F412569

General Info

Members Datasets Scaffolds Average Seq Length
336 189 672 167

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100269217|Ga0070706_1002692173
Length 179
Sequence VDDRAVVARQLGRAPRAFRRVVVSCPFGLPAVTEQEPYDAAGEPFPTTYYLTCPHLVAAVSRIEAAGGVERWSRAAAADPALEASLERASAEQRDVRRVLAAGRVGTDGGASLELGIGGAGRRGSLKCLHAHAAYALARPGYELGERILAELEPRWPDDCCTNRETESEPDSGPAPTLK

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
112 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
115 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
118 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
119 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
122 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
128 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
129 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
130 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
131 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
132 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
133 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
134 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
135 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
136 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
137 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
141 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
142 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
143 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
144 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
145 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
146 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
170 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
174 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
175 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
176 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
185 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
186 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
187 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 13.99
Rhizosphere 86.01
Stem 0
Stem Tuber 0
Unclassified 22.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100269217 3300005467 Bacteria 1590
2 Ga0070676_10095754 3300005328 Bacteria 1826
3 Ga0070683_100003111 3300005329 Bacteria 13374
4 Ga0070683_100151787 3300005329 Unclassified 2196
5 Ga0070683_100597646 3300005329 Unclassified 1056
6 Ga0070683_101009269 3300005329 Bacteria 799
7 Ga0070670_100404372 3300005331 Bacteria 1206
8 Ga0070677_10507949 3300005333 Bacteria 654
9 Ga0070680_100155101 3300005336 Bacteria 1923
10 Ga0070680_100889647 3300005336 Bacteria 768
11 Ga0070682_100015508 3300005337 Bacteria 4417
12 Ga0070682_100024671 3300005337 Bacteria 3581
13 Ga0068868_100167892 3300005338 Unclassified 1816
14 Ga0068868_100410661 3300005338 Bacteria 1170
15 Ga0070660_100001059 3300005339 Bacteria 18513
16 Ga0070689_100067323 3300005340 Bacteria 2792
17 Ga0070691_10158533 3300005341 Bacteria 1165
18 Ga0070687_100403234 3300005343 Bacteria 897
19 Ga0070687_100643270 3300005343 Bacteria 734
20 Ga0070661_100232513 3300005344 Bacteria 1417
21 Ga0070668_100547487 3300005347 Unclassified 1007
22 Ga0070675_100069180 3300005354 Bacteria 2924
23 Ga0070675_100117613 3300005354 Bacteria 2256
24 Ga0070671_100022733 3300005355 Bacteria 5123
25 Ga0070671_100289768 3300005355 Unclassified 1393
26 Ga0070674_100037015 3300005356 Bacteria 3280
27 Ga0070674_100055155 3300005356 Bacteria 2751
