F412547
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 336 | 157 | 336 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300005353|Ga0070669_100153768|Ga0070669_1001537682 |
| Length | 189 |
| Sequence | VKINAGAAKSYAKALFDLARERNQADQIQTELDQIAQQIAGDAELMAVLGRPWVTPAVKQQIAKSVGERLQLSKLGQDFLALVAAHGRADHLAAIAETYRGMLDAAHGRVRARVRTAVPLTEADRTALGQRLGRALASNAGSAKPLDVVIEEVLDKHLLGGFVAEIGSLVVDGSLDGQLARMRERLVKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 7 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 30 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 33 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 34 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 37 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 38 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 39 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 40 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 41 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 42 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 43 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 44 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 45 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 46 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 47 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 86 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 88 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 89 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 90 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 91 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 92 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 93 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 94 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 95 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 96 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 97 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 98 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 100 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 101 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 103 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 104 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 105 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 106 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 107 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 108 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 109 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 110 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 111 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 122 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 123 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 124 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 125 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 126 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 127 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 128 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 129 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 130 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 131 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 132 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 133 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 134 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 135 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 136 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 137 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 139 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 140 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 141 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 142 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 143 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 144 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 145 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 146 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 147 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 148 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 149 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 150 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 151 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 152 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 153 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 154 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 155 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 156 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 2.68 |
| Rhizosphere | 97.32 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10015956 | 3300003203 | Bacteria | 3148 |
| 2 | Ga0065712_10174252 | 3300005290 | Bacteria | 1226 |
| 3 | Ga0070676_10043287 | 3300005328 | Bacteria | 2617 |
| 4 | Ga0068869_100012417 | 3300005334 | Bacteria | 5630 |
| 5 | Ga0070680_100235179 | 3300005336 | Bacteria | 1548 |
| 6 | Ga0070680_100582908 | 3300005336 | Bacteria | 960 |
| 7 | Ga0070692_10189265 | 3300005345 | Bacteria | 1198 |
| 8 | Ga0070669_100153768 | 3300005353 | Bacteria | 1782 |
| 9 | Ga0070674_100487742 | 3300005356 | Bacteria | 1024 |
| 10 | Ga0070659_100438081 | 3300005366 | Bacteria | 1107 |
| 11 | Ga0070703_10038863 | 3300005406 | Bacteria | 1473 |
| 12 | Ga0070705_100002975 | 3300005440 | Bacteria | 8376 |
| 13 | Ga0070705_100145563 | 3300005440 | Bacteria | 1565 |
| 14 | Ga0070700_100237775 | 3300005441 | Bacteria | 1300 |
| 15 | Ga0070694_100034946 | 3300005444 | Bacteria | 3319 |
| 16 | Ga0070694_100215516 | 3300005444 | Bacteria | 1438 |
| 17 | Ga0070694_100316040 | 3300005444 | Bacteria | 1201 |
| 18 | Ga0070694_100529848 | 3300005444 | Bacteria | 941 |
| 19 | Ga0070708_100033154 | 3300005445 | Bacteria | 4486 |
| 20 | Ga0070708_100036034 | 3300005445 | Bacteria | 4313 |
| 21 | Ga0070708_100184030 | 3300005445 | Bacteria | 1953 |
| 22 | Ga0070708_100588291 | 3300005445 | Bacteria | 1049 |
| 23 | Ga0070663_101142777 | 3300005455 | Unclassified | 682 |
| 24 | Ga0070662_100025632 | 3300005457 | Bacteria | 4074 |
| 25 | Ga0070681_10135884 | 3300005458 | Bacteria | 2390 |
| 26 | Ga0068867_100232542 | 3300005459 | Unclassified | 1491 |
| 27 | Ga0068867_100435961 | 3300005459 | Bacteria | 1113 |
| 28 | Ga0070706_100015740 | 3300005467 | Bacteria | 6985 |
| 29 | Ga0070706_100188895 | 3300005467 | Bacteria | 1925 |
| 30 | Ga0070706_100614379 | 3300005467 | Bacteria | 1010 |
| 31 | Ga0070707_100048747 | 3300005468 | Bacteria | 4058 |
| 32 | Ga0070707_100240652 | 3300005468 | Bacteria | 1761 |
| 33 | Ga0070707_100391043 | 3300005468 | Bacteria | 1350 |
| 34 | Ga0070698_100243249 | 3300005471 | Bacteria | 1732 |
| 35 | Ga0070698_101575254 | 3300005471 | Bacteria | 609 |
| 36 | Ga0070699_100122232 | 3300005518 | Bacteria | 2290 |
| 37 | Ga0070699_100123862 | 3300005518 | Bacteria | 2274 |
| 38 | Ga0070699_100212172 | 3300005518 | Bacteria | 1724 |
| 39 | Ga0070697_100045576 | 3300005536 | Bacteria | 3554 |
| 40 | Ga0070697_100101819 | 3300005536 | Bacteria | 2386 |
| 41 | Ga0070697_100398664 | 3300005536 | Bacteria | 1194 |
| 42 | Ga0070672_100044337 | 3300005543 | Bacteria | 3434 |
| 43 | Ga0070672_100872231 | 3300005543 | Bacteria | 794 |
| 44 | Ga0070695_100018279 | 3300005545 | Bacteria | 4256 |
| 45 | Ga0070695_100030118 | 3300005545 | Bacteria | 3377 |
| 46 | Ga0070696_100055284 | 3300005546 | Bacteria | 2768 |
| 47 | Ga0070696_100175618 | 3300005546 | Bacteria | 1586 |
| 48 | Ga0070696_100411883 | 3300005546 | Bacteria | 1060 |
| 49 | Ga0070693_100169249 | 3300005547 | Unclassified | 1398 |
| 50 | Ga0070704_100018330 | 3300005549 | Bacteria | 4474 |
| 51 | Ga0070704_100185712 | 3300005549 | Bacteria | 1667 |
| 52 | Ga0070704_101062660 | 3300005549 | Bacteria | 734 |
| 53 | Ga0068859_100433412 | 3300005617 | Bacteria | 1411 |
| 54 | Ga0068866_10196754 | 3300005718 | Bacteria | 1202 |
| 55 | Ga0068866_10487582 | 3300005718 | Bacteria | 813 |
| 56 | Ga0068861_100099002 | 3300005719 | Bacteria | 2315 |
| 57 | Ga0068861_100269454 | 3300005719 | Bacteria | 1461 |
| 58 | Ga0068863_100360228 | 3300005841 | Bacteria | 1418 |
| 59 | Ga0068860_100179003 | 3300005843 | Bacteria | 2049 |
| 60 | Ga0068862_100149668 | 3300005844 | Bacteria | 2077 |
| 61 | Ga0068862_100250560 | 3300005844 | Bacteria | 1614 |
| 62 | Ga0068862_100620797 | 3300005844 | Bacteria | 1040 |
| 63 | Ga0081455_10216670 | 3300005937 | Bacteria | 1422 |
| 64 | Ga0081455_10218266 | 3300005937 | Bacteria | 1415 |
| 65 | Ga0081538_10011202 | 3300005981 | Bacteria | 7284 |
| 66 | Ga0081540_1173869 | 3300005983 | Bacteria | 816 |
| 67 | Ga0081539_10000002 | 3300005985 | Bacteria | 601032 |
| 68 | Ga0075427_10017526 | 3300006194 | Bacteria | 1118 |
| 69 | Ga0075428_100000632 | 3300006844 | Bacteria | 36076 |
| 70 | Ga0075428_100030167 | 3300006844 | Bacteria | 5998 |
| 71 | Ga0075428_100229022 | 3300006844 | Bacteria | 2005 |
| 72 | Ga0075430_100011228 | 3300006846 | Bacteria | 7597 |
| 73 | Ga0075430_100057083 | 3300006846 | Bacteria | 3284 |
| 74 | Ga0075430_100170246 | 3300006846 | Unclassified | 1812 |
| 75 | Ga0075430_100316164 | 3300006846 | Bacteria | 1291 |
| 76 | Ga0075431_100001140 | 3300006847 | Bacteria | 23868 |
| 77 | Ga0075431_100043271 | 3300006847 | Bacteria | 4648 |
| 78 | Ga0075431_100061393 | 3300006847 | Bacteria | 3878 |
| 79 | Ga0075431_100074165 | 3300006847 | Bacteria | 3511 |
| 80 | Ga0075431_100164748 | 3300006847 | Bacteria | 2279 |
| 81 | Ga0075431_100332932 | 3300006847 | Bacteria | 1529 |
| 82 | Ga0075433_10011217 | 3300006852 | Bacteria | 7211 |
| 83 | Ga0075433_10011794 | 3300006852 | Bacteria | 7040 |
| 84 | Ga0075433_10035412 | 3300006852 | Bacteria | 4292 |
| 85 | Ga0075433_10043241 | 3300006852 | Bacteria | 3909 |
| 86 | Ga0075433_10047845 | 3300006852 | Bacteria | 3720 |
| 87 | Ga0075433_10215856 | 3300006852 | Bacteria | 1704 |
| 88 | Ga0075433_10510721 | 3300006852 | Bacteria | 1057 |
| 89 | Ga0075433_11123838 | 3300006852 | Bacteria | 683 |
| 90 | Ga0075434_100000331 | 3300006871 | Bacteria | 34017 |
| 91 | Ga0075434_100017950 | 3300006871 | Bacteria | 6827 |
| 92 | Ga0075434_100049964 | 3300006871 | Bacteria | 4154 |
| 93 | Ga0075434_100078842 | 3300006871 | Bacteria | 3290 |
| 94 | Ga0075434_100108580 | 3300006871 | Bacteria | 2785 |
| 95 | Ga0075434_100144917 | 3300006871 | Bacteria | 2395 |
| 96 | Ga0075434_100380747 | 3300006871 | Bacteria | 1432 |
| 97 | Ga0075434_100467647 | 3300006871 | Unclassified | 1282 |
| 98 | Ga0075434_100676131 | 3300006871 | Unclassified | 1050 |
| 99 | Ga0075434_100866480 | 3300006871 | Unclassified | 918 |
| 100 | Ga0075434_100889649 | 3300006871 | Bacteria | 905 |
| 101 | Ga0075434_101149711 | 3300006871 | Bacteria | 789 |
| 102 | Ga0075429_100001406 | 3300006880 | Bacteria | 19700 |
| 103 | Ga0075429_100033237 | 3300006880 | Bacteria | 4481 |
| 104 | Ga0075429_100061598 | 3300006880 | Bacteria | 3269 |
| 105 | Ga0075429_100340429 | 3300006880 | Bacteria | 1313 |
| 106 | Ga0075429_100521315 | 3300006880 | Bacteria | 1041 |
| 107 | Ga0075436_100056114 | 3300006914 | Bacteria | 2721 |
| 108 | Ga0075436_100095707 | 3300006914 | Bacteria | 2065 |
| 109 | Ga0097620_100433429 | 3300006931 | Bacteria | 1411 |
| 110 | Ga0075435_100011953 | 3300007076 | Bacteria | 6413 |
| 111 | Ga0075435_100045900 | 3300007076 | Bacteria | 3503 |
| 112 | Ga0075435_100051046 | 3300007076 | Bacteria | 3330 |
| 113 | Ga0075435_100077808 | 3300007076 | Bacteria | 2720 |
| 114 | Ga0075435_100212282 | 3300007076 | Bacteria | 1642 |
| 115 | Ga0075435_100448405 | 3300007076 | Bacteria | 1113 |
| 116 | Ga0099794_10002836 | 3300007265 | Bacteria | 6496 |
| 117 | Ga0111539_10054924 | 3300009094 | Bacteria | 4736 |
| 118 | Ga0111539_10118313 | 3300009094 | Bacteria | 3106 |
| 119 | Ga0111539_10786486 | 3300009094 | Bacteria | 1107 |
| 120 | Ga0111539_11821559 | 3300009094 | Unclassified | 706 |
| 121 | Ga0114129_10001745 | 3300009147 | Bacteria | 29582 |
| 122 | Ga0114129_10017933 | 3300009147 | Bacteria | 10078 |
| 123 | Ga0114129_10021512 | 3300009147 | Bacteria | 9155 |
| 124 | Ga0114129_10026003 | 3300009147 | Bacteria | 8289 |
| 125 | Ga0114129_10028977 | 3300009147 | Bacteria | 7843 |
| 126 | Ga0114129_10060544 | 3300009147 | Bacteria | 5293 |
| 127 | Ga0114129_10099708 | 3300009147 | Bacteria | 4020 |
| 128 | Ga0114129_10272828 | 3300009147 | Bacteria | 2262 |
| 129 | Ga0114129_10418912 | 3300009147 | Bacteria | 1762 |
| 130 | Ga0114129_10442991 | 3300009147 | Bacteria | 1705 |
| 131 | Ga0114129_10628914 | 3300009147 | Bacteria | 1387 |
| 132 | Ga0114129_10670015 | 3300009147 | Bacteria | 1337 |
| 133 | Ga0114129_10886122 | 3300009147 | Bacteria | 1132 |
| 134 | Ga0105243_10380867 | 3300009148 | Bacteria | 1305 |
| 135 | Ga0105243_10439665 | 3300009148 | Bacteria | 1221 |
| 136 | Ga0105241_10201173 | 3300009174 | Bacteria | 1664 |
| 137 | Ga0105249_11020797 | 3300009553 | Bacteria | 896 |
| 138 | Ga0157373_10189883 | 3300013100 | Bacteria | 1448 |
| 139 | Ga0157378_10210896 | 3300013297 | Bacteria | 1842 |
| 140 | Ga0157378_10294926 | 3300013297 | Bacteria | 1567 |
