F412769

General Info

Members Datasets Scaffolds Average Seq Length
336 235 297 185

Family's Representative Sequence

Representative Sequence 3300044684|Ga0466966_0263322|Ga0466966_0263322_366_1019
Length 210
Sequence MKNLSGTNFDARERGPRDSGGEAQEGASNSVLRPAIALLILMTAITGIAYPKVLFPGQADGSLVVRDGKPVGSRLIGQPFSDPKDFWSRPSATSPQPYNGLASGGSNLGPLNSALTDAVKARIAALQSADPGNHAPIPVDLVTASASGLDPDISLAAAYYQADRIARIRHLSPDRVRALIAAHARGRVLGVIGEPRVNVLELNLALDAMK

Samples

Sample ID Description Type Environment
1 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
2 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
3 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
4 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
5 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
6 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
7 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
8 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
9 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
10 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
11 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
12 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
13 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
14 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
15 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
16 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
17 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
18 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
19 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
20 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
21 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
22 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
23 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
24 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
25 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
26 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
27 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
28 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
29 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
30 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
31 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
32 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
33 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
34 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
35 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
36 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
37 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
43 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
44 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
48 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
51 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
52 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
53 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
54 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
55 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
56 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
57 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
83 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
91 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
105 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
150 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
154 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
155 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
160 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
173 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
182 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
187 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
206 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
207 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
208 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
221 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
222 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
224 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
232 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
233 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
234 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
235 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 88.39
Metatranscriptomes 0
Isolates 11.61