28 Ga0070674_100112823 3300005356 Bacteria 1999
29 Ga0070674_100446943 3300005356 Bacteria 1066
30 Ga0070673_100367202 3300005364 Bacteria 1281
31 Ga0070688_100036639 3300005365 Bacteria 2985
32 Ga0070659_101006682 3300005366 Bacteria 732
33 Ga0070709_10600724 3300005434 Bacteria 847
34 Ga0070709_11198735 3300005434 Bacteria 610
35 Ga0070714_100004166 3300005435 Bacteria 10876
36 Ga0070701_10084095 3300005438 Unclassified 1730
37 Ga0070701_10376606 3300005438 Bacteria 893
38 Ga0070701_11190883 3300005438 Bacteria 540
39 Ga0070705_100290076 3300005440 Bacteria 1168
40 Ga0070700_100104693 3300005441 Bacteria 1870
41 Ga0070700_100322184 3300005441 Bacteria 1136
42 Ga0070663_100219727 3300005455 Bacteria 1491
43 Ga0070663_100594596 3300005455 Bacteria 930
44 Ga0070678_100044715 3300005456 Bacteria 3164
45 Ga0070678_100174136 3300005456 Unclassified 1755
46 Ga0070678_100362020 3300005456 Bacteria 1250
47 Ga0070681_10035132 3300005458 Bacteria 5035
48 Ga0070681_10057827 3300005458 Bacteria 3858
49 Ga0070681_10764014 3300005458 Unclassified 883
50 Ga0068867_100234131 3300005459 Bacteria 1486
51 Ga0068867_100325529 3300005459 Unclassified 1275
52 Ga0068867_100645457 3300005459 Unclassified 928
53 Ga0068867_100967224 3300005459 Bacteria 770
54 Ga0070707_100511355 3300005468 Bacteria 1163
55 Ga0070698_100014470 3300005471 Bacteria 8332
56 Ga0070698_100630458 3300005471 Bacteria 1013
57 Ga0070679_100096651 3300005530 Bacteria 2941
58 Ga0070679_100122406 3300005530 Bacteria 2585
59 Ga0070684_100000342 3300005535 Bacteria 32228
60 Ga0070684_100136593 3300005535 Unclassified 2215
61 Ga0070672_100007084 3300005543 Bacteria 7584
62 Ga0070672_100161931 3300005543 Unclassified 1857
63 Ga0070696_100136234 3300005546 Unclassified 1790
64 Ga0070696_100137048 3300005546 Unclassified 1785
65 Ga0070693_100011821 3300005547 Bacteria 4404
66 Ga0070665_100075238 3300005548 Bacteria 3384
67 Ga0070664_100068784 3300005564 Bacteria 3028
68 Ga0070664_101918726 3300005564 Unclassified 562
69 Ga0068854_100644094 3300005578 Bacteria 909
70 Ga0068856_100033471 3300005614 Bacteria 5032
71 Ga0070702_100020298 3300005615 Bacteria 3478
72 Ga0070702_100376687 3300005615 Bacteria 1008
73 Ga0068852_101033007 3300005616 Bacteria 841
74 Ga0068859_100645993 3300005617 Bacteria 1150
75 Ga0068864_100012534 3300005618 Bacteria 7011
76 Ga0068866_10282401 3300005718 Bacteria 1029
77 Ga0068866_10386231 3300005718 Unclassified 899
78 Ga0068870_10017583 3300005840 Unclassified 3437
79 Ga0068870_10026466 3300005840 Unclassified 2892
80 Ga0068862_100648748 3300005844 Bacteria 1018
81 Ga0081455_10177687 3300005937 Bacteria 1615
82 Ga0081455_10189991 3300005937 Bacteria 1547
83 Ga0097621_100586073 3300006237 Unclassified 1018
84 Ga0068871_100103886 3300006358 Bacteria 2383
85 Ga0075434_100287816 3300006871 Bacteria 1663
86 Ga0075429_100111681 3300006880 Bacteria 2389
87 Ga0068865_100024765 3300006881 Unclassified 3941
88 Ga0068865_100285697 3300006881 Unclassified 1315
89 Ga0097620_100646056 3300006931 Bacteria 1150
90 Ga0075435_100442744 3300007076 Bacteria 1120
91 Ga0105240_10388335 3300009093 Unclassified 1575
92 Ga0105245_10002441 3300009098 Bacteria 16824
93 Ga0105245_10193811 3300009098 Unclassified 1948
94 Ga0105245_10233193 3300009098 Bacteria 1781
95 Ga0105245_10272585 3300009098 Bacteria 1651
96 Ga0105245_10369917 3300009098 Unclassified 1425
97 Ga0105243_10015096 3300009148 Bacteria 5846
98 Ga0105243_10080878 3300009148 Bacteria 2651
99 Ga0105243_10540548 3300009148 Unclassified 1111
