 0.9469 | 142 | 198 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar