F412742

General Info

Members Datasets Scaffolds Average Seq Length
336 202 672 309

Family's Representative Sequence

Representative Sequence 3300035084|Ga0373928_0009377|Ga0373928_0009377_349_1470
Length 373
Sequence MRGDRPGGDDQGGRRNRRDRLGPAARPYHGPREHGEQGGXXXXLGGGVQDPVLPDDEGGRRGRLIHWQDDRMGPLMLLDTASLYFRAYYGVPETLTAPDGTPVNAIRGLLDMIARLVRARHPGQLVACMDADWRPAFRVAAIPSYKAHRVAPDGGEEVPPALAAQVPVIEEVLAAAGVAMAGAPGYEADDVIGTLTARAAGLVEIVTGDRDLFQLVDDERPVRVLYTQRGLAKLDVVDEAAVTARYHIPGRAYADYAVLRGDASDGLPGVAGVGDKTAAALVRTFGSVEAMLAAIEAGHGGFPMNSRPKLAAARDYLSVAPAVTRVATDAPVPEVGGTLPLTPAAPDRLAALDERWDLGSSLRRALSALTEQG

Samples

Sample ID Description Type Environment
1 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
26 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
33 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
34 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
38 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
45 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
46 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
47 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
48 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
76 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
77 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
78 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
79 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
80 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
81 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
82 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
83 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
84 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
85 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
86 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
87 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
90 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
91 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
92 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
93 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
94 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
95 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
96 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
97 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
98 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
99 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
100 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
101 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
102 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
103 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
104 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
105 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
106 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
107 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
108 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
109 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
110 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
111 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
112 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
113 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
114 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
115 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
116 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
117 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
118 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
119 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
120 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
126 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
127 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
132 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
133 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
134 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
143 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
144 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
145 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
146 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
147 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
163 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
185 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
186 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
190 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
191 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
192 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
193 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
194 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
195 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
196 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
197 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
198 2844849076 Arthrobacter cupressi DSM 24664 Isolate Rhizosphere
199 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
200 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
201 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
202 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 95.83
Metatranscriptomes 0
Isolates 4.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.19
Nodule 0
Rhizoplane 7.14
Rhizosphere 88.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373928_0009377 3300035084 Bacteria 1911
2 JGI25152J39213_1001484 3300002773 Bacteria 10022
3 rootH2_10017219 3300003320 Bacteria 17970
4 Ga0070658_10000677 3300005327 Bacteria 29445
5 Ga0070682_100099264 3300005337 Bacteria 1919
6 Ga0070709_10005391 3300005434 Bacteria 6927
7 Ga0070709_10015188 3300005434 Bacteria 4375
8 Ga0070714_100003145 3300005435 Bacteria 12256
9 Ga0070714_100013600 3300005435 Bacteria 6524
10 Ga0070714_100016176 3300005435 Bacteria 6018
11 Ga0070714_100038688 3300005435 Bacteria 4011
12 Ga0070713_100007127 3300005436 Bacteria 7818
13 Ga0070713_100014692 3300005436 Bacteria 5824
14 Ga0070713_100152277 3300005436 Bacteria 2058
15 Ga0070710_10001679 3300005437 Bacteria 10439
16 Ga0070710_10008038 3300005437 Bacteria 5129
17 Ga0070710_10058165 3300005437 Bacteria 2192
18 Ga0070711_100006467 3300005439 Bacteria 7065
19 Ga0070711_100077569 3300005439 Bacteria 2358
20 Ga0070705_100120339 3300005440 Bacteria 1694
21 Ga0070708_100002180 3300005445 Bacteria 15120
22 Ga0070708_100002897 3300005445 Bacteria 13325
23 Ga0070706_100049766 3300005467 Bacteria 3866
24 Ga0070706_100063221 3300005467 Bacteria 3420
25 Ga0070706_100086260 3300005467 Bacteria 2909
26 Ga0070706_100123189 3300005467 Bacteria 2417
27 Ga0070707_100088562 3300005468 Bacteria 2995
28 Ga0070707_100237152 3300005468 Bacteria 1775
29 Ga0070698_100000013 3300005471 Bacteria 114652
30 Ga0070698_100225368 3300005471 Bacteria 1808
31 Ga0070684_100331982 3300005535 Bacteria 1397
32 Ga0070697_100213885 3300005536 Bacteria 1642
33 Ga0070695_100131399 3300005545 Bacteria 1726
34 Ga0070696_100030644 3300005546 Bacteria 3684
35 Ga0070696_100122949 3300005546 Bacteria 1880
36 Ga0070665_100058283 3300005548 Bacteria 3872
37 Ga0068855_100076638 3300005563 Bacteria 3880
38 Ga0068856_100029361 3300005614 Bacteria 5372
39 Ga0068856_100195919 3300005614 Bacteria 2034
40 Ga0068864_100192617 3300005618 Bacteria 1870
41 Ga0068863_100146122 3300005841 Bacteria 2261
42 Ga0068863_100498682 3300005841 Bacteria 1199
43 Ga0068858_100111412 3300005842 Bacteria 2556
44 Ga0068860_100448879 3300005843 Bacteria 1282
45 Ga0081540_1000270 3300005983 Bacteria 54211
46 Ga0070717_10002906 3300006028 Bacteria 12167
47 Ga0070717_10021204 3300006028 Bacteria 5120
48 Ga0070717_10055550 3300006028 Bacteria 3268
49 Ga0070717_10103782 3300006028 Bacteria 2417
50 Ga0070717_10120565 3300006028 Bacteria 2246
51 Ga0070717_10504309 3300006028 Bacteria 1094
52 Ga0070715_10031947 3300006163 Bacteria 2141
53 Ga0070716_100008374 3300006173 Bacteria 5130
54 Ga0070716_100019534 3300006173 Bacteria 3542
55 Ga0070712_100006050 3300006175 Bacteria 7492
56 Ga0075433_10119097 3300006852 Bacteria 2343
57 Ga0075433_10161756 3300006852 Bacteria 1993
58 Ga0075434_100013619 3300006871 Bacteria 7750
59 Ga0075434_100110359 3300006871 Bacteria 2761
60 Ga0075436_100020511 3300006914 Bacteria 4536