100 Ga0105241_10061683 3300009174 Bacteria 2888
101 Ga0105242_10056859 3300009176 Unclassified 3202
102 Ga0105248_10531611 3300009177 Bacteria 1326
103 Ga0105239_10537628 3300010375 Bacteria 1330
104 Ga0105246_10004023 3300011119 Bacteria 8928
105 Ga0105246_10031290 3300011119 Bacteria 3521
106 Ga0105246_10163201 3300011119 Bacteria 1699
107 Ga0105246_10307837 3300011119 Unclassified 1282
108 Ga0105246_10817996 3300011119 Unclassified 828
109 Ga0157370_10585269 3300013104 Unclassified 1022
110 Ga0157369_10238381 3300013105 Bacteria 1900
111 Ga0157375_10101255 3300013308 Bacteria 2963
112 Ga0157375_10317604 3300013308 Bacteria 1722
113 Ga0163163_10016212 3300014325 Bacteria 6917
114 Ga0163163_10171223 3300014325 Bacteria 2218
115 Ga0163163_10453386 3300014325 Unclassified 1343
116 Ga0157380_10135060 3300014326 Unclassified 2110
117 Ga0182008_10353912 3300014497 Bacteria 779
118 Ga0157377_10004799 3300014745 Bacteria 6274
119 Ga0157376_10144040 3300014969 Bacteria 2141
120 Ga0157376_10428089 3300014969 Bacteria 1286
121 Ga0163161_10197201 3300017792 Unclassified 1550
122 Ga0207682_10269489 3300025893 Bacteria 795
123 Ga0207642_10409267 3300025899 Bacteria 813
124 Ga0207642_10613722 3300025899 Bacteria 678
125 Ga0207688_10206878 3300025901 Bacteria 1178
126 Ga0207645_10361696 3300025907 Unclassified 972
127 Ga0207643_10005178 3300025908 Bacteria 6973
128 Ga0207643_10023836 3300025908 Bacteria 3377
129 Ga0207643_10367107 3300025908 Bacteria 906
130 Ga0207643_10840274 3300025908 Bacteria 595
131 Ga0207684_10226840 3300025910 Bacteria 1612
132 Ga0207707_10001902 3300025912 Bacteria 19002
133 Ga0207707_10023929 3300025912 Bacteria 5339
134 Ga0207663_10855760 3300025916 Unclassified 726
135 Ga0207660_10006670 3300025917 Bacteria 7486
136 Ga0207660_10135776 3300025917 Bacteria 1877
137 Ga0207657_10013451 3300025919 Bacteria 8028
138 Ga0207652_10102571 3300025921 Bacteria 2529
139 Ga0207652_10135578 3300025921 Bacteria 2198
140 Ga0207650_10109591 3300025925 Bacteria 2135
141 Ga0207659_10012398 3300025926 Bacteria 5422
142 Ga0207659_10169213 3300025926 Bacteria 1723
143 Ga0207687_10002028 3300025927 Bacteria 13898
144 Ga0207687_10196331 3300025927 Unclassified 1574
145 Ga0207687_10293619 3300025927 Bacteria 1307
146 Ga0207700_11227356 3300025928 Unclassified 669
147 Ga0207664_10414611 3300025929 Bacteria 1199
148 Ga0207644_10053254 3300025931 Unclassified 2912
149 Ga0207709_10037489 3300025935 Bacteria 2881
150 Ga0207670_10374078 3300025936 Bacteria 1133
151 Ga0207669_10034598 3300025937 Unclassified 2864
152 Ga0207669_10201773 3300025937 Bacteria 1444
153 Ga0207704_10079696 3300025938 Bacteria 2111
154 Ga0207704_10487654 3300025938 Bacteria 991
155 Ga0207691_10166064 3300025940 Unclassified 1934
156 Ga0207691_10590035 3300025940 Unclassified 941
157 Ga0207689_10024496 3300025942 Bacteria 5064
158 Ga0207661_10000662 3300025944 Bacteria 22262
159 Ga0207661_10028194 3300025944 Bacteria 4298
160 Ga0207661_10198901 3300025944 Bacteria 1761
161 Ga0207661_10380462 3300025944 Bacteria 1278
162 Ga0207679_10051047 3300025945 Bacteria 3026
163 Ga0207651_10698098 3300025960 Bacteria 894
164 Ga0207668_10169503 3300025972 Unclassified 1711
165 Ga0207640_10464006 3300025981 Bacteria 1047
166 Ga0207677_10185638 3300026023 Unclassified 1640
167 Ga0207677_10574440 3300026023 Unclassified 986
168 Ga0207639_10352113 3300026041 Unclassified 1315
169 Ga0207678_10280877 3300026067 Bacteria 1429
170 Ga0207678_10287403 3300026067 Bacteria 1412