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 2.08
Nodule 12.2
Rhizoplane 4.76
Rhizosphere 73.81
Stem 0
Stem Tuber 0
Unclassified 6.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10073072 3300003323 Bacteria 1321
2 rootH1_10211231 3300003323 Bacteria 2232
3 rootH1_10306602 3300003323 Bacteria 3536
4 Ga0055531_10021549 3300003794 Bacteria 2494
5 Ga0070676_10015637 3300005328 Bacteria 4188
6 Ga0070683_100000007 3300005329 Bacteria 342155
7 Ga0070683_100007866 3300005329 Bacteria 9030
8 Ga0070683_100041760 3300005329 Bacteria 4221
9 Ga0070690_100079218 3300005330 Bacteria 2148
10 Ga0070670_100026369 3300005331 Bacteria 5002
11 Ga0068869_100098125 3300005334 Bacteria 2213
12 Ga0068869_100175022 3300005334 Bacteria 1679
13 Ga0070666_10007357 3300005335 Bacteria 6784
14 Ga0070680_100011576 3300005336 Bacteria 6832
15 Ga0070680_100100777 3300005336 Bacteria 2397
16 Ga0070680_100212683 3300005336 Bacteria 1631
17 Ga0068868_100019389 3300005338 Bacteria 5096
18 Ga0068868_100146218 3300005338 Bacteria 1944
19 Ga0070660_100042504 3300005339 Bacteria 3469
20 Ga0070691_10009196 3300005341 Bacteria 4517
21 Ga0070669_100000007 3300005353 Bacteria 233709
22 Ga0070671_100034370 3300005355 Bacteria 4196
23 Ga0070667_100066711 3300005367 Bacteria 3058
24 Ga0070667_100083420 3300005367 Bacteria 2738
25 Ga0070667_100107310 3300005367 Bacteria 2418
26 Ga0070709_10598330 3300005434 Bacteria 849
27 Ga0070714_100222822 3300005435 Bacteria 1734
28 Ga0070714_100931169 3300005435 Bacteria 844
29 Ga0070713_100002189 3300005436 Bacteria 12653
30 Ga0070710_10008578 3300005437 Bacteria 4975
31 Ga0070711_100027053 3300005439 Bacteria 3762
32 Ga0070711_100546848 3300005439 Bacteria 960
33 Ga0070663_100450562 3300005455 Bacteria 1061
34 Ga0070678_100003645 3300005456 Bacteria 8596
35 Ga0070681_10004054 3300005458 Bacteria 13830
36 Ga0070681_10174440 3300005458 Bacteria 2071
37 Ga0068867_100100186 3300005459 Bacteria 2212
38 Ga0068867_100263027 3300005459 Bacteria 1407
39 Ga0070679_100036783 3300005530 Bacteria 4859
40 Ga0070684_100000021 3300005535 Bacteria 132928
41 Ga0070684_100042361 3300005535 Bacteria 3930
42 Ga0068853_100764942 3300005539 Bacteria 924
43 Ga0070672_100291816 3300005543 Bacteria 1381
44 Ga0070686_100129001 3300005544 Bacteria 1746
45 Ga0070665_100036805 3300005548 Bacteria 4921
46 Ga0070665_100084818 3300005548 Bacteria 3173
47 Ga0068855_100001240 3300005563 Bacteria 31649
48 Ga0068855_100013474 3300005563 Bacteria 9856
49 Ga0068855_100040675 3300005563 Bacteria 5516
50 Ga0068855_100226400 3300005563 Bacteria 2095
51 Ga0068857_100040227 3300005577 Bacteria 4146
52 Ga0068857_100126840 3300005577 Bacteria 2300
53 Ga0068856_100166618 3300005614 Bacteria 2214
54 Ga0068856_100285160 3300005614 Bacteria 1668
55 Ga0068856_100286029 3300005614 Bacteria 1666
56 Ga0068856_100368610 3300005614 Bacteria 1455
57 Ga0068859_100019247 3300005617 Bacteria 6858
58 Ga0068859_100098763 3300005617 Bacteria 2974
59 Ga0068866_10008057 3300005718 Bacteria 4426
60 Ga0068870_10040148 3300005840 Bacteria 2425
61 Ga0068863_100013514 3300005841 Bacteria 7875
62 Ga0068863_100025565 3300005841 Bacteria 5629
63 Ga0068858_100019933 3300005842 Bacteria 6270
64 Ga0068858_100090130 3300005842 Bacteria 2853
65 Ga0068860_100010201 3300005843 Bacteria 9297
66 Ga0070715_10010850 3300006163 Bacteria 3259
67 Ga0070712_100042372 3300006175 Bacteria 3130
68 Ga0097621_100214480 3300006237 Bacteria 1675
69 Ga0097621_100322510 3300006237 Bacteria 1369
70 Ga0068871_100270121 3300006358 Bacteria 1485
71 Ga0068865_100024111 3300006881 Bacteria 3988
72 Ga0068865_100140738 3300006881 Bacteria 1819
73 Ga0075436_100064683 3300006914 Bacteria 2529
74 Ga0097620_100019247 3300006931 Bacteria 6858
75 Ga0097620_100098761 3300006931 Bacteria 2974
76 Ga0079104_1003013 3300006946 Bacteria 8270
77 Ga0105250_10058157 3300009092 Bacteria 1552
78 Ga0105240_10005746 3300009093 Bacteria 18400
79 Ga0105240_10008007 3300009093 Bacteria 15222
80 Ga0105240_10116497 3300009093 Bacteria 3223
81 Ga0105240_10354300 3300009093 Bacteria 1664
82 Ga0105240_10581970 3300009093 Bacteria 1235
83 Ga0105245_10020265 3300009098 Bacteria 5829
84 Ga0105247_10011794 3300009101 Bacteria 5255
85 Ga0105247_10711486 3300009101 Bacteria 757
86 Ga0105241_10005253 3300009174 Bacteria 9564
87 Ga0105242_10006532 3300009176 Bacteria 8976
88 Ga0105248_10044969 3300009177 Bacteria 4951
89 Ga0105237_10026415 3300009545 Bacteria 5934
90 Ga0105237_10272911 3300009545 Bacteria 1694
91 Ga0105237_10586043 3300009545 Bacteria 1122
92 Ga0105238_10128763 3300009551 Bacteria 2510
93 Ga0105238_10152591 3300009551 Bacteria 2285
94 Ga0105238_10161023 3300009551 Bacteria 2220
95 Ga0105238_10313720 3300009551 Bacteria 1553
96 Ga0105238_10526451 3300009551 Bacteria 1185
97 Ga0105249_10428581 3300009553 Bacteria 1358
98 Ga0105249_10601079 3300009553 Bacteria 1155
99 Ga0105239_10015203 3300010375 Bacteria 8530
100 Ga0105239_10067355 3300010375 Bacteria 3933
101 Ga0105239_10208439 3300010375 Bacteria 2190
102 Ga0105239_10559925 3300010375 Bacteria 1302
103 Ga0105239_11271523 3300010375 Bacteria 849
104 Ga0157371_10844572 3300013102 Unclassified 692
105 Ga0157370_10121672 3300013104 Bacteria 2437
106 Ga0157369_10017860 3300013105 Bacteria 7962
107 Ga0157369_10223891 3300013105 Bacteria 1968
108 Ga0157374_10100515 3300013296 Bacteria 2772
109 Ga0157378_10008652 3300013297 Bacteria 8860
110 Ga0163162_11336637 3300013306 Bacteria 815
111 Ga0157372_10222451 3300013307 Bacteria 2188
112 Ga0157372_10636133 3300013307 Bacteria 1243
113 Ga0157375_10105434 3300013308 Bacteria 2909
114 Ga0157375_10192195 3300013308 Bacteria 2196
115 Ga0157375_10895751 3300013308 Bacteria 1031
116 Ga0163163_10089102 3300014325 Bacteria 3097
117 Ga0157379_10116649 3300014968 Bacteria 2401
118 Ga0157379_10204577 3300014968 Bacteria 1786
119 Ga0228711_1021821 3300022739 Bacteria 5168
120 Ga0228710_1000227 3300022740 Bacteria 59028
121 Ga0209050_1014699 3300025298 Bacteria 3348
122 Ga0209257_1000428 3300025304 Bacteria 80856
123 Ga0207642_10008703 3300025899 Bacteria 3497
124 Ga0207710_10004536 3300025900 Bacteria 6035
125 Ga0207710_10048276 3300025900 Bacteria 1905
126 Ga0207680_10070035 3300025903 Bacteria 2169
127 Ga0207680_10100622 3300025903 Bacteria 1856
128 Ga0207685_10015362 3300025905 Bacteria 2424
129 Ga0207699_10124564 3300025906 Bacteria 1672
130 Ga0207645_10003439 3300025907 Bacteria 12030
131 Ga0207643_10045654 3300025908 Bacteria 2475
132 Ga0207654_10100748 3300025911 Bacteria 1779
133 Ga0207654_10244390 3300025911 Bacteria 1201
134 Ga0207707_10006539 3300025912 Bacteria 10172
135 Ga0207707_10042225 3300025912 Bacteria 3981
136 Ga0207695_10004642 3300025913 Bacteria 18615
137 Ga0207695_10134164 3300025913 Bacteria 2430
138 Ga0207671_10082062 3300025914 Bacteria 2419
139 Ga0207671_10304914 3300025914 Bacteria 1258
140 Ga0207671_10358042 3300025914 Bacteria 1158
141 Ga0207671_10526162 3300025914 Bacteria 943
142 Ga0207693_10000554 3300025915 Bacteria 33783
143 Ga0207663_10012405 3300025916 Bacteria 4608
144 Ga0207660_10078262 3300025917 Bacteria 2423
145 Ga0207660_10133459 3300025917 Bacteria 1892
146 Ga0207657_10112449 3300025919 Bacteria 2247
147 Ga0207649_10935946 3300025920 Bacteria 680
148 Ga0207652_10290353 3300025921 Bacteria 1475
149 Ga0207681_10000017 3300025923 Bacteria 294161
150 Ga0207694_10134393 3300025924 Bacteria 1985
151 Ga0207694_10248108 3300025924 Bacteria 1456
152 Ga0207659_10005510 3300025926 Bacteria 7680
153 Ga0207664_10346727 3300025929 Bacteria 1314
154 Ga0207644_10048516 3300025931 Bacteria 3036
155 Ga0207644_10345886 3300025931 Bacteria 1207
156 Ga0207686_10032638 3300025934 Bacteria 3100
157 Ga0207709_10169591 3300025935 Bacteria 1530
158 Ga0207704_10006560 3300025938 Bacteria 5437
159 Ga0207665_10072596 3300025939 Bacteria 2351
160 Ga0207711_10059110 3300025941 Bacteria 3300
161 Ga0207711_10390947 3300025941 Bacteria 1291
162 Ga0207661_10000010 3300025944 Bacteria 375338
163 Ga0207661_10250683 3300025944 Bacteria 1573
164 Ga0207667_10002349 3300025949 Bacteria 23706
165 Ga0207667_10034005 3300025949 Bacteria 5476
166 Ga0207667_10421995 3300025949 Bacteria 1357
167 Ga0207651_10107937 3300025960 Bacteria 2082
168 Ga0207712_10053786 3300025961 Bacteria 2826
169 Ga0207658_10021511 3300025986 Bacteria 4480
170 Ga0207658_10201864 3300025986 Bacteria 1660
171 Ga0207658_10210150 3300025986 Bacteria 1630
172 Ga0207677_10006577 3300026023 Bacteria 6377
173 Ga0207703_10007874 3300026035 Bacteria 8427
174 Ga0207703_10510164 3300026035 Bacteria 1130
175 Ga0207678_10068230 3300026067 Bacteria 3052
176 Ga0207702_10176356 3300026078 Bacteria 1964
177 Ga0207702_10732395 3300026078 Bacteria 975
178 Ga0207641_10001021 3300026088 Bacteria 28410
179 Ga0207641_10248839 3300026088 Bacteria 1659
180 Ga0207648_10145871 3300026089 Bacteria 2087
181 Ga0207648_10384810 3300026089 Bacteria 1269
182 Ga0207676_10370273 3300026095 Bacteria 1331
183 Ga0207674_10100246 3300026116 Bacteria 2877
184 Ga0207674_10195424 3300026116 Bacteria 1973
185 Ga0207683_10017678 3300026121 Bacteria 6080
186 Ga0209281_1000348 3300027111 Bacteria 76877
187 Ga0209282_1000070 3300027666 Bacteria 85274
188 Ga0268266_10012190 3300028379 Bacteria 7441
189 Ga0268266_10063202 3300028379 Bacteria 3196
190 Ga0268266_10881443 3300028379 Bacteria 865
191 Ga0268264_10000200 3300028381 Bacteria 122063
192 Ga0307515_10031623 3300028794 Bacteria 8813
193 Ga0265338_10117159 3300028800 Bacteria 2132
194 Ga0265331_10042757 3300031250 Bacteria 2197
195 Ga0307508_10166722 3300031616 Bacteria 1806
196 Ga0315914_1000082 3300031967 Bacteria 78317
197 Ga0307510_10009306 3300033180 Bacteria 11707
198 Ga0315913_1000028 3300033430 Bacteria 78319
199 Ga0315915_1000004 3300033464 Bacteria 403083
200 Ga0373951_0000658 3300035091 Bacteria 9500
201 Ga0373954_0143484 3300035118 Bacteria 1165
202 Ga0373946_0163667 3300035171 Bacteria 1046
203 Ga0373955_0141097 3300035172 Bacteria 1413
204 Ga0373927_0038327 3300035695 Bacteria 3112
205 Ga0373947_0546736 3300035725 Bacteria 788
206 Ga0373937_0021134 3300036401 Bacteria 5841
207 Ga0373937_0324813 3300036401 Bacteria 1456
208 Ga0373925_0341941 3300037068 Bacteria 1214
209 Ga0373925_0450525 3300037068 Bacteria 1054
210 Ga0395900_0141676 3300037418 Bacteria 2461
211 Ga0395905_0000510 3300037471 Bacteria 53278
212 Ga0395905_0004003 3300037471 Bacteria 15481
213 Ga0395905_0055159 3300037471 Bacteria 3719
214 Ga0436360_1204672 3300039438 Bacteria 2177
215 Ga0451577_0000196 3300042876 Bacteria 126516
216 Ga0466969_0003786 3300044656 Bacteria 8036
217 Ga0466965_0029582 3300044683 Bacteria 2666
218 Ga0466966_0019917 3300044684 Bacteria 4413
219 Ga0466966_0050104 3300044684 Bacteria 2657
220 Ga0466966_0263322 3300044684 Bacteria 1038
221 Ga0453684_0000821 3300044712 Bacteria 105082
222 Ga0466970_0231143 3300044765 Bacteria 1033
223 Ga0466959_0007582 3300045049 Bacteria 7627
224 Ga0466959_0018816 3300045049 Bacteria 5074
225 Ga0466959_0042176 3300045049 Bacteria 3366
226 Ga0466959_0156511 3300045049 Bacteria 1604
227 Ga0451576_0351435 3300045051 Bacteria 1543
228 Ga0451576_1141344 3300045051 Bacteria 815
229 Ga0466958_0313340 3300045836 Bacteria 1008
230 Ga0495580_0003847 3300046472 Bacteria 12702
231 Ga0495580_0076034 3300046472 Bacteria 2342
232 Ga0495652_0341180 3300046529 Bacteria 1076
233 Ga0495652_0709418 3300046529 Bacteria 676
234 Ga0495657_0015759 3300046675 Bacteria 5523
235 Ga0495672_0007702 3300047320 Bacteria 8062
236 Ga0495676_0518650 3300047321 Bacteria 781
237 Ga0495683_0173684 3300047323 Bacteria 989
238 Ga0495687_000121 3300047443 Bacteria 120336
239 Ga0495686_0347753 3300047472 Bacteria 807
240 Ga0495602_0560393 3300048088 Unclassified 791
241 Ga0496100_0161561 3300048903 Bacteria 1606
242 Ga0496101_0017712 3300048904 Bacteria 4831
243 Ga0496101_0425233 3300048904 Bacteria 1047
244 Ga0496102_0095929 3300048905 Bacteria 2749
245 Ga0496103_0188592 3300048906 Bacteria 1325
246 Ga0496104_0112226 3300048907 Bacteria 2614
247 Ga0496104_0607760 3300048907 Bacteria 1003
248 Ga0496105_0459813 3300048908 Bacteria 1003
249 Ga0496108_0010699 3300048911 Bacteria 7444
250 Ga0496109_0118312 3300048912 Bacteria 2466
251 Ga0496110_0018270 3300048913 Bacteria 5878
252 Ga0496112_0388878 3300048915 Bacteria 1335
253 Ga0496114_0016930 3300048917 Bacteria 5878
254 Ga0496115_0001057 3300048918 Bacteria 19957
255 Ga0496115_0009395 3300048918 Bacteria 7267
256 Ga0496115_0273357 3300048918 Bacteria 1388
257 Ga0496116_0000100 3300048919 Bacteria 194740
258 Ga0496117_0079828 3300048920 Bacteria 2154
259 Ga0496118_0015405 3300048921 Bacteria 7078
260 Ga0496118_0036776 3300048921 Bacteria 3952
261 Ga0496118_0041597 3300048921 Bacteria 3636
262 Ga0496121_0002328 3300048924 Bacteria 29355
263 Ga0496121_0271667 3300048924 Bacteria 1165
264 Ga0496122_0004142 3300048925 Bacteria 18314
265 Ga0496123_0053744 3300048926 Bacteria 2659
266 Ga0496124_0393861 3300048927 Bacteria 964
267 Ga0496125_0004854 3300048928 Bacteria 15263
268 Ga0496126_0000311 3300048929 Bacteria 103353
269 Ga0496126_0004169 3300048929 Bacteria 17445
270 Ga0496126_0186186 3300048929 Bacteria 1761
271 Ga0501032_0914289 3300049569 Bacteria 552
272 Ga0501034_0000056 3300049571 Bacteria 202540
273 Ga0501034_0002152 3300049571 Bacteria 24462
274 Ga0501034_0095817 3300049571 Bacteria 2964
275 Ga0501043_0177978 3300049579 Bacteria 1658
276 Ga0501043_0639831 3300049579 Bacteria 782
277 Ga0501046_0215452 3300049580 Bacteria 1424
278 Ga0501047_0003323 3300049581 Bacteria 15230
279 Ga0501068_0000394 3300049584 Bacteria 22113
280 Ga0501069_0000211 3300049585 Bacteria 25989
281 Ga0501070_0596913 3300049586 Bacteria 880
282 Ga0501072_0000016 3300049588 Bacteria 165259
283 Ga0501079_0005386 3300049741 Bacteria 9528
284 Ga0501083_0005162 3300049744 Bacteria 9239
285 Ga0501035_0165847 3300049822 Bacteria 1910
286 Ga0501044_0128847 3300049823 Bacteria 2525
287 Ga0501044_0350853 3300049823 Bacteria 1395
288 Ga0501044_0514509 3300049823 Bacteria 1097
289 nmdc:mga0n895_384342_c1 3300050512 Bacteria 1420
290 nmdc:mga08x19_168393_c1 3300050514 Bacteria 1491
291 Ga0495595_0080202 3300053084 Bacteria 1553
292 Ga0500616_0060331 3300053153 Bacteria 1966
293 Ga0500636_0000011 3300053177 Bacteria 140769
294 Ga0500637_0225735 3300053178 Bacteria 1057
295 Ga0500637_0239413 3300053178 Bacteria 1018
296 Ga0501084_0000028 3300054114 Bacteria 124129
297 Ga0530510_0030502 3300061734 Bacteria 3873

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10058157 Ga0105250_100581572 155
2 3300009101 Ga0105247_10011794 Ga0105247_100117943 155
3 3300009176 Ga0105242_10006532 Ga0105242_100065323 155
4 3300009553 Ga0105249_10428581 Ga0105249_104285812 155
5 3300013296 Ga0157374_10100515 Ga0157374_101005152 155
6 3300013308 Ga0157375_10192195 Ga0157375_101921951 155
7 3300035118 Ga0373954_0143484 Ga0373954_0143484_457_987 155
8 3300035171 Ga0373946_0163667 Ga0373946_0163667_86_616 155
9 3300035172 Ga0373955_0141097 Ga0373955_0141097_707_1237 155
10 3300035695 Ga0373927_0038327 Ga0373927_0038327_2090_2620 155
11 3300036401 Ga0373937_0021134 Ga0373937_0021134_2122_2652 155
12 3300037068 Ga0373925_0450525 Ga0373925_0450525_394_924 155
13 3300046472 Ga0495580_0076034 Ga0495580_0076034_1124_1654 155
14 3300046529 Ga0495652_0341180 Ga0495652_0341180_238_768 155
15 3300048906 Ga0496103_0188592 Ga0496103_0188592_525_1055 155
16 3300048907 Ga0496104_0607760 Ga0496104_0607760_53_583 155
17 3300048908 Ga0496105_0459813 Ga0496105_0459813_181_711 155
18 3300048911 Ga0496108_0010699 Ga0496108_0010699_3321_3851 155
19 3300048912 Ga0496109_0118312 Ga0496109_0118312_697_1227 155
20 3300048913 Ga0496110_0018270 Ga0496110_0018270_2114_2644 155
21 3300048915 Ga0496112_0388878 Ga0496112_0388878_69_599 155
22 3300048917 Ga0496114_0016930 Ga0496114_0016930_1480_2010 155
23 3300048918 Ga0496115_0001057 Ga0496115_0001057_14259_14789 155
24 3300005458 Ga0070681_10004054 Ga0070681_100040547 164
25 3300005530 Ga0070679_100036783 Ga0070679_1000367833 164
26 3300005563 Ga0068855_100013474 Ga0068855_1000134745 164
27 3300009093 Ga0105240_10008007 Ga0105240_100080078 164
28 3300025912 Ga0207707_10006539 Ga0207707_100065396 164
29 3300025921 Ga0207652_10290353 Ga0207652_102903532 164
30 3300025949 Ga0207667_10421995 Ga0207667_104219952 164
31 3300005336 Ga0070680_100011576 Ga0070680_1000115763 166
32 3300005614 Ga0068856_100368610 Ga0068856_1003686102 166
33 3300009551 Ga0105238_10313720 Ga0105238_103137202 166
34 3300013105 Ga0157369_10223891 Ga0157369_102238912 166
35 3300045049 Ga0466959_0156511 Ga0466959_0156511_786_1454 168
36 3300005329 Ga0070683_100041760 Ga0070683_1000417601 169
37 3300005335 Ga0070666_10007357 Ga0070666_100073572 169
38 3300005459 Ga0068867_100263027 Ga0068867_1002630271 169
39 3300005543 Ga0070672_100291816 Ga0070672_1002918162 169
40 3300005544 Ga0070686_100129001 Ga0070686_1001290012 169
41 3300005548 Ga0070665_100036805 Ga0070665_1000368053 169
42 3300005841 Ga0068863_100025565 Ga0068863_1000255653 169
43 3300013105 Ga0157369_10017860 Ga0157369_100178604 169
44 3300013307 Ga0157372_10636133 Ga0157372_106361331 169
45 3300025900 Ga0207710_10048276 Ga0207710_100482762 169
46 3300025941 Ga0207711_10059110 Ga0207711_100591102 169
47 3300025960 Ga0207651_10107937 Ga0207651_101079372 169
48 3300026035 Ga0207703_10510164 Ga0207703_105101642 169
49 3300026088 Ga0207641_10248839 Ga0207641_102488392 169
50 3300026089 Ga0207648_10384810 Ga0207648_103848102 169
51 3300028379 Ga0268266_10881443 Ga0268266_108814432 169
52 3300028794 Ga0307515_10031623 Ga0307515_100316238 170
53 3300048920 Ga0496117_0079828 Ga0496117_0079828_471_1040 170
54 3300048926 Ga0496123_0053744 Ga0496123_0053744_417_986 170
55 3300003323 rootH1_10306602 rootH1_103066021 171
56 3300005329 Ga0070683_100007866 Ga0070683_1000078666 172
57 3300005336 Ga0070680_100212683 Ga0070680_1002126832 172
58 3300005458 Ga0070681_10174440 Ga0070681_101744402 172
59 3300005535 Ga0070684_100042361 Ga0070684_1000423612 172
60 3300009551 Ga0105238_10526451 Ga0105238_105264512 172
61 3300025912 Ga0207707_10042225 Ga0207707_100422252 172
62 3300025917 Ga0207660_10133459 Ga0207660_101334592 172
63 3300025944 Ga0207661_10250683 Ga0207661_102506832 172
64 3300047320 Ga0495672_0007702 Ga0495672_0007702_4417_5022 172
65 3300025961 Ga0207712_10053786 Ga0207712_100537862 173
66 3300033180 Ga0307510_10009306 Ga0307510_100093063 173
67 3300037418 Ga0395900_0141676 Ga0395900_0141676_1151_1726 173
68 3300037471 Ga0395905_0055159 Ga0395905_0055159_153_728 173
69 3300049569 Ga0501032_0914289 Ga0501032_0914289_14_535 173
70 3300049571 Ga0501034_0000056 Ga0501034_0000056_105379_106017 173
71 3300009093 Ga0105240_10116497 Ga0105240_101164971 174
72 3300009098 Ga0105245_10020265 Ga0105245_100202652 174
73 3300009174 Ga0105241_10005253 Ga0105241_100052536 174
74 3300009177 Ga0105248_10044969 Ga0105248_100449693 174
75 3300009545 Ga0105237_10026415 Ga0105237_100264156 174
76 3300010375 Ga0105239_10067355 Ga0105239_100673552 174
77 3300013102 Ga0157371_10844572 Ga0157371_108445722 174
78 3300013297 Ga0157378_10008652 Ga0157378_100086525 174
79 3300046472 Ga0495580_0003847 Ga0495580_0003847_8168_8698 174
80 3300046529 Ga0495652_0709418 Ga0495652_0709418_25_549 174
81 3300047472 Ga0495686_0347753 Ga0495686_0347753_262_789 174
82 3300048903 Ga0496100_0161561 Ga0496100_0161561_785_1315 174
83 3300048904 Ga0496101_0017712 Ga0496101_0017712_3881_4411 174