61 Ga0075436_100021588 3300006914 Bacteria 4419
62 Ga0075436_100038621 3300006914 Bacteria 3295
63 Ga0075436_100069150 3300006914 Bacteria 2440
64 Ga0075435_100175013 3300007076 Bacteria 1812
65 Ga0075435_100194706 3300007076 Bacteria 1716
66 Ga0111539_10206608 3300009094 Bacteria 2289
67 Ga0105247_10155237 3300009101 Bacteria 1511
68 Ga0114129_10085133 3300009147 Bacteria 4386
69 Ga0105243_10061801 3300009148 Bacteria 2997
70 Ga0105238_10325589 3300009551 Bacteria 1523
71 Ga0105246_10000119 3300011119 Bacteria 35825
72 Ga0157373_10048554 3300013100 Bacteria 3026
73 Ga0157370_10056578 3300013104 Bacteria 3733
74 Ga0163163_10013608 3300014325 Bacteria 7451
75 Ga0157379_10016832 3300014968 Bacteria 6435
76 Ga0157376_10052238 3300014969 Bacteria 3398
77 Ga0224572_1001106 3300024225 Bacteria 3803
78 Ga0209129_1000046 3300025258 Bacteria 271702
79 Ga0209025_1000875 3300025294 Bacteria 47317
80 Ga0209051_1045047 3300025303 Bacteria 1531
81 Ga0207697_10074168 3300025315 Bacteria 1429
82 Ga0207692_10002818 3300025898 Bacteria 6712
83 Ga0207692_10011724 3300025898 Bacteria 3742
84 Ga0207692_10041940 3300025898 Bacteria 2269
85 Ga0207692_10142586 3300025898 Bacteria 1364
86 Ga0207685_10061856 3300025905 Bacteria 1486
87 Ga0207699_10002155 3300025906 Bacteria 9300
88 Ga0207699_10013636 3300025906 Bacteria 4167
89 Ga0207699_10020682 3300025906 Bacteria 3532
90 Ga0207699_10092745 3300025906 Bacteria 1899
91 Ga0207705_10004269 3300025909 Bacteria 10824
92 Ga0207705_10035034 3300025909 Bacteria 3591
93 Ga0207684_10001895 3300025910 Bacteria 21750
94 Ga0207684_10005603 3300025910 Bacteria 11553
95 Ga0207684_10076346 3300025910 Bacteria 2848
96 Ga0207671_10103871 3300025914 Bacteria 2155
97 Ga0207693_10009931 3300025915 Bacteria 7738
98 Ga0207693_10048947 3300025915 Bacteria 3319
99 Ga0207693_10067432 3300025915 Bacteria 2802
100 Ga0207693_10175437 3300025915 Bacteria 1687
101 Ga0207663_10013701 3300025916 Bacteria 4415
102 Ga0207663_10020878 3300025916 Bacteria 3717
103 Ga0207652_10328167 3300025921 Bacteria 1382
104 Ga0207646_10070702 3300025922 Bacteria 3117
105 Ga0207700_10000949 3300025928 Bacteria 16681
106 Ga0207700_10007442 3300025928 Bacteria 6690
107 Ga0207700_10179632 3300025928 Bacteria 1771
108 Ga0207664_10000703 3300025929 Bacteria 22779
109 Ga0207664_10003202 3300025929 Bacteria 10880
110 Ga0207664_10030106 3300025929 Bacteria 4143
111 Ga0207709_10083636 3300025935 Bacteria 2064
112 Ga0207665_10000516 3300025939 Bacteria 26163
113 Ga0207665_10000944 3300025939 Bacteria 19638
114 Ga0207665_10228167 3300025939 Bacteria 1367
115 Ga0207667_10060718 3300025949 Bacteria 3957
116 Ga0207667_10185641 3300025949 Bacteria 2135
117 Ga0207703_10064934 3300026035 Bacteria 2998
118 Ga0207702_10020689 3300026078 Bacteria 5444
119 Ga0207702_10025260 3300026078 Bacteria 4929
120 Ga0207641_10114524 3300026088 Bacteria 2396
121 Ga0207676_10037919 3300026095 Bacteria 3677
122 Ga0268266_10045411 3300028379 Bacteria 3759
123 Ga0265325_10012328 3300031241 Bacteria 4890
124 Ga0265340_10013177 3300031247 Bacteria 4351
125 Ga0265340_10017319 3300031247 Bacteria 3726
126 Ga0265339_10030412 3300031249 Bacteria 3058
127 Ga0265316_10050617 3300031344 Bacteria 3266
128 Ga0307408_100103602 3300031548 Bacteria 2172
129 Ga0265313_10029532 3300031595 Bacteria 2835
130 Ga0265342_10111852 3300031712 Bacteria 1545
131 Ga0307416_100003582 3300032002 Bacteria 9157
132 Ga0307414_10039620 3300032004 Bacteria 3175
133 Ga0316212_1006922 3300033547 Bacteria 1641
134 Ga0373930_0008593 3300034816 Bacteria 1789
135 Ga0373944_0068166 3300035089 Bacteria 1154
136 Ga0373944_0076257 3300035089 Bacteria 1100
137 Ga0373949_0016753 3300035090 Bacteria 1645
138 Ga0373939_0028704 3300035114 Bacteria 1586
139 Ga0373945_0115070 3300035116 Bacteria 1064
140 Ga0373953_0004594 3300035117 Bacteria 4409
141 Ga0373956_0053064 3300035119 Bacteria 1824
142 Ga0373957_0002009 3300035120 Bacteria 5687
143 Ga0373960_0001453 3300035121 Bacteria 5242
144 Ga0373943_0027013 3300035170 Bacteria 2693
145 Ga0373943_0043591 3300035170 Bacteria 2179
146 Ga0373943_0076205 3300035170 Bacteria 1710
147 Ga0373955_0054863 3300035172 Bacteria 2180