171 Ga0207708_10082679 3300026075 Unclassified 2469
172 Ga0207708_10572124 3300026075 Unclassified 955
173 Ga0207702_10024611 3300026078 Bacteria 4996
174 Ga0207702_10120192 3300026078 Bacteria 2350
175 Ga0207702_11279337 3300026078 Bacteria 728
176 Ga0207648_10077469 3300026089 Bacteria 2898
177 Ga0207648_10241190 3300026089 Bacteria 1609
178 Ga0207648_10612603 3300026089 Unclassified 1004
179 Ga0207683_10032917 3300026121 Unclassified 4504
180 Ga0207683_10072278 3300026121 Unclassified 3050
181 Ga0207698_11502854 3300026142 Bacteria 689
182 Ga0268266_10325009 3300028379 Unclassified 1441
183 Ga0268265_11109400 3300028380 Bacteria 786
184 Ga0265318_10040773 3300028577 Bacteria 1767
185 Ga0265324_10196158 3300029957 Bacteria 686
186 Ga0307408_100320915 3300031548 Bacteria 1305
187 Ga0373943_0463162 3300035170 Bacteria 738
188 Ga0373946_0049407 3300035171 Bacteria 1754
189 Ga0373925_0057208 3300037068 Bacteria 2922
190 Ga0395900_0036601 3300037418 Bacteria 5060
191 Ga0395900_0220445 3300037418 Unclassified 1912
192 Ga0395901_0086325 3300038443 Bacteria 3281
193 Ga0466963_0021815 3300044694 Bacteria 4046
194 Ga0466963_0074083 3300044694 Bacteria 2296
195 Ga0466967_0130034 3300045976 Bacteria 2336
196 Ga0466967_0174503 3300045976 Unclassified 2024
197 Ga0495603_0132647 3300046455 Bacteria 1450
198 Ga0495584_0330735 3300046491 Unclassified 774
199 Ga0495608_0289202 3300046511 Archaea 1016
200 Ga0495618_0093394 3300046514 Bacteria 1924
201 Ga0495652_0102550 3300046529 Bacteria 2318
202 Ga0495652_0598704 3300046529 Unclassified 752
203 Ga0495645_0307791 3300046543 Bacteria 1033
204 Ga0495656_0028645 3300046615 Bacteria 2235
205 Ga0495611_0275421 3300046648 Bacteria 778
206 Ga0495635_0255121 3300046663 Unclassified 1182
207 Ga0495647_0038924 3300046681 Bacteria 1800
208 Ga0495658_0520724 3300046683 Bacteria 761
209 Ga0495613_0317806 3300046689 Bacteria 1075
210 Ga0495613_0343792 3300046689 Unclassified 1026
211 Ga0495624_0067964 3300046690 Bacteria 2222
212 Ga0495649_0205818 3300046694 Unclassified 1021
213 Ga0495604_0276137 3300047317 Unclassified 1137
214 Ga0495636_0314718 3300047318 Bacteria 734
215 Ga0495674_0236041 3300047319 Unclassified 1508
216 Ga0495676_0250185 3300047321 Bacteria 1209
217 Ga0496100_0157529 3300048903 Bacteria 1625
218 Ga0496100_0283131 3300048903 Bacteria 1236
219 Ga0496100_0297255 3300048903 Bacteria 1208
220 Ga0496101_0014360 3300048904 Bacteria 5320
221 Ga0496101_0058566 3300048904 Bacteria 2790
222 Ga0496101_0125237 3300048904 Bacteria 1947
223 Ga0496101_0220529 3300048904 Unclassified 1472
224 Ga0496102_0001654 3300048905 Bacteria 19583
225 Ga0496102_0253247 3300048905 Bacteria 1660
226 Ga0496102_0451086 3300048905 Bacteria 1207
227 Ga0496103_0039727 3300048906 Bacteria 2891
228 Ga0496104_0001145 3300048907 Bacteria 22699
229 Ga0496104_0019550 3300048907 Bacteria 6200
230 Ga0496104_0070986 3300048907 Bacteria 3311
231 Ga0496105_0027655 3300048908 Bacteria 4635
232 Ga0496105_0198958 3300048908 Bacteria 1636
233 Ga0496106_0027262 3300048909 Bacteria 4255
234 Ga0496107_0493694 3300048910 Bacteria 908
235 Ga0496107_0704781 3300048910 Bacteria 742
236 Ga0496108_0023860 3300048911 Bacteria 5035
237 Ga0496108_0108163 3300048911 Bacteria 2375
238 Ga0496108_0275201 3300048911 Unclassified 1466
239 Ga0496108_1041995 3300048911 Unclassified 697
240 Ga0496109_0001504 3300048912 Bacteria 19386
241 Ga0496109_0057998 3300048912 Bacteria 3536
242 Ga0496109_0069658 3300048912 Unclassified 3226