84 3300048905 Ga0496102_0095929 Ga0496102_0095929_1229_1759 174
85 3300048918 Ga0496115_0273357 Ga0496115_0273357_46_621 174
86 3300048929 Ga0496126_0004169 Ga0496126_0004169_15592_16167 174
87 3300048088 Ga0495602_0560393 Ga0495602_0560393_55_627 175
88 3300053178 Ga0500637_0239413 Ga0500637_0239413_11_565 175
89 3300005455 Ga0070663_100450562 Ga0070663_1004505621 176
90 3300005614 Ga0068856_100166618 Ga0068856_1001666182 176
91 3300005841 Ga0068863_100013514 Ga0068863_1000135142 176
92 3300005843 Ga0068860_100010201 Ga0068860_1000102012 176
93 3300006237 Ga0097621_100322510 Ga0097621_1003225102 176
94 3300009093 Ga0105240_10581970 Ga0105240_105819702 176
95 3300009545 Ga0105237_10272911 Ga0105237_102729112 176
96 3300010375 Ga0105239_10208439 Ga0105239_102084392 176
97 3300025914 Ga0207671_10526162 Ga0207671_105261622 176
98 3300026078 Ga0207702_10732395 Ga0207702_107323952 176
99 3300026088 Ga0207641_10001021 Ga0207641_100010213 176
100 3300028381 Ga0268264_10000200 Ga0268264_100002002 176
101 3300048929 Ga0496126_0186186 Ga0496126_0186186_907_1494 176
102 3300005353 Ga0070669_100000007 Ga0070669_100000007142 177
103 3300005539 Ga0068853_100764942 Ga0068853_1007649421 177
104 3300005563 Ga0068855_100226400 Ga0068855_1002264002 177
105 3300005617 Ga0068859_100019247 Ga0068859_1000192477 177
106 3300005842 Ga0068858_100090130 Ga0068858_1000901302 177
107 3300006931 Ga0097620_100019247 Ga0097620_1000192477 177
108 3300009545 Ga0105237_10586043 Ga0105237_105860432 177
109 3300009551 Ga0105238_10161023 Ga0105238_101610232 177
110 3300010375 Ga0105239_10559925 Ga0105239_105599252 177
111 3300010375 Ga0105239_11271523 Ga0105239_112715232 177
112 3300014325 Ga0163163_10089102 Ga0163163_100891022 177
113 3300014968 Ga0157379_10116649 Ga0157379_101166492 177
114 3300025900 Ga0207710_10004536 Ga0207710_100045362 177
115 3300025911 Ga0207654_10244390 Ga0207654_102443902 177
116 3300025914 Ga0207671_10304914 Ga0207671_103049142 177
117 3300025923 Ga0207681_10000017 Ga0207681_1000001759 177
118 3300025924 Ga0207694_10248108 Ga0207694_102481082 177
119 3300025931 Ga0207644_10345886 Ga0207644_103458862 177
120 3300025941 Ga0207711_10390947 Ga0207711_103909471 177
121 3300026035 Ga0207703_10007874 Ga0207703_100078743 177
122 3300026067 Ga0207678_10068230 Ga0207678_100682302 177
123 3300026095 Ga0207676_10370273 Ga0207676_103702732 177
124 3300048904 Ga0496101_0425233 Ga0496101_0425233_368_964 177
125 3300048921 Ga0496118_0036776 Ga0496118_0036776_3129_3725 177
126 3300048928 Ga0496125_0004854 Ga0496125_0004854_9045_9641 177
127 3300005367 Ga0070667_100083420 Ga0070667_1000834202 178
128 3300025986 Ga0207658_10021511 Ga0207658_100215112 178
129 3300031616 Ga0307508_10166722 Ga0307508_101667222 179
130 3300025903 Ga0207680_10070035 Ga0207680_100700352 180
131 3300005548 Ga0070665_100084818 Ga0070665_1000848182 181
132 3300028379 Ga0268266_10063202 Ga0268266_100632022 181
133 3300044684 Ga0466966_0263322 Ga0466966_0263322_366_1019 181
134 3300045836 Ga0466958_0313340 Ga0466958_0313340_137_790 181
135 3300046675 Ga0495657_0015759 Ga0495657_0015759_3469_4071 181
136 3300048919 Ga0496116_0000100 Ga0496116_0000100_84092_84661 181
137 3300048929 Ga0496126_0000311 Ga0496126_0000311_3151_3720 181
138 3300049579 Ga0501043_0177978 Ga0501043_0177978_393_971 181
139 3300049580 Ga0501046_0215452 Ga0501046_0215452_350_928 181
140 3300049822 Ga0501035_0165847 Ga0501035_0165847_67_645 181
141 3300049823 Ga0501044_0128847 Ga0501044_0128847_651_1229 181
142 3300053084 Ga0495595_0080202 Ga0495595_0080202_107_709 181
143 3300049571 Ga0501034_0095817 Ga0501034_0095817_138_740 182
144 3300049823 Ga0501044_0350853 Ga0501044_0350853_38_640 182
145 3300053153 Ga0500616_0060331 Ga0500616_0060331_675_1283 182
146 3300037471 Ga0395905_0000510 Ga0395905_0000510_21441_22010 183
147 3300005328 Ga0070676_10015637 Ga0070676_100156372 184
148 3300005331 Ga0070670_100026369 Ga0070670_1000263692 184
149 3300005334 Ga0068869_100098125 Ga0068869_1000981252 184
150 3300005338 Ga0068868_100146218 Ga0068868_1001462182 184
151 3300005367 Ga0070667_100107310 Ga0070667_1001073102 184
152 3300005459 Ga0068867_100100186 Ga0068867_1001001862 184
153 3300005577 Ga0068857_100126840 Ga0068857_1001268402 184
154 3300005840 Ga0068870_10040148 Ga0068870_100401482 184
155 3300006881 Ga0068865_100140738 Ga0068865_1001407382 184
156 3300009093 Ga0105240_10005746 Ga0105240_100057462 184
157 3300009551 Ga0105238_10128763 Ga0105238_101287632 184
158 3300013307 Ga0157372_10222451 Ga0157372_102224512 184
159 3300013308 Ga0157375_10105434 Ga0157375_101054342 184
160 3300025907 Ga0207645_10003439 Ga0207645_100034394 184
161 3300025908 Ga0207643_10045654 Ga0207643_100456542 184
162 3300025926 Ga0207659_10005510 Ga0207659_100055102 184
163 3300025935 Ga0207709_10169591 Ga0207709_101695912 184
164 3300025938 Ga0207704_10006560 Ga0207704_100065602 184
165 3300025986 Ga0207658_10210150 Ga0207658_102101502 184