148 Ga0373955_0132945 3300035172 Bacteria 1453
149 Ga0373962_0041097 3300035242 Bacteria 1302
150 Ga0373935_0029213 3300035692 Bacteria 3412
151 Ga0373927_0026207 3300035695 Bacteria 3810
152 Ga0373927_0177845 3300035695 Bacteria 1395
153 Ga0373933_0059197 3300035724 Bacteria 2306
154 Ga0373947_0017251 3300035725 Bacteria 4152
155 Ga0373947_0055205 3300035725 Bacteria 2398
156 Ga0373947_0320446 3300035725 Bacteria 1036
157 Ga0373925_0000872 3300037068 Bacteria 27570
158 Ga0373925_0064891 3300037068 Bacteria 2749
159 Ga0373925_0148193 3300037068 Bacteria 1840
160 Ga0373925_0308630 3300037068 Bacteria 1278
161 Ga0373925_0319317 3300037068 Bacteria 1256
162 Ga0373925_0450713 3300037068 Bacteria 1053
163 Ga0373925_0654388 3300037068 Bacteria 866
164 Ga0395899_0043713 3300037312 Bacteria 3340
165 Ga0395900_0026526 3300037418 Bacteria 5932
166 Ga0395898_0069872 3300037466 Bacteria 3396
167 Ga0395898_0278124 3300037466 Bacteria 1597
168 Ga0436364_0322461 3300037853 Bacteria 8264
169 Ga0395901_0008722 3300038443 Bacteria 10247
170 Ga0395901_0226189 3300038443 Bacteria 1954
171 Ga0439449_0003540 3300042007 Bacteria 6064
172 Ga0466969_0002368 3300044656 Bacteria 10070
173 Ga0466966_0002406 3300044684 Bacteria 12217
174 Ga0466961_0085958 3300044693 Bacteria 1988
175 Ga0466963_0031857 3300044694 Bacteria 3410
176 Ga0466971_0120639 3300044719 Bacteria 1213
177 Ga0466970_0106996 3300044765 Bacteria 1526
178 Ga0466957_0001824 3300044842 Bacteria 11233
179 Ga0466960_0046868 3300044901 Bacteria 2071
180 Ga0466959_0027672 3300045049 Bacteria 4204
181 Ga0495592_0088236 3300046454 Bacteria 2229
182 Ga0495603_0042888 3300046455 Bacteria 2703
183 Ga0495629_0026620 3300046459 Bacteria 4107
184 Ga0495629_0029327 3300046459 Bacteria 3903
185 Ga0495629_0239276 3300046459 Bacteria 1250
186 Ga0495641_0023718 3300046461 Bacteria 3041
187 Ga0495641_0030049 3300046461 Bacteria 2610
188 Ga0495641_0170422 3300046461 Bacteria 974
189 Ga0495651_0165391 3300046462 Bacteria 1580
190 Ga0495653_0095124 3300046463 Bacteria 2169
191 Ga0495653_0105079 3300046463 Bacteria 2039
192 Ga0495580_0162462 3300046472 Bacteria 1545
193 Ga0495582_0015920 3300046473 Bacteria 4122
194 Ga0495662_0022731 3300046476 Bacteria 3027
195 Ga0495662_0025842 3300046476 Bacteria 2836
196 Ga0495662_0054114 3300046476 Bacteria 1938
197 Ga0495608_0072607 3300046511 Bacteria 2245
198 Ga0495608_0084658 3300046511 Bacteria 2056
199 Ga0495608_0124546 3300046511 Bacteria 1651
200 Ga0495618_0015790 3300046514 Bacteria 4609
201 Ga0495618_0049298 3300046514 Bacteria 2659
202 Ga0495628_0030159 3300046516 Bacteria 4392
203 Ga0495628_0236249 3300046516 Bacteria 1368
204 Ga0495630_0046672 3300046517 Bacteria 3238
205 Ga0495630_0361916 3300046517 Bacteria 1110
206 Ga0495666_0013698 3300046526 Bacteria 4043
207 Ga0495652_0055431 3300046529 Bacteria 3371
208 Ga0495652_0404664 3300046529 Bacteria 965
209 Ga0495665_0009071 3300046531 Bacteria 5394
210 Ga0495665_0144277 3300046531 Bacteria 1243
211 Ga0495640_0012559 3300046533 Bacteria 6464
212 Ga0495640_0047480 3300046533 Bacteria 2971
213 Ga0495640_0129710 3300046533 Bacteria 1632
214 Ga0495586_0034951 3300046535 Bacteria 2700
215 Ga0495587_0012828 3300046536 Bacteria 5270
216 Ga0495587_0027899 3300046536 Bacteria 3437
217 Ga0495587_0050117 3300046536 Bacteria 2470
218 Ga0495645_0008527 3300046543 Bacteria 7158
219 Ga0495645_0009532 3300046543 Bacteria 6788
220 Ga0495645_0074794 3300046543 Bacteria 2438
221 Ga0495645_0122746 3300046543 Bacteria 1827
222 Ga0495667_0031240 3300046559 Bacteria 3576
223 Ga0495634_0020469 3300046642 Bacteria 4691
224 Ga0495634_0119341 3300046642 Bacteria 1689
225 Ga0495634_0184048 3300046642 Bacteria 1306
226 Ga0495635_0076759 3300046663 Bacteria 2289
227 Ga0495635_0214360 3300046663 Bacteria 1303
228 Ga0495588_0063500 3300046674 Bacteria 1915
229 Ga0495657_0041758 3300046675 Bacteria 3136
230 Ga0495657_0117126 3300046675 Bacteria 1681
231 Ga0495599_0113874 3300046678 Bacteria 1683
232 Ga0495623_0145922 3300046679 Bacteria 1403
233 Ga0495646_0031989 3300046680 Bacteria 3275
234 Ga0495647_0042461 3300046681 Bacteria 1736