243 Ga0496109_0627514 3300048912 Bacteria 1011
244 Ga0496110_0011414 3300048913 Bacteria 7270
245 Ga0496110_0025368 3300048913 Bacteria 5065
246 Ga0496110_0048811 3300048913 Bacteria 3711
247 Ga0496110_0191110 3300048913 Bacteria 1859
248 Ga0496110_0833428 3300048913 Unclassified 827
249 Ga0496111_0028815 3300048914 Bacteria 3937
250 Ga0496111_0032357 3300048914 Bacteria 3728
251 Ga0496111_0123233 3300048914 Bacteria 1915
252 Ga0496112_0016564 3300048915 Bacteria 6910
253 Ga0496112_0066059 3300048915 Bacteria 3569
254 Ga0496112_0181393 3300048915 Bacteria 2069
255 Ga0496112_0810647 3300048915 Bacteria 861
256 Ga0496113_0143233 3300048916 Bacteria 1882
257 Ga0496113_0235423 3300048916 Bacteria 1461
258 Ga0496114_0000956 3300048917 Bacteria 21611
259 Ga0496114_0001197 3300048917 Bacteria 19622
260 Ga0496114_0183029 3300048917 Bacteria 1830
261 Ga0496114_1239903 3300048917 Unclassified 632
262 Ga0496115_0008306 3300048918 Bacteria 7675
263 Ga0496115_0794080 3300048918 Bacteria 737
264 Ga0501031_0028209 3300049568 Bacteria 3659
265 Ga0501031_0178460 3300049568 Unclassified 1387
266 Ga0501032_0153962 3300049569 Bacteria 1511
267 Ga0501033_0314269 3300049570 Bacteria 1101
268 Ga0501036_0111715 3300049572 Bacteria 2309
269 Ga0501036_0149150 3300049572 Unclassified 1972
270 Ga0501036_0386968 3300049572 Bacteria 1167
271 Ga0501038_0536195 3300049574 Bacteria 892
272 Ga0501039_0028845 3300049575 Bacteria 4274
273 Ga0501040_0014233 3300049576 Bacteria 5239
274 Ga0501040_0127190 3300049576 Bacteria 1790
275 Ga0501040_1063614 3300049576 Bacteria 587
276 Ga0501041_0009008 3300049577 Bacteria 5870
277 Ga0501041_0014788 3300049577 Bacteria 4635
278 Ga0501042_0004406 3300049578 Bacteria 8981
279 Ga0501042_0023403 3300049578 Bacteria 4323
280 Ga0501042_0478328 3300049578 Bacteria 904
281 Ga0501042_0592638 3300049578 Bacteria 806
282 Ga0501043_0250948 3300049579 Unclassified 1363
283 Ga0501046_0042440 3300049580 Bacteria 3627
284 Ga0501048_0009826 3300049582 Bacteria 7173
285 Ga0501048_0083988 3300049582 Unclassified 2245
286 Ga0501067_0261419 3300049583 Bacteria 963
287 Ga0501068_0171278 3300049584 Bacteria 1370
288 Ga0501069_0113207 3300049585 Bacteria 1546
289 Ga0501070_0286716 3300049586 Bacteria 1343
290 Ga0501071_0014193 3300049587 Bacteria 5446
291 Ga0501071_0017644 3300049587 Bacteria 4927
292 Ga0501071_0101040 3300049587 Unclassified 2126
293 Ga0501071_0352433 3300049587 Bacteria 1120
294 Ga0501071_0636263 3300049587 Bacteria 821
295 Ga0501072_0013910 3300049588 Bacteria 6167
296 Ga0501072_0291802 3300049588 Bacteria 1297
297 Ga0501072_0317031 3300049588 Bacteria 1239
298 Ga0501072_0339688 3300049588 Bacteria 1193
299 Ga0501072_0371672 3300049588 Bacteria 1135
300 Ga0501072_0507780 3300049588 Bacteria 953
301 Ga0501074_0017090 3300049590 Bacteria 5263
302 Ga0501075_0016152 3300049591 Bacteria 5372
303 Ga0501075_0027799 3300049591 Bacteria 4170
304 Ga0501076_0128139 3300049592 Bacteria 2057
305 Ga0501076_0138647 3300049592 Unclassified 1975
306 Ga0501076_0590580 3300049592 Bacteria 916
307 Ga0501077_0014305 3300049593 Bacteria 4985
308 Ga0501077_0019132 3300049593 Bacteria 4330
309 Ga0501077_0742551 3300049593 Bacteria 631
310 Ga0501079_0041958 3300049741 Bacteria 3533
311 Ga0501079_0346514 3300049741 Bacteria 1164
312 Ga0501080_0099051 3300049742 Bacteria 2705
313 Ga0501081_0004797 3300049743 Bacteria 8692
314 Ga0501081_0218509 3300049743 Bacteria 1386
315 Ga0501081_0407297 3300049743 Bacteria 1007