166 3300026023 Ga0207677_10006577 Ga0207677_100065775 184
167 3300026089 Ga0207648_10145871 Ga0207648_101458712 184
168 3300026116 Ga0207674_10100246 Ga0207674_101002462 184
169 3300047321 Ga0495676_0518650 Ga0495676_0518650_60_665 184
170 3300013308 Ga0157375_10895751 Ga0157375_108957512 185
171 3300039438 Ga0436360_1204672 Ga0436360_1204672_538_1101 185
172 iso_pu_bacteria 2512875026 2512975084 185
173 iso_pu_bacteria 2513237089 2513605122 185
174 iso_pu_bacteria 2513237156 2513987580 185
175 iso_pu_bacteria 2513237160 2514007847 185
176 iso_pu_bacteria 2517487022 2517567728 185
177 iso_pu_bacteria 2802428858 2802721056 185
178 iso_pu_bacteria 2802428859 2802728145 185
179 iso_pu_bacteria 2802428860 2802733611 185
180 iso_pu_bacteria 2802428861 2802736646 185
181 iso_pu_bacteria 2802428862 2802746713 185
182 iso_pu_bacteria 2802428863 2802749789 185
183 iso_pu_bacteria 2915980308 2915986733 185
184 iso_pu_bacteria 2916061851 2916064143 185
185 iso_pu_bacteria 2919166419 2919166778 185
186 iso_pu_bacteria 2921250672 2921254061 185
187 iso_pu_bacteria 2937029754 2937035471 185
188 iso_pu_bacteria 2937036028 2937039940 185
189 iso_pu_bacteria 2937078374 2937078963 185
190 iso_pu_bacteria 2937084907 2937087497 185
191 iso_pu_bacteria 2957375807 2957376312 185
192 iso_pu_bacteria 2957437181 2957440486 185
193 iso_pu_bacteria 2960591022 2960597391 185
194 iso_pu_bacteria 2960631154 2960636584 185
195 iso_pu_bacteria 2960680706 2960686094 185
196 iso_pu_bacteria 2960693952 2960695798 185
197 iso_pu_bacteria 2967686174 2967690966 185
198 iso_pu_bacteria 2967728569 2967733714 185
199 iso_pu_bacteria 2970026789 2970029055 185
200 iso_pu_bacteria 2970122695 2970125149 185
201 iso_pu_bacteria 2970143518 2970148056 185
202 iso_pu_bacteria 2977530762 2977533397 185
203 iso_pu_bacteria 2977544691 2977548847 185
204 iso_pu_bacteria 2978969890 2978973194 185
205 iso_pu_bacteria 2984587000 2984591443 185
206 iso_pu_bacteria 8003999396 8004005274 185
207 iso_pu_bacteria 8018150411 8018150762 185
208 iso_pu_bacteria 8054460903 8054464528 185
209 iso_pu_bacteria 8002745576 8002750024 186
210 3300003794 Ga0055531_10021549 Ga0055531_100215492 187
211 3300005439 Ga0070711_100546848 Ga0070711_1005468481 187
212 3300009553 Ga0105249_10601079 Ga0105249_106010792 187
213 3300025298 Ga0209050_1014699 Ga0209050_10146992 187
214 3300025304 Ga0209257_1000428 Ga0209257_100042868 187
215 3300036401 Ga0373937_0324813 Ga0373937_0324813_129_725 187
216 3300048921 Ga0496118_0015405 Ga0496118_0015405_835_1422 187
217 3300048924 Ga0496121_0002328 Ga0496121_0002328_20022_20609 187
218 3300049571 Ga0501034_0002152 Ga0501034_0002152_20205_20768 187
219 3300049586 Ga0501070_0596913 Ga0501070_0596913_236_832 187
220 3300005330 Ga0070690_100079218 Ga0070690_1000792182 188
221 3300005334 Ga0068869_100175022 Ga0068869_1001750222 188
222 3300005336 Ga0070680_100100777 Ga0070680_1001007772 188
223 3300005338 Ga0068868_100019389 Ga0068868_1000193892 188
224 3300005355 Ga0070671_100034370 Ga0070671_1000343702 188
225 3300005367 Ga0070667_100066711 Ga0070667_1000667112 188
226 3300005434 Ga0070709_10598330 Ga0070709_105983302 188
227 3300005435 Ga0070714_100222822 Ga0070714_1002228222 188
228 3300005435 Ga0070714_100931169 Ga0070714_1009311692 188
229 3300005436 Ga0070713_100002189 Ga0070713_10000218911 188
230 3300005437 Ga0070710_10008578 Ga0070710_100085782 188
231 3300005439 Ga0070711_100027053 Ga0070711_1000270532 188
232 3300005456 Ga0070678_100003645 Ga0070678_1000036455 188
233 3300005563 Ga0068855_100001240 Ga0068855_10000124011 188
234 3300005614 Ga0068856_100286029 Ga0068856_1002860292 188
235 3300005617 Ga0068859_100098763 Ga0068859_1000987632 188
236 3300005718 Ga0068866_10008057 Ga0068866_100080572 188
237 3300005842 Ga0068858_100019933 Ga0068858_1000199332 188
238 3300006163 Ga0070715_10010850 Ga0070715_100108502 188
239 3300006175 Ga0070712_100042372 Ga0070712_1000423723 188
240 3300006237 Ga0097621_100214480 Ga0097621_1002144802 188
241 3300006358 Ga0068871_100270121 Ga0068871_1002701212 188
242 3300006881 Ga0068865_100024111 Ga0068865_1000241112 188
243 3300006914 Ga0075436_100064683 Ga0075436_1000646834 188
244 3300006931 Ga0097620_100098761 Ga0097620_1000987612 188
245 3300009093 Ga0105240_10354300 Ga0105240_103543002 188
246 3300009551 Ga0105238_10152591 Ga0105238_101525912 188
247 3300010375 Ga0105239_10015203 Ga0105239_100152033 188
248 3300025899 Ga0207642_10008703 Ga0207642_100087032 188
249 3300025903 Ga0207680_10100622 Ga0207680_101006222 188
250 3300025905 Ga0207685_10015362 Ga0207685_100153622 188
251 3300025906 Ga0207699_10124564 Ga0207699_101245642 188
252 3300025911 Ga0207654_10100748 Ga0207654_101007483 188
253 3300025913 Ga0207695_10004642 Ga0207695_100046425 188
254 3300025913 Ga0207695_10134164 Ga0207695_101341642 188
255 3300025914 Ga0207671_10082062 Ga0207671_100820622 188
256 3300025914 Ga0207671_10358042 Ga0207671_103580422 188