| 141 | Ga0163162_10554214 | 3300013306 | Bacteria | 1278 |
| 142 | Ga0163162_10718226 | 3300013306 | Bacteria | 1120 |
| 143 | Ga0157375_10207641 | 3300013308 | Bacteria | 2115 |
| 144 | Ga0157375_10345056 | 3300013308 | Bacteria | 1654 |
| 145 | Ga0157375_10646708 | 3300013308 | Bacteria | 1214 |
| 146 | Ga0163163_10170116 | 3300014325 | Bacteria | 2225 |
| 147 | Ga0157380_10615073 | 3300014326 | Bacteria | 1077 |
| 148 | Ga0157380_10871792 | 3300014326 | Unclassified | 924 |
| 149 | Ga0157377_10177570 | 3300014745 | Bacteria | 1336 |
| 150 | Ga0157379_10356473 | 3300014968 | Bacteria | 1340 |
| 151 | Ga0163161_10253143 | 3300017792 | Bacteria | 1373 |
| 152 | Ga0207653_10039676 | 3300025885 | Bacteria | 1542 |
| 153 | Ga0207642_10017368 | 3300025899 | Bacteria | 2735 |
| 154 | Ga0207645_10061565 | 3300025907 | Bacteria | 2398 |
| 155 | Ga0207684_10009724 | 3300025910 | Bacteria | 8479 |
| 156 | Ga0207684_10045417 | 3300025910 | Bacteria | 3726 |
| 157 | Ga0207707_10166135 | 3300025912 | Bacteria | 1929 |
| 158 | Ga0207660_10796321 | 3300025917 | Unclassified | 771 |
| 159 | Ga0207652_10180707 | 3300025921 | Unclassified | 1896 |
| 160 | Ga0207646_10121036 | 3300025922 | Bacteria | 2351 |
| 161 | Ga0207646_10227441 | 3300025922 | Bacteria | 1685 |
| 162 | Ga0207646_10378450 | 3300025922 | Bacteria | 1279 |
| 163 | Ga0207687_10133876 | 3300025927 | Bacteria | 1872 |
| 164 | Ga0207690_10629270 | 3300025932 | Bacteria | 878 |
| 165 | Ga0207706_10015189 | 3300025933 | Bacteria | 6968 |
| 166 | Ga0207706_10031900 | 3300025933 | Bacteria | 4694 |
| 167 | Ga0207709_10312337 | 3300025935 | Bacteria | 1173 |
| 168 | Ga0207709_10415988 | 3300025935 | Bacteria | 1031 |
| 169 | Ga0207669_10502050 | 3300025937 | Unclassified | 971 |
| 170 | Ga0207704_10382023 | 3300025938 | Bacteria | 1106 |
| 171 | Ga0207691_10009823 | 3300025940 | Bacteria | 9188 |
| 172 | Ga0207689_10017708 | 3300025942 | Bacteria | 6021 |
| 173 | Ga0207712_10147852 | 3300025961 | Bacteria | 1811 |
| 174 | Ga0207712_10829626 | 3300025961 | Bacteria | 814 |
| 175 | Ga0207712_10832412 | 3300025961 | Bacteria | 813 |
| 176 | Ga0207641_10305573 | 3300026088 | Bacteria | 1504 |
| 177 | Ga0207641_10570280 | 3300026088 | Bacteria | 1105 |
| 178 | Ga0207648_10319504 | 3300026089 | Bacteria | 1395 |
| 179 | Ga0207648_10350404 | 3300026089 | Unclassified | 1331 |
| 180 | Ga0207675_100163824 | 3300026118 | Bacteria | 2122 |
| 181 | Ga0207675_100221340 | 3300026118 | Bacteria | 1824 |
| 182 | Ga0207675_100476490 | 3300026118 | Bacteria | 1240 |
| 183 | Ga0207675_100860550 | 3300026118 | Bacteria | 922 |
| 184 | Ga0209588_1033346 | 3300027671 | Bacteria | 1651 |
| 185 | Ga0207428_10001754 | 3300027907 | Bacteria | 22214 |
| 186 | Ga0207428_10003735 | 3300027907 | Bacteria | 14616 |
| 187 | Ga0207428_10031901 | 3300027907 | Bacteria | 4339 |
| 188 | Ga0268265_10211047 | 3300028380 | Bacteria | 1692 |
| 189 | Ga0268265_10341017 | 3300028380 | Bacteria | 1364 |
| 190 | Ga0268265_10362594 | 3300028380 | Bacteria | 1327 |
| 191 | Ga0307408_100002186 | 3300031548 | Bacteria | 13985 |
| 192 | Ga0307408_100067291 | 3300031548 | Bacteria | 2634 |
| 193 | Ga0307408_100083795 | 3300031548 | Bacteria | 2390 |
| 194 | Ga0307412_10018941 | 3300031911 | Bacteria | 4156 |
| 195 | Ga0307416_100002121 | 3300032002 | Bacteria | 11208 |
| 196 | Ga0307411_10529045 | 3300032005 | Bacteria | 1002 |
| 197 | Ga0307415_100731950 | 3300032126 | Bacteria | 896 |
| 198 | Ga0373930_0008771 | 3300034816 | Bacteria | 1774 |
| 199 | Ga0373928_0068574 | 3300035084 | Unclassified | 872 |
| 200 | Ga0373940_0008476 | 3300035088 | Bacteria | 2360 |
| 201 | Ga0373951_0013479 | 3300035091 | Bacteria | 1838 |
| 202 | Ga0373932_0026166 | 3300035112 | Bacteria | 1585 |
| 203 | Ga0373939_0066676 | 3300035114 | Bacteria | 1161 |
| 204 | Ga0373939_0186228 | 3300035114 | Bacteria | 777 |
| 205 | Ga0373941_0028258 | 3300035115 | Bacteria | 1645 |
| 206 | Ga0373960_0003843 | 3300035121 | Bacteria | 3415 |
| 207 | Ga0373961_0042054 | 3300035241 | Bacteria | 1323 |
| 208 | Ga0373931_0004846 | 3300035691 | Bacteria | 6181 |
| 209 | Ga0373931_0021143 | 3300035691 | Bacteria | 3263 |
| 210 | Ga0373931_0265857 | 3300035691 | Bacteria | 1048 |
| 211 | Ga0395899_0018685 | 3300037312 | Bacteria | 5268 |
| 212 | Ga0395900_0009521 | 3300037418 | Bacteria | 9963 |
| 213 | Ga0395898_0016944 | 3300037466 | Bacteria | 7440 |
| 214 | Ga0395901_0007936 | 3300038443 | Bacteria | 10708 |
| 215 | Ga0439435_0023798 | 3300042436 | Bacteria | 1611 |
| 216 | Ga0439460_0008062 | 3300042461 | Bacteria | 2655 |
| 217 | Ga0450893_0017434 | 3300042532 | Bacteria | 1220 |
| 218 | Ga0451577_0820844 | 3300042876 | Bacteria | 839 |
| 219 | Ga0451576_0113732 | 3300045051 | Bacteria | 2817 |
| 220 | Ga0451576_0222537 | 3300045051 | Bacteria | 1970 |
| 221 | Ga0451576_0423663 | 3300045051 | Bacteria | 1396 |
| 222 | Ga0495603_0059911 | 3300046455 | Bacteria | 2250 |
| 223 | Ga0495580_0000240 | 3300046472 | Bacteria | 43439 |
| 224 | Ga0495584_0189219 | 3300046491 | Bacteria | 1046 |
| 225 | Ga0495594_0103034 | 3300046499 | Bacteria | 1606 |
| 226 | Ga0495642_0128743 | 3300046528 | Bacteria | 1089 |
| 227 | Ga0495642_0249647 | 3300046528 | Unclassified | 776 |
| 228 | Ga0495659_0069632 | 3300046664 | Bacteria | 1316 |
| 229 | Ga0495669_0047076 | 3300046684 | Bacteria | 1926 |
| 230 | Ga0495669_0072945 | 3300046684 | Bacteria | 1567 |
| 231 | Ga0495670_0123201 | 3300046691 | Bacteria | 1348 |
| 232 | Ga0495636_0059640 | 3300047318 | Bacteria | 1611 |
| 233 | Ga0495677_0162301 | 3300047445 | Bacteria | 863 |
| 234 | Ga0496101_0656256 | 3300048904 | Bacteria | 829 |
| 235 | Ga0496102_0003719 | 3300048905 | Bacteria | 12892 |
| 236 | Ga0496103_0105703 | 3300048906 | Bacteria | 1785 |
| 237 | Ga0496106_0279153 | 3300048909 | Bacteria | 1338 |
| 238 | Ga0496106_0932707 | 3300048909 | Unclassified | 684 |
| 239 | Ga0496108_0737884 | 3300048911 | Bacteria | 852 |
| 240 | Ga0496109_0149035 | 3300048912 | Bacteria | 2190 |
| 241 | Ga0496111_0384362 | 3300048914 | Unclassified | 1038 |
| 242 | Ga0496112_0033321 | 3300048915 | Bacteria | 5007 |
| 243 | Ga0501033_0353006 | 3300049570 | Bacteria | 1030 |
| 244 | Ga0501033_0544893 | 3300049570 | Bacteria | 800 |
| 245 | Ga0501039_0707917 | 3300049575 | Unclassified | 787 |
| 246 | Ga0501040_0251363 | 3300049576 | Unclassified | 1261 |
| 247 | Ga0501040_0833978 | 3300049576 | Bacteria | 667 |
| 248 | Ga0501040_0901793 | 3300049576 | Unclassified | 640 |
| 249 | Ga0501041_0623217 | 3300049577 | Bacteria | 689 |