316 Ga0501083_0077203 3300049744 Bacteria 2210
317 Ga0501045_0012666 3300049824 Bacteria 5937
318 Ga0501045_0015133 3300049824 Bacteria 5475
319 nmdc:mga0rr50_401824_c1 3300050513 Bacteria 1157
320 nmdc:mga0a205_707164_c1 3300050515 Bacteria 857
321 Ga0495601_0189859 3300053077 Bacteria 1343
322 Ga0495655_0064719 3300053083 Unclassified 1007
323 Ga0495619_0085433 3300053085 Bacteria 2131
324 Ga0495619_0453169 3300053085 Bacteria 884
325 Ga0501084_0037417 3300054114 Bacteria 4054
326 Ga0501084_0137162 3300054114 Unclassified 2059
327 Ga0501084_0348936 3300054114 Bacteria 1250
328 Ga0501084_0437452 3300054114 Unclassified 1106
329 Ga0501082_0016173 3300060353 Bacteria 6420
330 Ga0501082_0191324 3300060353 Bacteria 1780
331 Ga0530510_0035455 3300061734 Bacteria 3595
332 Ga0530510_0099244 3300061734 Bacteria 2129
333 Ga0530510_0141231 3300061734 Bacteria 1774
334 Ga0530510_0163986 3300061734 Bacteria 1644
335 Ga0530510_0354258 3300061734 Unclassified 1103
336 Ga0530510_0361615 3300061734 Bacteria 1091
337 Ga0070706_100269217
338 Ga0070676_10095754
339 Ga0070683_100003111
340 Ga0070683_100151787
341 Ga0070683_100597646
342 Ga0070683_101009269
343 Ga0070670_100404372
344 Ga0070677_10507949
345 Ga0070680_100155101
346 Ga0070680_100889647
347 Ga0070682_100015508
348 Ga0070682_100024671
349 Ga0068868_100167892
350 Ga0068868_100410661
351 Ga0070660_100001059
352 Ga0070689_100067323
353 Ga0070691_10158533
354 Ga0070687_100403234
355 Ga0070687_100643270
356 Ga0070661_100232513
357 Ga0070668_100547487
358 Ga0070675_100069180
359 Ga0070675_100117613
360 Ga0070671_100022733
361 Ga0070671_100289768
362 Ga0070674_100037015
363 Ga0070674_100055155
364 Ga0070674_100112823
365 Ga0070674_100446943
366 Ga0070673_100367202
367 Ga0070688_100036639
368 Ga0070659_101006682
369 Ga0070709_10600724
370 Ga0070709_11198735
371 Ga0070714_100004166
372 Ga0070701_10084095
373 Ga0070701_10376606
374 Ga0070701_11190883
375 Ga0070705_100290076
376 Ga0070700_100104693
377 Ga0070700_100322184
378 Ga0070663_100219727
379 Ga0070663_100594596
380 Ga0070678_100044715
381 Ga0070678_100174136
382 Ga0070678_100362020
383 Ga0070681_10035132
384 Ga0070681_10057827
385 Ga0070681_10764014
386 Ga0068867_100234131
387 Ga0068867_100325529
388 Ga0068867_100645457
389 Ga0068867_100967224
390 Ga0070707_100511355
391 Ga0070698_100014470
392 Ga0070698_100630458
393 Ga0070679_100096651
394 Ga0070679_100122406
395 Ga0070684_100000342
396 Ga0070684_100136593
397 Ga0070672_100007084
398 Ga0070672_100161931
399 Ga0070696_100136234
400 Ga0070696_100137048
401 Ga0070693_100011821
402 Ga0070665_100075238
403 Ga0070664_100068784
404 Ga0070664_101918726
405 Ga0068854_100644094
406 Ga0068856_100033471
407 Ga0070702_100020298
408 Ga0070702_100376687
409 Ga0068852_101033007
410 Ga0068859_100645993
411 Ga0068864_100012534
412 Ga0068866_10282401
413 Ga0068866_10386231
414 Ga0068870_10017583
415 Ga0068870_10026466
416 Ga0068862_100648748
417 Ga0081455_10177687
418 Ga0081455_10189991
419 Ga0097621_100586073
420 Ga0068871_100103886
421 Ga0075434_100287816
422 Ga0075429_100111681
423 Ga0068865_100024765
424 Ga0068865_100285697
425 Ga0097620_100646056
426 Ga0075435_100442744
427 Ga0105240_10388335
428 Ga0105245_10002441
429 Ga0105245_10193811
430 Ga0105245_10233193
431 Ga0105245_10272585
432 Ga0105245_10369917
433 Ga0105243_10015096
434 Ga0105243_10080878
435 Ga0105243_10540548
436 Ga0105241_10061683
437 Ga0105242_10056859
438 Ga0105248_10531611
439 Ga0105239_10537628
440 Ga0105246_10004023