257 3300025915 Ga0207693_10000554 Ga0207693_100005545 188
258 3300025916 Ga0207663_10012405 Ga0207663_100124053 188
259 3300025920 Ga0207649_10935946 Ga0207649_109359461 188
260 3300025924 Ga0207694_10134393 Ga0207694_101343932 188
261 3300025929 Ga0207664_10346727 Ga0207664_103467271 188
262 3300025931 Ga0207644_10048516 Ga0207644_100485162 188
263 3300025934 Ga0207686_10032638 Ga0207686_100326382 188
264 3300025939 Ga0207665_10072596 Ga0207665_100725962 188
265 3300025949 Ga0207667_10002349 Ga0207667_1000234912 188
266 3300025986 Ga0207658_10201864 Ga0207658_102018642 188
267 3300026078 Ga0207702_10176356 Ga0207702_101763562 188
268 3300026121 Ga0207683_10017678 Ga0207683_100176783 188
269 3300028379 Ga0268266_10012190 Ga0268266_100121904 188
270 3300028800 Ga0265338_10117159 Ga0265338_101171592 188
271 3300031250 Ga0265331_10042757 Ga0265331_100427572 188
272 3300044656 Ga0466969_0003786 Ga0466969_0003786_187_765 188
273 3300044684 Ga0466966_0019917 Ga0466966_0019917_1476_2054 188
274 3300045049 Ga0466959_0018816 Ga0466959_0018816_750_1322 188
275 3300045049 Ga0466959_0042176 Ga0466959_0042176_1156_1734 188
276 3300045051 Ga0451576_1141344 Ga0451576_1141344_109_708 188
277 3300048907 Ga0496104_0112226 Ga0496104_0112226_1565_2140 188
278 3300048918 Ga0496115_0009395 Ga0496115_0009395_4795_5370 188
279 3300050512 nmdc:mga0n895_384342_c1 nmdc:mga0n895_384342_c1_420_992 188
280 3300050514 nmdc:mga08x19_168393_c1 nmdc:mga08x19_168393_c1_147_719 188
281 3300053178 Ga0500637_0225735 Ga0500637_0225735_350_922 188
282 3300003323 rootH1_10211231 rootH1_102112312 189
283 3300005329 Ga0070683_100000007 Ga0070683_10000000736 189
284 3300005339 Ga0070660_100042504 Ga0070660_1000425042 189
285 3300005341 Ga0070691_10009196 Ga0070691_100091962 189
286 3300005535 Ga0070684_100000021 Ga0070684_10000002182 189
287 3300005563 Ga0068855_100040675 Ga0068855_1000406753 189
288 3300005577 Ga0068857_100040227 Ga0068857_1000402272 189
289 3300005614 Ga0068856_100285160 Ga0068856_1002851602 189
290 3300006946 Ga0079104_1003013 Ga0079104_10030133 189
291 3300013104 Ga0157370_10121672 Ga0157370_101216722 189
292 3300022739 Ga0228711_1021821 Ga0228711_10218213 189
293 3300022740 Ga0228710_1000227 Ga0228710_10002276 189
294 3300025917 Ga0207660_10078262 Ga0207660_100782622 189
295 3300025919 Ga0207657_10112449 Ga0207657_101124492 189
296 3300025944 Ga0207661_10000010 Ga0207661_1000001036 189
297 3300025949 Ga0207667_10034005 Ga0207667_100340053 189
298 3300026116 Ga0207674_10195424 Ga0207674_101954243 189
299 3300027111 Ga0209281_1000348 Ga0209281_100034850 189
300 3300027666 Ga0209282_1000070 Ga0209282_100007025 189
301 3300031967 Ga0315914_1000082 Ga0315914_100008227 189
302 3300033430 Ga0315913_1000028 Ga0315913_100002826 189
303 3300033464 Ga0315915_1000004 Ga0315915_100000427 189
304 3300037471 Ga0395905_0004003 Ga0395905_0004003_4112_4681 189
305 3300042876 Ga0451577_0000196 Ga0451577_0000196_64237_64821 189
306 3300044683 Ga0466965_0029582 Ga0466965_0029582_1858_2433 189
307 3300044684 Ga0466966_0050104 Ga0466966_0050104_164_739 189
308 3300044712 Ga0453684_0000821 Ga0453684_0000821_42465_43049 189
309 3300044765 Ga0466970_0231143 Ga0466970_0231143_126_701 189
310 3300045049 Ga0466959_0007582 Ga0466959_0007582_232_807 189
311 3300045051 Ga0451576_0351435 Ga0451576_0351435_817_1401 189
312 3300047323 Ga0495683_0173684 Ga0495683_0173684_348_923 189
313 3300047443 Ga0495687_000121 Ga0495687_000121_111298_111873 189
314 3300048921 Ga0496118_0041597 Ga0496118_0041597_20_589 189
315 3300048924 Ga0496121_0271667 Ga0496121_0271667_346_915 189
316 3300048925 Ga0496122_0004142 Ga0496122_0004142_7683_8252 189
317 3300048927 Ga0496124_0393861 Ga0496124_0393861_18_590 189
318 3300049581 Ga0501047_0003323 Ga0501047_0003323_14273_14929 189
319 3300049584 Ga0501068_0000394 Ga0501068_0000394_14469_15125 189
320 3300049585 Ga0501069_0000211 Ga0501069_0000211_45_701 189
321 3300049588 Ga0501072_0000016 Ga0501072_0000016_80132_80788 189
322 3300049741 Ga0501079_0005386 Ga0501079_0005386_8789_9445 189
323 3300049744 Ga0501083_0005162 Ga0501083_0005162_91_747 189
324 3300049823 Ga0501044_0514509 Ga0501044_0514509_196_765 189
325 3300053177 Ga0500636_0000011 Ga0500636_0000011_37530_38099 189
326 3300054114 Ga0501084_0000028 Ga0501084_0000028_38877_39533 189
327 3300061734 Ga0530510_0030502 Ga0530510_0030502_3136_3792 189
328 3300035091 Ga0373951_0000658 Ga0373951_0000658_1102_1698 194
329 iso_pu_bacteria 2835312727 2835319114 195
330 3300009101 Ga0105247_10711486 Ga0105247_107114861 199
331 3300013306 Ga0163162_11336637 Ga0163162_113366371 199
332 3300014968 Ga0157379_10204577 Ga0157379_102045772 199
333 3300003323 rootH1_10073072 rootH1_100730722 200
334 3300035725 Ga0373947_0546736 Ga0373947_0546736_167_772 200
335 3300037068 Ga0373925_0341941 Ga0373925_0341941_385_990 200
336 3300049579 Ga0501043_0639831 Ga0501043_0639831_69_686 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02669