| 250 | Ga0501042_0455490 | 3300049578 | Unclassified | 928 |
| 251 | Ga0501042_0502824 | 3300049578 | Bacteria | 880 |
| 252 | Ga0501046_0384546 | 3300049580 | Bacteria | 1015 |
| 253 | Ga0501071_0186744 | 3300049587 | Bacteria | 1554 |
| 254 | Ga0501071_0425002 | 3300049587 | Bacteria | 1016 |
| 255 | Ga0501072_0056620 | 3300049588 | Bacteria | 3089 |
| 256 | Ga0501072_0171696 | 3300049588 | Bacteria | 1730 |
| 257 | Ga0501072_0314384 | 3300049588 | Bacteria | 1245 |
| 258 | Ga0501072_0752636 | 3300049588 | Bacteria | 764 |
| 259 | Ga0501075_0036564 | 3300049591 | Bacteria | 3666 |
| 260 | Ga0501075_0057997 | 3300049591 | Bacteria | 2916 |
| 261 | Ga0501076_0023468 | 3300049592 | Bacteria | 4756 |
| 262 | Ga0501076_0321529 | 3300049592 | Bacteria | 1269 |
| 263 | Ga0501077_0059044 | 3300049593 | Bacteria | 2435 |
| 264 | Ga0501077_0395642 | 3300049593 | Bacteria | 883 |
| 265 | Ga0501079_0239142 | 3300049741 | Bacteria | 1419 |
| 266 | Ga0501079_0278891 | 3300049741 | Bacteria | 1307 |
| 267 | Ga0501079_0548002 | 3300049741 | Bacteria | 909 |
| 268 | Ga0501081_0243831 | 3300049743 | Unclassified | 1311 |
| 269 | Ga0501081_0508647 | 3300049743 | Unclassified | 898 |
| 270 | Ga0501081_0854490 | 3300049743 | Unclassified | 685 |
| 271 | Ga0501083_0496270 | 3300049744 | Unclassified | 795 |
| 272 | Ga0501035_0837100 | 3300049822 | Unclassified | 733 |
| 273 | Ga0501045_0464999 | 3300049824 | Bacteria | 940 |
| 274 | nmdc:mga05p37_150977_c1 | 3300050507 | Bacteria | 2842 |
| 275 | nmdc:mga05p37_179469_c1 | 3300050507 | Bacteria | 2577 |
| 276 | nmdc:mga05p37_23058_c1 | 3300050507 | Bacteria | 7553 |
| 277 | nmdc:mga05p37_23565_c1 | 3300050507 | Bacteria | 7470 |
| 278 | nmdc:mga05p37_248076_c1 | 3300050507 | Bacteria | 2137 |
| 279 | nmdc:mga05p37_44161_c1 | 3300050507 | Bacteria | 1292 |
| 280 | nmdc:mga05p37_47147_c1 | 3300050507 | Bacteria | 5300 |
| 281 | nmdc:mga05p37_50182_c1 | 3300050507 | Bacteria | 5131 |
| 282 | nmdc:mga05p37_569031_c1 | 3300050507 | Bacteria | 1286 |
| 283 | nmdc:mga05p37_64018_c1 | 3300050507 | Bacteria | 4525 |
| 284 | nmdc:mga05p37_79549_c1 | 3300050507 | Bacteria | 4037 |
| 285 | nmdc:mga05p37_8077_c1 | 3300050507 | Bacteria | 10458 |
| 286 | nmdc:mga09592_2319_c1 | 3300050508 | Bacteria | 15357 |
| 287 | nmdc:mga09592_41662_c1 | 3300050508 | Bacteria | 3861 |
| 288 | nmdc:mga09592_674699_c1 | 3300050508 | Bacteria | 881 |
| 289 | nmdc:mga0qj67_197163_c1 | 3300050509 | Bacteria | 1636 |
| 290 | nmdc:mga0qj67_6904_c1 | 3300050509 | Bacteria | 8356 |
| 291 | nmdc:mga0qj67_88682_c1 | 3300050509 | Bacteria | 2484 |
| 292 | nmdc:mga0qj67_979534_c1 | 3300050509 | Unclassified | 664 |
| 293 | nmdc:mga06r32_107974_c1 | 3300050510 | Bacteria | 2736 |
| 294 | nmdc:mga06r32_127302_c1 | 3300050510 | Bacteria | 2516 |
| 295 | nmdc:mga06r32_2599_c1 | 3300050510 | Bacteria | 16129 |
| 296 | nmdc:mga06r32_349876_c1 | 3300050510 | Bacteria | 1462 |
| 297 | nmdc:mga06r32_4391_c1 | 3300050510 | Bacteria | 12609 |
| 298 | nmdc:mga06r32_7176_c1 | 3300050510 | Bacteria | 10042 |
| 299 | nmdc:mga08y16_15084_c1 | 3300050511 | Bacteria | 8125 |
| 300 | nmdc:mga08y16_25942_c1 | 3300050511 | Bacteria | 6183 |
| 301 | nmdc:mga08y16_46712_c1 | 3300050511 | Bacteria | 4533 |
| 302 | nmdc:mga08y16_593965_c1 | 3300050511 | Bacteria | 1116 |
| 303 | nmdc:mga0n895_1031090_c1 | 3300050512 | Bacteria | 803 |
| 304 | nmdc:mga0n895_114198_c1 | 3300050512 | Bacteria | 2719 |
| 305 | nmdc:mga0n895_132641_c1 | 3300050512 | Bacteria | 2517 |
| 306 | nmdc:mga0n895_202879_c1 | 3300050512 | Bacteria | 2014 |
| 307 | nmdc:mga0n895_350529_c1 | 3300050512 | Bacteria | 1495 |
| 308 | nmdc:mga0n895_393644_c1 | 3300050512 | Bacteria | 1402 |
| 309 | nmdc:mga0n895_4232_c1 | 3300050512 | Bacteria | 11736 |
| 310 | nmdc:mga0n895_458049_c1 | 3300050512 | Unclassified | 1287 |
| 311 | nmdc:mga0n895_6538_c1 | 3300050512 | Bacteria | 9917 |
| 312 | nmdc:mga0n895_8865_c1 | 3300050512 | Bacteria | 8755 |
| 313 | nmdc:mga0rr50_254724_c1 | 3300050513 | Bacteria | 1459 |
| 314 | nmdc:mga0rr50_260827_c1 | 3300050513 | Bacteria | 1442 |
| 315 | nmdc:mga0rr50_335638_c1 | 3300050513 | Bacteria | 1269 |
| 316 | nmdc:mga0rr50_386551_c1 | 3300050513 | Bacteria | 1181 |
| 317 | nmdc:mga0rr50_50439_c1 | 3300050513 | Bacteria | 3084 |
| 318 | nmdc:mga0rr50_99678_c1 | 3300050513 | Bacteria | 2280 |
| 319 | nmdc:mga08x19_254925_c1 | 3300050514 | Unclassified | 1212 |
| 320 | nmdc:mga08x19_51700_c1 | 3300050514 | Bacteria | 2640 |
| 321 | nmdc:mga08x19_69728_c1 | 3300050514 | Bacteria | 2290 |
| 322 | nmdc:mga0a205_16370_c1 | 3300050515 | Bacteria | 6947 |
| 323 | nmdc:mga0a205_233069_c1 | 3300050515 | Bacteria | 1724 |
| 324 | nmdc:mga0a205_24881_c1 | 3300050515 | Bacteria | 5698 |
| 325 | nmdc:mga0a205_24929_c1 | 3300050515 | Bacteria | 5693 |
| 326 | nmdc:mga0a205_46483_c1 | 3300050515 | Bacteria | 4187 |
| 327 | nmdc:mga0a205_900300_c1 | 3300050515 | Unclassified | 732 |
| 328 | nmdc:mga0a205_9452_c1 | 3300050515 | Bacteria | 8915 |
| 329 | Ga0501084_0063192 | 3300054114 | Bacteria | 3099 |
| 330 | Ga0501084_0787948 | 3300054114 | Bacteria | 801 |
| 331 | Ga0590071_030531 | 3300059421 | Bacteria | 1283 |
| 332 | Ga0501082_0319031 | 3300060353 | Bacteria | 1354 |
| 333 | Ga0501082_0645592 | 3300060353 | Bacteria | 926 |
| 334 | Ga0501082_0700535 | 3300060353 | Unclassified | 886 |
| 335 | Ga0530510_0049679 | 3300061734 | Bacteria | 3030 |
| 336 | Ga0530510_0351435 | 3300061734 | Bacteria | 1107 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049592 | Ga0501076_0321529 | Ga0501076_0321529_235_780 | 152 |
| 2 | 3300005445 | Ga0070708_100036034 | Ga0070708_1000360342 | 163 |
| 3 | 3300005467 | Ga0070706_100188895 | Ga0070706_1001888952 | 163 |
| 4 | 3300005468 | Ga0070707_100048747 | Ga0070707_1000487472 | 163 |
| 5 | 3300005518 | Ga0070699_100122232 | Ga0070699_1001222322 | 163 |
| 6 | 3300005536 | Ga0070697_100101819 | Ga0070697_1001018192 | 163 |
| 7 | 3300025922 | Ga0207646_10227441 | Ga0207646_102274412 | 163 |
| 8 | 3300049578 | Ga0501042_0502824 | Ga0501042_0502824_12_560 | 164 |
| 9 | 3300025938 | Ga0207704_10382023 | Ga0207704_103820231 | 169 |
| 10 | 3300009147 | Ga0114129_10886122 | Ga0114129_108861222 | 171 |
| 11 | 3300050507 | nmdc:mga05p37_569031_c1 | nmdc:mga05p37_569031_c1_107_658 | 171 |
| 12 | 3300059421 | Ga0590071_030531 | Ga0590071_030531_697_1245 | 172 |
| 13 | 3300049591 | Ga0501075_0057997 | Ga0501075_0057997_806_1354 | 173 |
| 14 | 3300049576 | Ga0501040_0833978 | Ga0501040_0833978_101_649 | 174 |