235 Ga0495658_0024356 3300046683 Bacteria 3223
236 Ga0495658_0039908 3300046683 Bacteria 2607
237 Ga0495658_0052152 3300046683 Bacteria 2319
238 Ga0495613_0063006 3300046689 Bacteria 2713
239 Ga0495613_0122597 3300046689 Bacteria 1866
240 Ga0495624_0017803 3300046690 Bacteria 4761
241 Ga0495624_0087789 3300046690 Bacteria 1920
242 Ga0495624_0138653 3300046690 Bacteria 1490
243 Ga0495624_0146983 3300046690 Bacteria 1442
244 Ga0495624_0450554 3300046690 Bacteria 771
245 Ga0495600_0132335 3300046809 Bacteria 1621
246 Ga0495581_0030106 3300047315 Bacteria 3146
247 Ga0495581_0044779 3300047315 Bacteria 2558
248 Ga0495581_0069237 3300047315 Bacteria 2040
249 Ga0495604_0020065 3300047317 Bacteria 5341
250 Ga0495674_0014384 3300047319 Bacteria 7408
251 Ga0495674_0025786 3300047319 Bacteria 5383
252 Ga0495674_0128696 3300047319 Bacteria 2134
253 Ga0495676_0068830 3300047321 Bacteria 2733
254 Ga0495680_0014569 3300047322 Bacteria 6806
255 Ga0495680_0028244 3300047322 Bacteria 4600
256 Ga0495680_0054166 3300047322 Bacteria 3116
257 Ga0495680_0126183 3300047322 Bacteria 1884
258 Ga0495675_0046188 3300047444 Bacteria 2772
259 Ga0495675_0114038 3300047444 Bacteria 1685
260 Ga0495684_0039086 3300047471 Bacteria 3637
261 Ga0495684_0118540 3300047471 Bacteria 1995
262 Ga0495593_0054195 3300047673 Bacteria 2114
263 Ga0495593_0120165 3300047673 Bacteria 1337
264 Ga0495602_0033750 3300048088 Bacteria 4796
265 Ga0495602_0045956 3300048088 Bacteria 3948
266 Ga0495602_0322884 3300048088 Bacteria 1122
267 Ga0496100_0074076 3300048903 Bacteria 2280
268 Ga0496101_0047976 3300048904 Bacteria 3067
269 Ga0496102_0046372 3300048905 Bacteria 3948
270 Ga0496102_0111548 3300048905 Bacteria 2550
271 Ga0496104_0001119 3300048907 Bacteria 22942
272 Ga0496104_0014597 3300048907 Bacteria 7095
273 Ga0496104_0105993 3300048907 Bacteria 2693
274 Ga0496105_0003499 3300048908 Bacteria 11630
275 Ga0496105_0027786 3300048908 Bacteria 4624
276 Ga0496106_0069073 3300048909 Bacteria 2696
277 Ga0496106_0384039 3300048909 Bacteria 1128
278 Ga0496108_0056193 3300048911 Bacteria 3306
279 Ga0496108_0162397 3300048911 Bacteria 1931
280 Ga0496109_0005072 3300048912 Bacteria 11001
281 Ga0496109_0094394 3300048912 Bacteria 2769
282 Ga0496110_0021053 3300048913 Bacteria 5513
283 Ga0496111_0127846 3300048914 Bacteria 1879
284 Ga0496112_0000860 3300048915 Bacteria 21720
285 Ga0496112_0053295 3300048915 Bacteria 3972
286 Ga0496113_0027649 3300048916 Bacteria 4069
287 Ga0496113_0130942 3300048916 Bacteria 1968
288 Ga0496114_0032711 3300048917 Bacteria 4282
289 Ga0496115_0014179 3300048918 Bacteria 6031
290 Ga0496115_0031182 3300048918 Bacteria 4198
291 Ga0496125_0116229 3300048928 Bacteria 1921
292 Ga0501031_0092019 3300049568 Bacteria 1979
293 Ga0501032_0086323 3300049569 Bacteria 2086
294 Ga0501034_0298484 3300049571 Bacteria 1548
295 Ga0501034_0510173 3300049571 Bacteria 1115
296 Ga0501036_0006486 3300049572 Bacteria 9507
297 Ga0501036_0208393 3300049572 Bacteria 1643
298 Ga0501037_0019044 3300049573 Bacteria 5060
299 Ga0501038_0016782 3300049574 Bacteria 6630
300 Ga0501038_0351800 3300049574 Bacteria 1147
301 Ga0501039_0129202 3300049575 Bacteria 1983
302 Ga0501043_0098288 3300049579 Bacteria 2301
303 Ga0501047_0000015 3300049581 Bacteria 307932
304 Ga0501047_0123555 3300049581 Bacteria 2469
305 Ga0501047_0273722 3300049581 Bacteria 1534
306 Ga0501080_0049361 3300049742 Bacteria 3917
307 Ga0501035_0036693 3300049822 Bacteria 4441
308 Ga0501044_0279281 3300049823 Bacteria 1604
309 nmdc:mga05p37_58962_c1 3300050507 Bacteria 4728
310 nmdc:mga0n895_27172_c1 3300050512 Bacteria 5434
311 nmdc:mga0n895_43276_c1 3300050512 Bacteria 4388
312 nmdc:mga0n895_91237_c1 3300050512 Bacteria 3049
313 nmdc:mga0rr50_117692_c1 3300050513 Bacteria 2110
314 nmdc:mga0rr50_71937_c1 3300050513 Bacteria 2640
315 nmdc:mga08x19_21402_c1 3300050514 Bacteria 3991
316 nmdc:mga08x19_29707_c1 3300050514 Bacteria 3429
317 nmdc:mga08x19_75382_c1 3300050514 Bacteria 2205
318 nmdc:mga08x19_95752_c1 3300050514 Bacteria 1964
319 nmdc:mga0a205_37806_c1 3300050515 Bacteria 4642
320 Ga0495619_0021185 3300053085 Bacteria 4148