KdpC

K+-transporting ATPase, c chain

32

208

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7285 6 200
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7278 6 200
6hra-assembly1.cif.gz_C cryo-em structure of the kdpfabc complex in an e1 outward-facing state (state 1) 0.7216 6 200
7bh2-assembly1.cif.gz_C cryo-em structure of kdpfabc in e2pi state with bef3 and k+ 0.7124 6 200
6t1t-assembly1.cif.gz_A cytochrome p450 reductase in complex with nadph from candida tropicalis 0.6281 146 172
ID Description Score Start End Superfamily
af_A0A1D6IKH7_71_178_1.10.238.200 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain 0.6273 139 196 1.10.238.200
1hf0B02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5731 110 171 1.10.10.60
2eqzA00 Mainly Alpha;Orthogonal Bundle;DNA Binding (I), subunit A;High mobility group box domain 0.5596 90 126 1.10.30.10
af_Q2G2L8_2_138_1.10.1660.10 Mainly Alpha;Orthogonal Bundle;Multidrug-efflux Transporter Regulator; Chain: A; Domain 2; 0.4733 141 198 1.10.1660.10
af_Q54GP1_147_249_1.10.238.200 Mainly Alpha;Orthogonal Bundle;Recoverin; domain 1;Cullin, PONY binding domain 0.4665 104 196 1.10.238.200
ID Description Score Start End GO Terms
AF-I3E0A1-F1-model_v4 Potassium-transporting ATPase C chain 0.9636 126 198 GO:0005524
GO:0005886
GO:0008556
AF-A0A536ZNA7-F1-model_v4 Potassium-transporting ATPase subunit C 0.9613 123 196 GO:0005524
GO:0005886
GO:0008556
AF-A0A8B3G858-F1-model_v4 deleted 0.961 142 196
AF-A0A3L9ZEW8-F1-model_v4 K+-transporting ATPase C subunit 0.9534 132 198 GO:0005524
GO:0005886
GO:0008556
AF-A0A4Q6CGJ9-F1-model_v4 deleted 0.9469 142 198

Feature Viewer

pLDDT pTM Quality
80.87 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map