| 15 | 3300049824 | Ga0501045_0464999 | Ga0501045_0464999_359_907 | 174 |
| 16 | 3300014745 | Ga0157377_10177570 | Ga0157377_101775702 | 175 |
| 17 | 3300049743 | Ga0501081_0243831 | Ga0501081_0243831_157_705 | 175 |
| 18 | 3300005290 | Ga0065712_10174252 | Ga0065712_101742522 | 180 |
| 19 | 3300005328 | Ga0070676_10043287 | Ga0070676_100432872 | 180 |
| 20 | 3300005334 | Ga0068869_100012417 | Ga0068869_1000124177 | 180 |
| 21 | 3300005336 | Ga0070680_100235179 | Ga0070680_1002351792 | 180 |
| 22 | 3300005345 | Ga0070692_10189265 | Ga0070692_101892652 | 180 |
| 23 | 3300005406 | Ga0070703_10038863 | Ga0070703_100388632 | 180 |
| 24 | 3300005441 | Ga0070700_100237775 | Ga0070700_1002377752 | 180 |
| 25 | 3300005444 | Ga0070694_100215516 | Ga0070694_1002155162 | 180 |
| 26 | 3300005445 | Ga0070708_100033154 | Ga0070708_1000331542 | 180 |
| 27 | 3300005445 | Ga0070708_100184030 | Ga0070708_1001840302 | 180 |
| 28 | 3300005445 | Ga0070708_100588291 | Ga0070708_1005882912 | 180 |
| 29 | 3300005457 | Ga0070662_100025632 | Ga0070662_1000256323 | 180 |
| 30 | 3300005459 | Ga0068867_100232542 | Ga0068867_1002325423 | 180 |
| 31 | 3300005467 | Ga0070706_100015740 | Ga0070706_1000157403 | 180 |
| 32 | 3300005467 | Ga0070706_100614379 | Ga0070706_1006143792 | 180 |
| 33 | 3300005468 | Ga0070707_100240652 | Ga0070707_1002406522 | 180 |
| 34 | 3300005468 | Ga0070707_100391043 | Ga0070707_1003910432 | 180 |
| 35 | 3300005471 | Ga0070698_100243249 | Ga0070698_1002432491 | 180 |
| 36 | 3300005471 | Ga0070698_101575254 | Ga0070698_1015752541 | 180 |
| 37 | 3300005518 | Ga0070699_100212172 | Ga0070699_1002121722 | 180 |
| 38 | 3300005536 | Ga0070697_100045576 | Ga0070697_1000455764 | 180 |
| 39 | 3300005536 | Ga0070697_100398664 | Ga0070697_1003986642 | 180 |
| 40 | 3300005545 | Ga0070695_100030118 | Ga0070695_1000301183 | 180 |
| 41 | 3300005546 | Ga0070696_100175618 | Ga0070696_1001756182 | 180 |
| 42 | 3300005547 | Ga0070693_100169249 | Ga0070693_1001692493 | 180 |
| 43 | 3300005844 | Ga0068862_100149668 | Ga0068862_1001496683 | 180 |
| 44 | 3300005981 | Ga0081538_10011202 | Ga0081538_100112028 | 180 |
| 45 | 3300006844 | Ga0075428_100229022 | Ga0075428_1002290223 | 180 |
| 46 | 3300006846 | Ga0075430_100316164 | Ga0075430_1003161642 | 180 |
| 47 | 3300006847 | Ga0075431_100043271 | Ga0075431_1000432711 | 180 |
| 48 | 3300006852 | Ga0075433_10047845 | Ga0075433_100478452 | 180 |
| 49 | 3300006852 | Ga0075433_11123838 | Ga0075433_111238381 | 180 |
| 50 | 3300006871 | Ga0075434_100017950 | Ga0075434_1000179507 | 180 |
| 51 | 3300006871 | Ga0075434_100380747 | Ga0075434_1003807471 | 180 |
| 52 | 3300006871 | Ga0075434_100467647 | Ga0075434_1004676472 | 180 |
| 53 | 3300007076 | Ga0075435_100045900 | Ga0075435_1000459004 | 180 |
| 54 | 3300009147 | Ga0114129_10021512 | Ga0114129_100215122 | 180 |
| 55 | 3300009147 | Ga0114129_10670015 | Ga0114129_106700152 | 180 |
| 56 | 3300009148 | Ga0105243_10439665 | Ga0105243_104396651 | 180 |
| 57 | 3300009553 | Ga0105249_11020797 | Ga0105249_110207972 | 180 |
| 58 | 3300013306 | Ga0163162_10718226 | Ga0163162_107182262 | 180 |
| 59 | 3300013308 | Ga0157375_10207641 | Ga0157375_102076413 | 180 |
| 60 | 3300014325 | Ga0163163_10170116 | Ga0163163_101701163 | 180 |
| 61 | 3300025885 | Ga0207653_10039676 | Ga0207653_100396762 | 180 |
| 62 | 3300025907 | Ga0207645_10061565 | Ga0207645_100615652 | 180 |
| 63 | 3300025910 | Ga0207684_10045417 | Ga0207684_100454174 | 180 |
| 64 | 3300025922 | Ga0207646_10378450 | Ga0207646_103784502 | 180 |
| 65 | 3300025927 | Ga0207687_10133876 | Ga0207687_101338762 | 180 |
| 66 | 3300025933 | Ga0207706_10015189 | Ga0207706_100151895 | 180 |
| 67 | 3300025942 | Ga0207689_10017708 | Ga0207689_100177087 | 180 |
| 68 | 3300025961 | Ga0207712_10832412 | Ga0207712_108324122 | 180 |
| 69 | 3300026089 | Ga0207648_10350404 | Ga0207648_103504042 | 180 |
| 70 | 3300026118 | Ga0207675_100163824 | Ga0207675_1001638242 | 180 |
| 71 | 3300028380 | Ga0268265_10341017 | Ga0268265_103410172 | 180 |
| 72 | 3300035121 | Ga0373960_0003843 | Ga0373960_0003843_1381_1926 | 180 |
| 73 | 3300042532 | Ga0450893_0017434 | Ga0450893_0017434_265_810 | 180 |
| 74 | 3300045051 | Ga0451576_0113732 | Ga0451576_0113732_605_1150 | 180 |
| 75 | 3300048911 | Ga0496108_0737884 | Ga0496108_0737884_141_686 | 180 |
| 76 | 3300048912 | Ga0496109_0149035 | Ga0496109_0149035_1558_2103 | 180 |
| 77 | 3300048914 | Ga0496111_0384362 | Ga0496111_0384362_127_672 | 180 |
| 78 | 3300048915 | Ga0496112_0033321 | Ga0496112_0033321_1236_1781 | 180 |
| 79 | 3300049576 | Ga0501040_0901793 | Ga0501040_0901793_18_563 | 180 |
| 80 | 3300050507 | nmdc:mga05p37_44161_c1 | nmdc:mga05p37_44161_c1_628_1173 | 180 |
| 81 | 3300050507 | nmdc:mga05p37_50182_c1 | nmdc:mga05p37_50182_c1_56_601 | 180 |
| 82 | 3300050509 | nmdc:mga0qj67_197163_c1 | nmdc:mga0qj67_197163_c1_569_1114 | 180 |
| 83 | 3300050510 | nmdc:mga06r32_127302_c1 | nmdc:mga06r32_127302_c1_975_1520 | 180 |
| 84 | 3300050510 | nmdc:mga06r32_7176_c1 | nmdc:mga06r32_7176_c1_4269_4814 | 180 |
| 85 | 3300050512 | nmdc:mga0n895_350529_c1 | nmdc:mga0n895_350529_c1_765_1310 | 180 |
| 86 | 3300050512 | nmdc:mga0n895_393644_c1 | nmdc:mga0n895_393644_c1_627_1172 | 180 |
| 87 | 3300050512 | nmdc:mga0n895_458049_c1 | nmdc:mga0n895_458049_c1_721_1266 | 180 |
| 88 | 3300050513 | nmdc:mga0rr50_99678_c1 | nmdc:mga0rr50_99678_c1_1085_1630 | 180 |
| 89 | 3300050515 | nmdc:mga0a205_24929_c1 | nmdc:mga0a205_24929_c1_2192_2737 | 180 |
| 90 | 3300003203 | JGI25406J46586_10015956 | JGI25406J46586_100159563 | 181 |
| 91 | 3300005336 | Ga0070680_100582908 | Ga0070680_1005829082 | 181 |
| 92 | 3300005353 | Ga0070669_100153768 | Ga0070669_1001537682 | 181 |
| 93 | 3300005356 | Ga0070674_100487742 | Ga0070674_1004877422 | 181 |
| 94 | 3300005366 | Ga0070659_100438081 | Ga0070659_1004380812 | 181 |
| 95 | 3300005440 | Ga0070705_100002975 | Ga0070705_1000029752 | 181 |
| 96 | 3300005440 | Ga0070705_100145563 | Ga0070705_1001455632 | 181 |
| 97 | 3300005444 | Ga0070694_100034946 | Ga0070694_1000349462 | 181 |
| 98 | 3300005444 | Ga0070694_100316040 | Ga0070694_1003160402 | 181 |
| 99 | 3300005444 | Ga0070694_100529848 | Ga0070694_1005298482 | 181 |
| 100 | 3300005455 | Ga0070663_101142777 | Ga0070663_1011427771 | 181 |
| 101 | 3300005458 | Ga0070681_10135884 | Ga0070681_101358842 | 181 |
| 102 | 3300005459 | Ga0068867_100435961 | Ga0068867_1004359612 | 181 |
| 103 | 3300005518 | Ga0070699_100123862 | Ga0070699_1001238623 | 181 |
| 104 | 3300005543 | Ga0070672_100044337 | Ga0070672_1000443374 | 181 |