321 Ga0495619_0024390 3300053085 Bacteria 3880
322 Ga0495619_0065888 3300053085 Bacteria 2417
323 2515495810 2515154088 Bacteria 5526283
324 2515719435 2515154129 Bacteria 5584369
325 2515755625 2515154137 Bacteria 5711575
326 2516083774 2515154202 Bacteria 5471270
327 2644019245 2643221601 Bacteria 7493239
328 2644174153 2643221631 Bacteria 8168043
329 2812362703 2811994880 Bacteria 4147780
330 2819743790 2818991472 Bacteria 10089953
331 2831937002 2831935698 Bacteria 5963223
332 2844852578 2844849076 Bacteria 4091819
333 2862996756 2862993130 Bacteria 3860849
334 2995469247 2995463766 Bacteria 8577691
335 3006323505 3006321560 Bacteria 8247479
336 8003861271 8003856774 Bacteria 7675274
337 Ga0373928_0009377
338 JGI25152J39213_1001484
339 rootH2_10017219
340 Ga0070658_10000677
341 Ga0070682_100099264
342 Ga0070709_10005391
343 Ga0070709_10015188
344 Ga0070714_100003145
345 Ga0070714_100013600
346 Ga0070714_100016176
347 Ga0070714_100038688
348 Ga0070713_100007127
349 Ga0070713_100014692
350 Ga0070713_100152277
351 Ga0070710_10001679
352 Ga0070710_10008038
353 Ga0070710_10058165
354 Ga0070711_100006467
355 Ga0070711_100077569
356 Ga0070705_100120339
357 Ga0070708_100002180
358 Ga0070708_100002897
359 Ga0070706_100049766
360 Ga0070706_100063221
361 Ga0070706_100086260
362 Ga0070706_100123189
363 Ga0070707_100088562
364 Ga0070707_100237152
365 Ga0070698_100000013
366 Ga0070698_100225368
367 Ga0070684_100331982
368 Ga0070697_100213885
369 Ga0070695_100131399
370 Ga0070696_100030644
371 Ga0070696_100122949
372 Ga0070665_100058283
373 Ga0068855_100076638
374 Ga0068856_100029361
375 Ga0068856_100195919
376 Ga0068864_100192617
377 Ga0068863_100146122
378 Ga0068863_100498682
379 Ga0068858_100111412
380 Ga0068860_100448879
381 Ga0081540_1000270
382 Ga0070717_10002906
383 Ga0070717_10021204
384 Ga0070717_10055550
385 Ga0070717_10103782
386 Ga0070717_10120565
387 Ga0070717_10504309
388 Ga0070715_10031947
389 Ga0070716_100008374
390 Ga0070716_100019534
391 Ga0070712_100006050
392 Ga0075433_10119097
393 Ga0075433_10161756
394 Ga0075434_100013619
395 Ga0075434_100110359
396 Ga0075436_100020511
397 Ga0075436_100021588
398 Ga0075436_100038621
399 Ga0075436_100069150
400 Ga0075435_100175013
401 Ga0075435_100194706
402 Ga0111539_10206608
403 Ga0105247_10155237
404 Ga0114129_10085133
405 Ga0105243_10061801
406 Ga0105238_10325589
407 Ga0105246_10000119
408 Ga0157373_10048554
409 Ga0157370_10056578
410 Ga0163163_10013608
411 Ga0157379_10016832
412 Ga0157376_10052238
413 Ga0224572_1001106
414 Ga0209129_1000046
415 Ga0209025_1000875
416 Ga0209051_1045047
417 Ga0207697_10074168
418 Ga0207692_10002818
419 Ga0207692_10011724
420 Ga0207692_10041940
421 Ga0207692_10142586
422 Ga0207685_10061856
423 Ga0207699_10002155
424 Ga0207699_10013636
425 Ga0207699_10020682
426 Ga0207699_10092745
427 Ga0207705_10004269
428 Ga0207705_10035034
429 Ga0207684_10001895
430 Ga0207684_10005603
431 Ga0207684_10076346
432 Ga0207671_10103871
433 Ga0207693_10009931
434 Ga0207693_10048947
435 Ga0207693_10067432
436 Ga0207693_10175437
437 Ga0207663_10013701
438 Ga0207663_10020878
439 Ga0207652_10328167
440 Ga0207646_10070702
441 Ga0207700_10000949
442 Ga0207700_10007442
443 Ga0207700_10179632
444 Ga0207664_10000703
445 Ga0207664_10003202
446 Ga0207664_10030106
447 Ga0207709_10083636
448 Ga0207665_10000516
449 Ga0207665_10000944
450 Ga0207665_10228167
451 Ga0207667_10060718
452 Ga0207667_10185641
453 Ga0207703_10064934
454 Ga0207702_10020689
455 Ga0207702_10025260
456 Ga0207641_10114524
457 Ga0207676_10037919
458 Ga0268266_10045411
459 Ga0265325_10012328
460 Ga0265340_10013177
461 Ga0265340_10017319
462 Ga0265339_10030412
463 Ga0265316_10050617
464 Ga0307408_100103602
465 Ga0265313_10029532
466 Ga0265342_10111852
467 Ga0307416_100003582
468 Ga0307414_10039620
469 Ga0316212_1006922
470 Ga0373930_0008593
471 Ga0373944_0068166
472 Ga0373944_0076257
473 Ga0373949_0016753
474 Ga0373939_0028704
475 Ga0373945_0115070
476 Ga0373953_0004594
477 Ga0373956_0053064
478 Ga0373957_0002009
479 Ga0373960_0001453
480 Ga0373943_0027013
481 Ga0373943_0043591
482 Ga0373943_0076205
483 Ga0373955_0054863