441 Ga0105246_10031290
442 Ga0105246_10163201
443 Ga0105246_10307837
444 Ga0105246_10817996
445 Ga0157370_10585269
446 Ga0157369_10238381
447 Ga0157375_10101255
448 Ga0157375_10317604
449 Ga0163163_10016212
450 Ga0163163_10171223
451 Ga0163163_10453386
452 Ga0157380_10135060
453 Ga0182008_10353912
454 Ga0157377_10004799
455 Ga0157376_10144040
456 Ga0157376_10428089
457 Ga0163161_10197201
458 Ga0207682_10269489
459 Ga0207642_10409267
460 Ga0207642_10613722
461 Ga0207688_10206878
462 Ga0207645_10361696
463 Ga0207643_10005178
464 Ga0207643_10023836
465 Ga0207643_10367107
466 Ga0207643_10840274
467 Ga0207684_10226840
468 Ga0207707_10001902
469 Ga0207707_10023929
470 Ga0207663_10855760
471 Ga0207660_10006670
472 Ga0207660_10135776
473 Ga0207657_10013451
474 Ga0207652_10102571
475 Ga0207652_10135578
476 Ga0207650_10109591
477 Ga0207659_10012398
478 Ga0207659_10169213
479 Ga0207687_10002028
480 Ga0207687_10196331
481 Ga0207687_10293619
482 Ga0207700_11227356
483 Ga0207664_10414611
484 Ga0207644_10053254
485 Ga0207709_10037489
486 Ga0207670_10374078
487 Ga0207669_10034598
488 Ga0207669_10201773
489 Ga0207704_10079696
490 Ga0207704_10487654
491 Ga0207691_10166064
492 Ga0207691_10590035
493 Ga0207689_10024496
494 Ga0207661_10000662
495 Ga0207661_10028194
496 Ga0207661_10198901
497 Ga0207661_10380462
498 Ga0207679_10051047
499 Ga0207651_10698098
500 Ga0207668_10169503
501 Ga0207640_10464006
502 Ga0207677_10185638
503 Ga0207677_10574440
504 Ga0207639_10352113
505 Ga0207678_10280877
506 Ga0207678_10287403
507 Ga0207708_10082679
508 Ga0207708_10572124
509 Ga0207702_10024611
510 Ga0207702_10120192
511 Ga0207702_11279337
512 Ga0207648_10077469
513 Ga0207648_10241190
514 Ga0207648_10612603
515 Ga0207683_10032917
516 Ga0207683_10072278
517 Ga0207698_11502854
518 Ga0268266_10325009
519 Ga0268265_11109400
520 Ga0265318_10040773
521 Ga0265324_10196158
522 Ga0307408_100320915
523 Ga0373943_0463162
524 Ga0373946_0049407
525 Ga0373925_0057208
526 Ga0395900_0036601
527 Ga0395900_0220445
528 Ga0395901_0086325
529 Ga0466963_0021815
530 Ga0466963_0074083
531 Ga0466967_0130034
532 Ga0466967_0174503
533 Ga0495603_0132647
534 Ga0495584_0330735
535 Ga0495608_0289202
536 Ga0495618_0093394
537 Ga0495652_0102550
538 Ga0495652_0598704
539 Ga0495645_0307791
540 Ga0495656_0028645
541 Ga0495611_0275421
542 Ga0495635_0255121
543 Ga0495647_0038924
544 Ga0495658_0520724
545 Ga0495613_0317806
546 Ga0495613_0343792
547 Ga0495624_0067964
548 Ga0495649_0205818
549 Ga0495604_0276137
550 Ga0495636_0314718
551 Ga0495674_0236041
552 Ga0495676_0250185
553 Ga0496100_0157529
554 Ga0496100_0283131
555 Ga0496100_0297255
556 Ga0496101_0014360
557 Ga0496101_0058566
558 Ga0496101_0125237
559 Ga0496101_0220529
560 Ga0496102_0001654
561 Ga0496102_0253247
562 Ga0496102_0451086
563 Ga0496103_0039727
564 Ga0496104_0001145
565 Ga0496104_0019550
566 Ga0496104_0070986
567 Ga0496105_0027655
568 Ga0496105_0198958
569 Ga0496106_0027262
570 Ga0496107_0493694
571 Ga0496107_0704781
572 Ga0496108_0023860
573 Ga0496108_0108163
574 Ga0496108_0275201
575 Ga0496108_1041995
576 Ga0496109_0001504
577 Ga0496109_0057998
578 Ga0496109_0069658
579 Ga0496109_0627514
580 Ga0496110_0011414
581 Ga0496110_0025368
582 Ga0496110_0048811
583 Ga0496110_0191110
584 Ga0496110_0833428
585 Ga0496111_0028815
586 Ga0496111_0032357
587 Ga0496111_0123233
588 Ga0496112_0016564
589 Ga0496112_0066059
590 Ga0496112_0181393
591 Ga0496112_0810647
592 Ga0496113_0143233
593 Ga0496113_0235423
594 Ga0496114_0000956
595 Ga0496114_0001197
596 Ga0496114_0183029
597 Ga0496114_1239903
598 Ga0496115_0008306
599 Ga0496115_0794080
600 Ga0501031_0028209
601 Ga0501031_0178460
602 Ga0501032_0153962
603 Ga0501033_0314269
604 Ga0501036_0111715
605 Ga0501036_0149150
606 Ga0501036_0386968
607 Ga0501038_0536195
608 Ga0501039_0028845
609 Ga0501040_0014233
610 Ga0501040_0127190
611 Ga0501040_1063614
612 Ga0501041_0009008
613 Ga0501041_0014788
614 Ga0501042_0004406
615 Ga0501042_0023403
616 Ga0501042_0478328
617 Ga0501042_0592638
618 Ga0501043_0250948
619 Ga0501046_0042440
620 Ga0501048_0009826
621 Ga0501048_0083988
622 Ga0501067_0261419
623 Ga0501068_0171278
624 Ga0501069_0113207
625 Ga0501070_0286716
626 Ga0501071_0014193
627 Ga0501071_0017644
628 Ga0501071_0101040
629 Ga0501071_0352433
630 Ga0501071_0636263
631 Ga0501072_0013910
632 Ga0501072_0291802
633 Ga0501072_0317031
634 Ga0501072_0339688
635 Ga0501072_0371672
636 Ga0501072_0507780
637 Ga0501074_0017090
638 Ga0501075_0016152
639 Ga0501075_0027799
640 Ga0501076_0128139
641 Ga0501076_0138647
642 Ga0501076_0590580
643 Ga0501077_0014305
644 Ga0501077_0019132
645 Ga0501077_0742551
646 Ga0501079_0041958
647 Ga0501079_0346514
648 Ga0501080_0099051
649 Ga0501081_0004797
650 Ga0501081_0218509
651 Ga0501081_0407297
652 Ga0501083_0077203
653 Ga0501045_0012666
654 Ga0501045_0015133
655 nmdc:mga0rr50_401824_c1
656 nmdc:mga0a205_707164_c1
657 Ga0495601_0189859
658 Ga0495655_0064719
659 Ga0495619_0085433
660 Ga0495619_0453169
661 Ga0501084_0037417
662 Ga0501084_0137162
663 Ga0501084_0348936
664 Ga0501084_0437452
665 Ga0501082_0016173
666 Ga0501082_0191324
667 Ga0530510_0035455
668 Ga0530510_0099244
669 Ga0530510_0141231
670 Ga0530510_0163986
671 Ga0530510_0354258
672 Ga0530510_0361615

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04417

DUF501

Protein of unknown function (DUF501)

21

150

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dbt-assembly1.cif.gz_W "e. coli atp synthase imaged in 10mm mgatp state2 ""down" 0.3238 54 114
6gxz-assembly2.cif.gz_C crystal structure of the human rpap3(tpr2)-pih1d1(cs) complex 0.2415 55 152
2a7u-assembly1.cif.gz_B nmr solution structure of the e.coli f-atpase delta subunit n-terminal domain in complex with alpha subunit n-terminal 22 residues 0.2338 54 149
2xev-assembly1.cif.gz_A crystal structure of the tpr domain of xanthomonas campestris ybgf 0.2055 56 155
2a7u-assembly1.cif.gz_B nmr solution structure of the e.coli f-atpase delta subunit n-terminal domain in complex with alpha subunit n-terminal 22 residues 0.2032 54 149
ID Description Score Start End Superfamily
af_A0A0R0IB84_58_177_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.3682 52 167 1.10.520.10
af_A0A0R0IB84_58_177_1.10.520.10 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1; 0.2927 52 167 1.10.520.10
af_Q96T54_11_289_1.10.287.70 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.2437 54 170 1.10.287.70
2a7uB00 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.2338 54 149 1.10.520.20
2xevA00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.2055 56 155 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A7V9JP12-F1-model_v4 DUF501 domain-containing protein 0.9866 1 163
AF-A0A7V9CR68-F1-model_v4 DUF501 domain-containing protein 0.9861 1 162
AF-A0A538DC47-F1-model_v4 DUF501 domain-containing protein 0.9794 1 162
AF-A0A7V9JP12-F1-model_v4 DUF501 domain-containing protein 0.9747 1 163
AF-A0A538G6S4-F1-model_v4 DUF501 domain-containing protein 0.9691 1 140

Map