| 105 | 3300005543 | Ga0070672_100872231 | Ga0070672_1008722311 | 181 |
| 106 | 3300005545 | Ga0070695_100018279 | Ga0070695_1000182792 | 181 |
| 107 | 3300005546 | Ga0070696_100055284 | Ga0070696_1000552843 | 181 |
| 108 | 3300005546 | Ga0070696_100411883 | Ga0070696_1004118832 | 181 |
| 109 | 3300005549 | Ga0070704_100018330 | Ga0070704_1000183304 | 181 |
| 110 | 3300005549 | Ga0070704_100185712 | Ga0070704_1001857122 | 181 |
| 111 | 3300005549 | Ga0070704_101062660 | Ga0070704_1010626601 | 181 |
| 112 | 3300005617 | Ga0068859_100433412 | Ga0068859_1004334122 | 181 |
| 113 | 3300005718 | Ga0068866_10196754 | Ga0068866_101967542 | 181 |
| 114 | 3300005718 | Ga0068866_10487582 | Ga0068866_104875821 | 181 |
| 115 | 3300005719 | Ga0068861_100099002 | Ga0068861_1000990023 | 181 |
| 116 | 3300005719 | Ga0068861_100269454 | Ga0068861_1002694542 | 181 |
| 117 | 3300005841 | Ga0068863_100360228 | Ga0068863_1003602282 | 181 |
| 118 | 3300005843 | Ga0068860_100179003 | Ga0068860_1001790032 | 181 |
| 119 | 3300005844 | Ga0068862_100250560 | Ga0068862_1002505603 | 181 |
| 120 | 3300005844 | Ga0068862_100620797 | Ga0068862_1006207971 | 181 |
| 121 | 3300005937 | Ga0081455_10216670 | Ga0081455_102166702 | 181 |
| 122 | 3300005937 | Ga0081455_10218266 | Ga0081455_102182662 | 181 |
| 123 | 3300005983 | Ga0081540_1173869 | Ga0081540_11738692 | 181 |
| 124 | 3300005985 | Ga0081539_10000002 | Ga0081539_10000002613 | 181 |
| 125 | 3300006194 | Ga0075427_10017526 | Ga0075427_100175262 | 181 |
| 126 | 3300006844 | Ga0075428_100000632 | Ga0075428_10000063217 | 181 |
| 127 | 3300006844 | Ga0075428_100030167 | Ga0075428_1000301673 | 181 |
| 128 | 3300006846 | Ga0075430_100011228 | Ga0075430_1000112284 | 181 |
| 129 | 3300006846 | Ga0075430_100057083 | Ga0075430_1000570833 | 181 |
| 130 | 3300006846 | Ga0075430_100170246 | Ga0075430_1001702463 | 181 |
| 131 | 3300006847 | Ga0075431_100001140 | Ga0075431_10000114026 | 181 |
| 132 | 3300006847 | Ga0075431_100061393 | Ga0075431_1000613932 | 181 |
| 133 | 3300006847 | Ga0075431_100074165 | Ga0075431_1000741652 | 181 |
| 134 | 3300006847 | Ga0075431_100164748 | Ga0075431_1001647482 | 181 |
| 135 | 3300006847 | Ga0075431_100332932 | Ga0075431_1003329323 | 181 |
| 136 | 3300006852 | Ga0075433_10011217 | Ga0075433_100112177 | 181 |
| 137 | 3300006852 | Ga0075433_10011794 | Ga0075433_100117944 | 181 |
| 138 | 3300006852 | Ga0075433_10035412 | Ga0075433_100354123 | 181 |
| 139 | 3300006852 | Ga0075433_10043241 | Ga0075433_100432413 | 181 |
| 140 | 3300006852 | Ga0075433_10215856 | Ga0075433_102158562 | 181 |
| 141 | 3300006852 | Ga0075433_10510721 | Ga0075433_105107211 | 181 |
| 142 | 3300006871 | Ga0075434_100000331 | Ga0075434_10000033124 | 181 |
| 143 | 3300006871 | Ga0075434_100049964 | Ga0075434_1000499642 | 181 |
| 144 | 3300006871 | Ga0075434_100078842 | Ga0075434_1000788423 | 181 |
| 145 | 3300006871 | Ga0075434_100108580 | Ga0075434_1001085803 | 181 |
| 146 | 3300006871 | Ga0075434_100144917 | Ga0075434_1001449173 | 181 |
| 147 | 3300006871 | Ga0075434_100676131 | Ga0075434_1006761312 | 181 |
| 148 | 3300006871 | Ga0075434_100866480 | Ga0075434_1008664802 | 181 |
| 149 | 3300006871 | Ga0075434_100889649 | Ga0075434_1008896492 | 181 |
| 150 | 3300006871 | Ga0075434_101149711 | Ga0075434_1011497111 | 181 |
| 151 | 3300006880 | Ga0075429_100001406 | Ga0075429_1000014062 | 181 |
| 152 | 3300006880 | Ga0075429_100033237 | Ga0075429_1000332372 | 181 |
| 153 | 3300006880 | Ga0075429_100061598 | Ga0075429_1000615983 | 181 |
| 154 | 3300006880 | Ga0075429_100340429 | Ga0075429_1003404292 | 181 |
| 155 | 3300006880 | Ga0075429_100521315 | Ga0075429_1005213152 | 181 |
| 156 | 3300006914 | Ga0075436_100056114 | Ga0075436_1000561142 | 181 |
| 157 | 3300006914 | Ga0075436_100095707 | Ga0075436_1000957072 | 181 |
| 158 | 3300006931 | Ga0097620_100433429 | Ga0097620_1004334292 | 181 |
| 159 | 3300007076 | Ga0075435_100011953 | Ga0075435_1000119532 | 181 |
| 160 | 3300007076 | Ga0075435_100051046 | Ga0075435_1000510462 | 181 |
| 161 | 3300007076 | Ga0075435_100077808 | Ga0075435_1000778083 | 181 |
| 162 | 3300007076 | Ga0075435_100212282 | Ga0075435_1002122822 | 181 |
| 163 | 3300007076 | Ga0075435_100448405 | Ga0075435_1004484052 | 181 |
| 164 | 3300007265 | Ga0099794_10002836 | Ga0099794_100028367 | 181 |
| 165 | 3300009094 | Ga0111539_10054924 | Ga0111539_100549242 | 181 |
| 166 | 3300009094 | Ga0111539_10118313 | Ga0111539_101183133 | 181 |
| 167 | 3300009094 | Ga0111539_10786486 | Ga0111539_107864862 | 181 |
| 168 | 3300009094 | Ga0111539_11821559 | Ga0111539_118215592 | 181 |
| 169 | 3300009147 | Ga0114129_10001745 | Ga0114129_1000174517 | 181 |
| 170 | 3300009147 | Ga0114129_10017933 | Ga0114129_100179336 | 181 |
| 171 | 3300009147 | Ga0114129_10026003 | Ga0114129_100260032 | 181 |
| 172 | 3300009147 | Ga0114129_10028977 | Ga0114129_100289774 | 181 |
| 173 | 3300009147 | Ga0114129_10060544 | Ga0114129_100605447 | 181 |
| 174 | 3300009147 | Ga0114129_10099708 | Ga0114129_100997083 | 181 |
| 175 | 3300009147 | Ga0114129_10272828 | Ga0114129_102728281 | 181 |
| 176 | 3300009147 | Ga0114129_10418912 | Ga0114129_104189122 | 181 |
| 177 | 3300009147 | Ga0114129_10442991 | Ga0114129_104429912 | 181 |
| 178 | 3300009147 | Ga0114129_10628914 | Ga0114129_106289142 | 181 |
| 179 | 3300009148 | Ga0105243_10380867 | Ga0105243_103808672 | 181 |
| 180 | 3300009174 | Ga0105241_10201173 | Ga0105241_102011732 | 181 |
| 181 | 3300013100 | Ga0157373_10189883 | Ga0157373_101898832 | 181 |
| 182 | 3300013297 | Ga0157378_10210896 | Ga0157378_102108962 | 181 |
| 183 | 3300013297 | Ga0157378_10294926 | Ga0157378_102949262 | 181 |
| 184 | 3300013306 | Ga0163162_10554214 | Ga0163162_105542142 | 181 |
| 185 | 3300013308 | Ga0157375_10345056 | Ga0157375_103450563 | 181 |
| 186 | 3300013308 | Ga0157375_10646708 | Ga0157375_106467082 | 181 |
| 187 | 3300014326 | Ga0157380_10615073 | Ga0157380_106150732 | 181 |
| 188 | 3300014326 | Ga0157380_10871792 | Ga0157380_108717922 | 181 |
| 189 | 3300014968 | Ga0157379_10356473 | Ga0157379_103564732 | 181 |
| 190 | 3300017792 | Ga0163161_10253143 | Ga0163161_102531432 | 181 |
| 191 | 3300025899 | Ga0207642_10017368 | Ga0207642_100173684 | 181 |
| 192 | 3300025910 | Ga0207684_10009724 | Ga0207684_100097243 | 181 |
| 193 | 3300025912 | Ga0207707_10166135 | Ga0207707_101661352 | 181 |
| 194 | 3300025917 | Ga0207660_10796321 | Ga0207660_107963212 | 181 |
| 195 | 3300025921 | Ga0207652_10180707 | Ga0207652_101807073 | 181 |
| 196 | 3300025922 | Ga0207646_10121036 | Ga0207646_101210363 | 181 |