484 Ga0373955_0132945
485 Ga0373962_0041097
486 Ga0373935_0029213
487 Ga0373927_0026207
488 Ga0373927_0177845
489 Ga0373933_0059197
490 Ga0373947_0017251
491 Ga0373947_0055205
492 Ga0373947_0320446
493 Ga0373925_0000872
494 Ga0373925_0064891
495 Ga0373925_0148193
496 Ga0373925_0308630
497 Ga0373925_0319317
498 Ga0373925_0450713
499 Ga0373925_0654388
500 Ga0395899_0043713
501 Ga0395900_0026526
502 Ga0395898_0069872
503 Ga0395898_0278124
504 Ga0436364_0322461
505 Ga0395901_0008722
506 Ga0395901_0226189
507 Ga0439449_0003540
508 Ga0466969_0002368
509 Ga0466966_0002406
510 Ga0466961_0085958
511 Ga0466963_0031857
512 Ga0466971_0120639
513 Ga0466970_0106996
514 Ga0466957_0001824
515 Ga0466960_0046868
516 Ga0466959_0027672
517 Ga0495592_0088236
518 Ga0495603_0042888
519 Ga0495629_0026620
520 Ga0495629_0029327
521 Ga0495629_0239276
522 Ga0495641_0023718
523 Ga0495641_0030049
524 Ga0495641_0170422
525 Ga0495651_0165391
526 Ga0495653_0095124
527 Ga0495653_0105079
528 Ga0495580_0162462
529 Ga0495582_0015920
530 Ga0495662_0022731
531 Ga0495662_0025842
532 Ga0495662_0054114
533 Ga0495608_0072607
534 Ga0495608_0084658
535 Ga0495608_0124546
536 Ga0495618_0015790
537 Ga0495618_0049298
538 Ga0495628_0030159
539 Ga0495628_0236249
540 Ga0495630_0046672
541 Ga0495630_0361916
542 Ga0495666_0013698
543 Ga0495652_0055431
544 Ga0495652_0404664
545 Ga0495665_0009071
546 Ga0495665_0144277
547 Ga0495640_0012559
548 Ga0495640_0047480
549 Ga0495640_0129710
550 Ga0495586_0034951
551 Ga0495587_0012828
552 Ga0495587_0027899
553 Ga0495587_0050117
554 Ga0495645_0008527
555 Ga0495645_0009532
556 Ga0495645_0074794
557 Ga0495645_0122746
558 Ga0495667_0031240
559 Ga0495634_0020469
560 Ga0495634_0119341
561 Ga0495634_0184048
562 Ga0495635_0076759
563 Ga0495635_0214360
564 Ga0495588_0063500
565 Ga0495657_0041758
566 Ga0495657_0117126
567 Ga0495599_0113874
568 Ga0495623_0145922
569 Ga0495646_0031989
570 Ga0495647_0042461
571 Ga0495658_0024356
572 Ga0495658_0039908
573 Ga0495658_0052152
574 Ga0495613_0063006
575 Ga0495613_0122597
576 Ga0495624_0017803
577 Ga0495624_0087789
578 Ga0495624_0138653
579 Ga0495624_0146983
580 Ga0495624_0450554
581 Ga0495600_0132335
582 Ga0495581_0030106
583 Ga0495581_0044779
584 Ga0495581_0069237
585 Ga0495604_0020065
586 Ga0495674_0014384
587 Ga0495674_0025786
588 Ga0495674_0128696
589 Ga0495676_0068830
590 Ga0495680_0014569
591 Ga0495680_0028244
592 Ga0495680_0054166
593 Ga0495680_0126183
594 Ga0495675_0046188
595 Ga0495675_0114038
596 Ga0495684_0039086
597 Ga0495684_0118540
598 Ga0495593_0054195
599 Ga0495593_0120165
600 Ga0495602_0033750
601 Ga0495602_0045956
602 Ga0495602_0322884
603 Ga0496100_0074076
604 Ga0496101_0047976
605 Ga0496102_0046372
606 Ga0496102_0111548
607 Ga0496104_0001119
608 Ga0496104_0014597
609 Ga0496104_0105993
610 Ga0496105_0003499
611 Ga0496105_0027786
612 Ga0496106_0069073
613 Ga0496106_0384039
614 Ga0496108_0056193
615 Ga0496108_0162397
616 Ga0496109_0005072
617 Ga0496109_0094394
618 Ga0496110_0021053
619 Ga0496111_0127846
620 Ga0496112_0000860
621 Ga0496112_0053295
622 Ga0496113_0027649
623 Ga0496113_0130942
624 Ga0496114_0032711
625 Ga0496115_0014179
626 Ga0496115_0031182
627 Ga0496125_0116229
628 Ga0501031_0092019
629 Ga0501032_0086323
630 Ga0501034_0298484
631 Ga0501034_0510173
632 Ga0501036_0006486
633 Ga0501036_0208393
634 Ga0501037_0019044
635 Ga0501038_0016782
636 Ga0501038_0351800
637 Ga0501039_0129202
638 Ga0501043_0098288
639 Ga0501047_0000015
640 Ga0501047_0123555
641 Ga0501047_0273722
642 Ga0501080_0049361
643 Ga0501035_0036693
644 Ga0501044_0279281
645 nmdc:mga05p37_58962_c1
646 nmdc:mga0n895_27172_c1
647 nmdc:mga0n895_43276_c1
648 nmdc:mga0n895_91237_c1
649 nmdc:mga0rr50_117692_c1
650 nmdc:mga0rr50_71937_c1
651 nmdc:mga08x19_21402_c1
652 nmdc:mga08x19_29707_c1
653 nmdc:mga08x19_75382_c1
654 nmdc:mga08x19_95752_c1
655 nmdc:mga0a205_37806_c1
656 Ga0495619_0021185
657 Ga0495619_0024390
658 Ga0495619_0065888
659 2515495810
660 2515719435
661 2515755625
662 2516083774
663 2644019245
664 2644174153
665 2812362703
666 2819743790
667 2831937002
668 2844852578
669 2862996756
670 2995469247
671 3006323505
672 8003861271

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02739

5_3_exonuc_N

5'-3' exonuclease, N-terminal resolvase-like domain

74

247

0.93

PF01367

5_3_exonuc

5'-3' exonuclease, C-terminal SAM fold

248

347

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6c34-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease mutant d125n 0.9422 4 308
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.9396 1 308
6c33-assembly1.cif.gz_A mycobacterium smegmatis dna flap endonuclease 0.9392 1 308
6c35-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d148n 0.9363 1 308
6c36-assembly1.cif.gz_A mycobacterium smegmatis flap endonuclease mutant d208n 0.9308 1 308
ID Description Score Start End Superfamily
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9496 1 183 3.40.50.1010
af_P9WNU3_1_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9299 1 183 3.40.50.1010
af_P9WNU5_7_186_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9287 1 183 3.40.50.1010
3zd8A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;5' to 3' exonuclease, C-terminal subdomain 0.9237 187 265 1.10.150.20
af_Q2FXN9_1_169_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.9221 3 181 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A852WZ57-F1-model_v4 5'-3' exonuclease 0.9828 1 309 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A2W6V6Q8-F1-model_v4 Flap endonuclease 0.9797 44 309 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7K2N428-F1-model_v4 Flap endonuclease 0.9781 6 215 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A132NAJ3-F1-model_v4 5'-3' exonuclease 0.9776 6 308 GO:0003677
GO:0008409
GO:0017108
GO:0033567
AF-A0A7X9LBM7-F1-model_v4 5'-3' exonuclease 0.9762 3 212 GO:0003677
GO:0008409
GO:0017108
GO:0033567

Map