| 197 | 3300025932 | Ga0207690_10629270 | Ga0207690_106292702 | 181 |
| 198 | 3300025933 | Ga0207706_10031900 | Ga0207706_100319005 | 181 |
| 199 | 3300025935 | Ga0207709_10312337 | Ga0207709_103123372 | 181 |
| 200 | 3300025935 | Ga0207709_10415988 | Ga0207709_104159882 | 181 |
| 201 | 3300025937 | Ga0207669_10502050 | Ga0207669_105020501 | 181 |
| 202 | 3300025940 | Ga0207691_10009823 | Ga0207691_1000982310 | 181 |
| 203 | 3300025961 | Ga0207712_10147852 | Ga0207712_101478522 | 181 |
| 204 | 3300025961 | Ga0207712_10829626 | Ga0207712_108296261 | 181 |
| 205 | 3300026088 | Ga0207641_10305573 | Ga0207641_103055732 | 181 |
| 206 | 3300026088 | Ga0207641_10570280 | Ga0207641_105702802 | 181 |
| 207 | 3300026089 | Ga0207648_10319504 | Ga0207648_103195042 | 181 |
| 208 | 3300026118 | Ga0207675_100221340 | Ga0207675_1002213403 | 181 |
| 209 | 3300026118 | Ga0207675_100476490 | Ga0207675_1004764902 | 181 |
| 210 | 3300026118 | Ga0207675_100860550 | Ga0207675_1008605502 | 181 |
| 211 | 3300027671 | Ga0209588_1033346 | Ga0209588_10333462 | 181 |
| 212 | 3300027907 | Ga0207428_10001754 | Ga0207428_1000175418 | 181 |
| 213 | 3300027907 | Ga0207428_10003735 | Ga0207428_100037352 | 181 |
| 214 | 3300027907 | Ga0207428_10031901 | Ga0207428_100319014 | 181 |
| 215 | 3300028380 | Ga0268265_10211047 | Ga0268265_102110473 | 181 |
| 216 | 3300028380 | Ga0268265_10362594 | Ga0268265_103625942 | 181 |
| 217 | 3300031548 | Ga0307408_100002186 | Ga0307408_1000021866 | 181 |
| 218 | 3300031548 | Ga0307408_100067291 | Ga0307408_1000672913 | 181 |
| 219 | 3300031548 | Ga0307408_100083795 | Ga0307408_1000837953 | 181 |
| 220 | 3300031911 | Ga0307412_10018941 | Ga0307412_100189415 | 181 |
| 221 | 3300032002 | Ga0307416_100002121 | Ga0307416_1000021219 | 181 |
| 222 | 3300032005 | Ga0307411_10529045 | Ga0307411_105290452 | 181 |
| 223 | 3300032126 | Ga0307415_100731950 | Ga0307415_1007319502 | 181 |
| 224 | 3300034816 | Ga0373930_0008771 | Ga0373930_0008771_665_1213 | 181 |
| 225 | 3300035084 | Ga0373928_0068574 | Ga0373928_0068574_126_674 | 181 |
| 226 | 3300035088 | Ga0373940_0008476 | Ga0373940_0008476_138_686 | 181 |
| 227 | 3300035091 | Ga0373951_0013479 | Ga0373951_0013479_886_1434 | 181 |
| 228 | 3300035112 | Ga0373932_0026166 | Ga0373932_0026166_504_1052 | 181 |
| 229 | 3300035114 | Ga0373939_0066676 | Ga0373939_0066676_305_853 | 181 |
| 230 | 3300035114 | Ga0373939_0186228 | Ga0373939_0186228_83_631 | 181 |
| 231 | 3300035115 | Ga0373941_0028258 | Ga0373941_0028258_297_845 | 181 |
| 232 | 3300035241 | Ga0373961_0042054 | Ga0373961_0042054_612_1160 | 181 |
| 233 | 3300035691 | Ga0373931_0004846 | Ga0373931_0004846_1866_2414 | 181 |
| 234 | 3300035691 | Ga0373931_0021143 | Ga0373931_0021143_1793_2341 | 181 |
| 235 | 3300035691 | Ga0373931_0265857 | Ga0373931_0265857_48_596 | 181 |
| 236 | 3300037312 | Ga0395899_0018685 | Ga0395899_0018685_1427_1975 | 181 |
| 237 | 3300037418 | Ga0395900_0009521 | Ga0395900_0009521_5999_6547 | 181 |
| 238 | 3300037466 | Ga0395898_0016944 | Ga0395898_0016944_6865_7413 | 181 |
| 239 | 3300038443 | Ga0395901_0007936 | Ga0395901_0007936_2976_3524 | 181 |
| 240 | 3300042436 | Ga0439435_0023798 | Ga0439435_0023798_111_659 | 181 |
| 241 | 3300042461 | Ga0439460_0008062 | Ga0439460_0008062_905_1453 | 181 |
| 242 | 3300042876 | Ga0451577_0820844 | Ga0451577_0820844_209_757 | 181 |
| 243 | 3300045051 | Ga0451576_0222537 | Ga0451576_0222537_778_1326 | 181 |
| 244 | 3300045051 | Ga0451576_0423663 | Ga0451576_0423663_645_1193 | 181 |
| 245 | 3300046455 | Ga0495603_0059911 | Ga0495603_0059911_1570_2139 | 181 |
| 246 | 3300046472 | Ga0495580_0000240 | Ga0495580_0000240_28641_29189 | 181 |
| 247 | 3300046491 | Ga0495584_0189219 | Ga0495584_0189219_298_867 | 181 |
| 248 | 3300046499 | Ga0495594_0103034 | Ga0495594_0103034_636_1205 | 181 |
| 249 | 3300046528 | Ga0495642_0128743 | Ga0495642_0128743_182_730 | 181 |
| 250 | 3300046528 | Ga0495642_0249647 | Ga0495642_0249647_62_631 | 181 |
| 251 | 3300046664 | Ga0495659_0069632 | Ga0495659_0069632_440_988 | 181 |
| 252 | 3300046684 | Ga0495669_0047076 | Ga0495669_0047076_659_1228 | 181 |
| 253 | 3300046684 | Ga0495669_0072945 | Ga0495669_0072945_367_915 | 181 |
| 254 | 3300046691 | Ga0495670_0123201 | Ga0495670_0123201_518_1087 | 181 |
| 255 | 3300047318 | Ga0495636_0059640 | Ga0495636_0059640_621_1169 | 181 |
| 256 | 3300047445 | Ga0495677_0162301 | Ga0495677_0162301_250_819 | 181 |
| 257 | 3300048904 | Ga0496101_0656256 | Ga0496101_0656256_69_638 | 181 |
| 258 | 3300048905 | Ga0496102_0003719 | Ga0496102_0003719_6513_7061 | 181 |
| 259 | 3300048906 | Ga0496103_0105703 | Ga0496103_0105703_606_1154 | 181 |
| 260 | 3300048909 | Ga0496106_0279153 | Ga0496106_0279153_667_1215 | 181 |
| 261 | 3300048909 | Ga0496106_0932707 | Ga0496106_0932707_31_600 | 181 |
| 262 | 3300049570 | Ga0501033_0353006 | Ga0501033_0353006_38_586 | 181 |
| 263 | 3300049570 | Ga0501033_0544893 | Ga0501033_0544893_45_593 | 181 |
| 264 | 3300049575 | Ga0501039_0707917 | Ga0501039_0707917_68_616 | 181 |
| 265 | 3300049576 | Ga0501040_0251363 | Ga0501040_0251363_78_626 | 181 |
| 266 | 3300049577 | Ga0501041_0623217 | Ga0501041_0623217_47_595 | 181 |
| 267 | 3300049578 | Ga0501042_0455490 | Ga0501042_0455490_194_742 | 181 |
| 268 | 3300049580 | Ga0501046_0384546 | Ga0501046_0384546_87_635 | 181 |
| 269 | 3300049587 | Ga0501071_0186744 | Ga0501071_0186744_419_967 | 181 |
| 270 | 3300049587 | Ga0501071_0425002 | Ga0501071_0425002_82_630 | 181 |
| 271 | 3300049588 | Ga0501072_0056620 | Ga0501072_0056620_454_1002 | 181 |
| 272 | 3300049588 | Ga0501072_0171696 | Ga0501072_0171696_1007_1555 | 181 |
| 273 | 3300049588 | Ga0501072_0314384 | Ga0501072_0314384_514_1062 | 181 |
| 274 | 3300049588 | Ga0501072_0752636 | Ga0501072_0752636_31_579 | 181 |
| 275 | 3300049591 | Ga0501075_0036564 | Ga0501075_0036564_1893_2441 | 181 |
| 276 | 3300049592 | Ga0501076_0023468 | Ga0501076_0023468_3100_3648 | 181 |
| 277 | 3300049593 | Ga0501077_0059044 | Ga0501077_0059044_62_610 | 181 |
| 278 | 3300049593 | Ga0501077_0395642 | Ga0501077_0395642_59_607 | 181 |
| 279 | 3300049741 | Ga0501079_0239142 | Ga0501079_0239142_747_1298 | 181 |
| 280 | 3300049741 | Ga0501079_0278891 | Ga0501079_0278891_740_1288 | 181 |
| 281 | 3300049741 | Ga0501079_0548002 | Ga0501079_0548002_155_703 | 181 |
| 282 | 3300049743 | Ga0501081_0508647 | Ga0501081_0508647_284_835 | 181 |
| 283 | 3300049743 | Ga0501081_0854490 | Ga0501081_0854490_68_616 | 181 |
| 284 | 3300049744 | Ga0501083_0496270 | Ga0501083_0496270_70_618 | 181 |
| 285 | 3300049822 | Ga0501035_0837100 | Ga0501035_0837100_87_635 | 181 |
| 286 | 3300050507 | nmdc:mga05p37_150977_c1 | nmdc:mga05p37_150977_c1_1040_1588 | 181 |
| 287 | 3300050507 | nmdc:mga05p37_179469_c1 | nmdc:mga05p37_179469_c1_1892_2440 | 181 |
| 288 | 3300050507 | nmdc:mga05p37_23058_c1 | nmdc:mga05p37_23058_c1_4469_5017 | 181 |
| 289 | 3300050507 | nmdc:mga05p37_23565_c1 | nmdc:mga05p37_23565_c1_4907_5455 | 181 |
| 290 | 3300050507 | nmdc:mga05p37_248076_c1 | nmdc:mga05p37_248076_c1_168_716 | 181 |
| 291 | 3300050507 | nmdc:mga05p37_47147_c1 | nmdc:mga05p37_47147_c1_3073_3618 | 181 |
| 292 | 3300050507 | nmdc:mga05p37_64018_c1 | nmdc:mga05p37_64018_c1_2493_3041 | 181 |
| 293 | 3300050507 | nmdc:mga05p37_79549_c1 | nmdc:mga05p37_79549_c1_718_1266 | 181 |
| 294 | 3300050507 | nmdc:mga05p37_8077_c1 | nmdc:mga05p37_8077_c1_7603_8151 | 181 |
| 295 | 3300050508 | nmdc:mga09592_2319_c1 | nmdc:mga09592_2319_c1_13829_14377 | 181 |
| 296 | 3300050508 | nmdc:mga09592_41662_c1 | nmdc:mga09592_41662_c1_1877_2425 | 181 |
| 297 | 3300050508 | nmdc:mga09592_674699_c1 | nmdc:mga09592_674699_c1_207_755 | 181 |
| 298 | 3300050509 | nmdc:mga0qj67_6904_c1 | nmdc:mga0qj67_6904_c1_4015_4563 | 181 |
| 299 | 3300050509 | nmdc:mga0qj67_88682_c1 | nmdc:mga0qj67_88682_c1_1796_2344 | 181 |
| 300 | 3300050509 | nmdc:mga0qj67_979534_c1 | nmdc:mga0qj67_979534_c1_73_642 | 181 |
| 301 | 3300050510 | nmdc:mga06r32_107974_c1 | nmdc:mga06r32_107974_c1_1955_2503 | 181 |
| 302 | 3300050510 | nmdc:mga06r32_2599_c1 | nmdc:mga06r32_2599_c1_14470_15018 | 181 |
| 303 | 3300050510 | nmdc:mga06r32_349876_c1 | nmdc:mga06r32_349876_c1_109_657 | 181 |
| 304 | 3300050510 | nmdc:mga06r32_4391_c1 | nmdc:mga06r32_4391_c1_9507_10055 | 181 |
| 305 | 3300050511 | nmdc:mga08y16_15084_c1 | nmdc:mga08y16_15084_c1_312_860 | 181 |
| 306 | 3300050511 | nmdc:mga08y16_25942_c1 | nmdc:mga08y16_25942_c1_5322_5891 | 181 |
| 307 | 3300050511 | nmdc:mga08y16_46712_c1 | nmdc:mga08y16_46712_c1_1087_1635 | 181 |
| 308 | 3300050511 | nmdc:mga08y16_593965_c1 | nmdc:mga08y16_593965_c1_266_814 | 181 |
| 309 | 3300050512 | nmdc:mga0n895_1031090_c1 | nmdc:mga0n895_1031090_c1_70_618 | 181 |
| 310 | 3300050512 | nmdc:mga0n895_114198_c1 | nmdc:mga0n895_114198_c1_581_1129 | 181 |
| 311 | 3300050512 | nmdc:mga0n895_132641_c1 | nmdc:mga0n895_132641_c1_576_1124 | 181 |
| 312 | 3300050512 | nmdc:mga0n895_202879_c1 | nmdc:mga0n895_202879_c1_1009_1557 | 181 |
| 313 | 3300050512 | nmdc:mga0n895_4232_c1 | nmdc:mga0n895_4232_c1_10086_10634 | 181 |
| 314 | 3300050512 | nmdc:mga0n895_6538_c1 | nmdc:mga0n895_6538_c1_8625_9173 | 181 |
| 315 | 3300050512 | nmdc:mga0n895_8865_c1 | nmdc:mga0n895_8865_c1_1890_2438 | 181 |
| 316 | 3300050513 | nmdc:mga0rr50_254724_c1 | nmdc:mga0rr50_254724_c1_19_567 | 181 |
| 317 | 3300050513 | nmdc:mga0rr50_260827_c1 | nmdc:mga0rr50_260827_c1_20_568 | 181 |
| 318 | 3300050513 | nmdc:mga0rr50_335638_c1 | nmdc:mga0rr50_335638_c1_322_870 | 181 |
| 319 | 3300050513 | nmdc:mga0rr50_386551_c1 | nmdc:mga0rr50_386551_c1_390_938 | 181 |
| 320 | 3300050513 | nmdc:mga0rr50_50439_c1 | nmdc:mga0rr50_50439_c1_458_1006 | 181 |
| 321 | 3300050514 | nmdc:mga08x19_254925_c1 | nmdc:mga08x19_254925_c1_94_642 | 181 |
| 322 | 3300050514 | nmdc:mga08x19_51700_c1 | nmdc:mga08x19_51700_c1_657_1205 | 181 |
| 323 | 3300050514 | nmdc:mga08x19_69728_c1 | nmdc:mga08x19_69728_c1_1523_2071 | 181 |
| 324 | 3300050515 | nmdc:mga0a205_16370_c1 | nmdc:mga0a205_16370_c1_2164_2712 | 181 |
| 325 | 3300050515 | nmdc:mga0a205_233069_c1 | nmdc:mga0a205_233069_c1_642_1190 | 181 |
| 326 | 3300050515 | nmdc:mga0a205_24881_c1 | nmdc:mga0a205_24881_c1_1649_2197 | 181 |
| 327 | 3300050515 | nmdc:mga0a205_46483_c1 | nmdc:mga0a205_46483_c1_96_644 | 181 |
| 328 | 3300050515 | nmdc:mga0a205_900300_c1 | nmdc:mga0a205_900300_c1_48_593 | 181 |
| 329 | 3300050515 | nmdc:mga0a205_9452_c1 | nmdc:mga0a205_9452_c1_4799_5347 | 181 |
| 330 | 3300054114 | Ga0501084_0063192 | Ga0501084_0063192_573_1121 | 181 |
| 331 | 3300054114 | Ga0501084_0787948 | Ga0501084_0787948_151_702 | 181 |
| 332 | 3300060353 | Ga0501082_0319031 | Ga0501082_0319031_329_877 | 181 |
| 333 | 3300060353 | Ga0501082_0645592 | Ga0501082_0645592_320_868 | 181 |
| 334 | 3300060353 | Ga0501082_0700535 | Ga0501082_0700535_171_719 | 181 |
| 335 | 3300061734 | Ga0530510_0049679 | Ga0530510_0049679_226_774 | 181 |
| 336 | 3300061734 | Ga0530510_0351435 | Ga0530510_0351435_347_895 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rdf-assembly1.cif.gz_P | cryoem structure of polytomella f-atp synthase, primary rotary state 3, monomer-masked refinement | 0.913 | 110 | 180 |
| 6re7-assembly1.cif.gz_P | cryo-em structure of polytomella f-atp synthase, rotary substate 2c, focussed refinement of f1 head and rotor | 0.8757 | 7 | 105 |
| 6rea-assembly1.cif.gz_P | cryo-em structure of polytomella f-atp synthase, rotary substate 2d, focussed refinement of f1 head and rotor | 0.8742 | 7 | 105 |
| 6rdp-assembly1.cif.gz_P | cryo-em structure of polytomella f-atp synthase, rotary substate 1c, focussed refinement of f1 head and rotor | 0.8728 | 7 | 105 |
| 6rdb-assembly1.cif.gz_P | cryoem structure of polytomella f-atp synthase, primary rotary state 1, focussed refinement of f1 head and rotor | 0.8723 | 7 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FWE7_104_179_3.30.2320.30 | Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal | 0.9485 | 107 | 180 | 3.30.2320.30 |
| af_Q7JNG1_50_145_1.10.520.20 | Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase | 0.9351 | 6 | 99 | 1.10.520.20 |
| af_Q5A7P7_25_119_1.10.520.20 | Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase | 0.9327 | 7 | 98 | 1.10.520.20 |
| af_Q9DB20_36_129_1.10.520.20 | Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase | 0.9275 | 7 | 98 | 1.10.520.20 |
| af_Q96251_57_149_1.10.520.20 | Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase | 0.9221 | 8 | 98 | 1.10.520.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I1MJN8-F1-model_v4 | ATP synthase subunit O, mitochondrial | 0.9383 | 9 | 105 |
GO:0016020
GO:0046933 |
| AF-A0A2G9HEK9-F1-model_v4 | Uncharacterized protein | 0.9354 | 9 | 98 |
GO:0016020
GO:0046933 |
| AF-A0A6N7S8A8-F1-model_v4 | ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) | 0.9325 | 6 | 180 |
GO:0005886
GO:0045261 GO:0046933 |
| AF-A0A7C4QZW0-F1-model_v4 | F0F1 ATP synthase subunit delta | 0.9325 | 1 | 105 |
GO:0016020
GO:0046933 |
| AF-A0A7V0U4Q5-F1-model_v4 | ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) | 0.9316 | 1 | 179 |
GO:0005886
GO:0045261 GO:0046933 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar