F412547

General Info

Members Datasets Scaffolds Average Seq Length
336 157 336 182

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_100153768|Ga0070669_1001537682
Length 189
Sequence VKINAGAAKSYAKALFDLARERNQADQIQTELDQIAQQIAGDAELMAVLGRPWVTPAVKQQIAKSVGERLQLSKLGQDFLALVAAHGRADHLAAIAETYRGMLDAAHGRVRARVRTAVPLTEADRTALGQRLGRALASNAGSAKPLDVVIEEVLDKHLLGGFVAEIGSLVVDGSLDGQLARMRERLVKG

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
88 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
91 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
92 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
93 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
94 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
98 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
99 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
100 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
101 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
102 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
103 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
104 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
105 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
106 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
107 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
108 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
109 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
110 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
113 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
116 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
122 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
123 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
124 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
125 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
126 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
127 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
131 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
136 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
137 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
138 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
139 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
140 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
141 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
142 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
143 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
144 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
145 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
146 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
147 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
148 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
151 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
152 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
153 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
154 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
155 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
156 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
157 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.68
Rhizosphere 97.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10015956 3300003203 Bacteria 3148
2 Ga0065712_10174252 3300005290 Bacteria 1226
3 Ga0070676_10043287 3300005328 Bacteria 2617
4 Ga0068869_100012417 3300005334 Bacteria 5630
5 Ga0070680_100235179 3300005336 Bacteria 1548
6 Ga0070680_100582908 3300005336 Bacteria 960
7 Ga0070692_10189265 3300005345 Bacteria 1198
8 Ga0070669_100153768 3300005353 Bacteria 1782
9 Ga0070674_100487742 3300005356 Bacteria 1024
10 Ga0070659_100438081 3300005366 Bacteria 1107
11 Ga0070703_10038863 3300005406 Bacteria 1473
12 Ga0070705_100002975 3300005440 Bacteria 8376
13 Ga0070705_100145563 3300005440 Bacteria 1565
14 Ga0070700_100237775 3300005441 Bacteria 1300
15 Ga0070694_100034946 3300005444 Bacteria 3319
16 Ga0070694_100215516 3300005444 Bacteria 1438
17 Ga0070694_100316040 3300005444 Bacteria 1201
18 Ga0070694_100529848 3300005444 Bacteria 941
19 Ga0070708_100033154 3300005445 Bacteria 4486
20 Ga0070708_100036034 3300005445 Bacteria 4313
21 Ga0070708_100184030 3300005445 Bacteria 1953
22 Ga0070708_100588291 3300005445 Bacteria 1049
23 Ga0070663_101142777 3300005455 Unclassified 682
24 Ga0070662_100025632 3300005457 Bacteria 4074
25 Ga0070681_10135884 3300005458 Bacteria 2390
26 Ga0068867_100232542 3300005459 Unclassified 1491
27 Ga0068867_100435961 3300005459 Bacteria 1113
28 Ga0070706_100015740 3300005467 Bacteria 6985
29 Ga0070706_100188895 3300005467 Bacteria 1925
30 Ga0070706_100614379 3300005467 Bacteria 1010
31 Ga0070707_100048747 3300005468 Bacteria 4058
32 Ga0070707_100240652 3300005468 Bacteria 1761
33 Ga0070707_100391043 3300005468 Bacteria 1350
34 Ga0070698_100243249 3300005471 Bacteria 1732
35 Ga0070698_101575254 3300005471 Bacteria 609
36 Ga0070699_100122232 3300005518 Bacteria 2290
37 Ga0070699_100123862 3300005518 Bacteria 2274
38 Ga0070699_100212172 3300005518 Bacteria 1724
39 Ga0070697_100045576 3300005536 Bacteria 3554
40 Ga0070697_100101819 3300005536 Bacteria 2386
41 Ga0070697_100398664 3300005536 Bacteria 1194
42 Ga0070672_100044337 3300005543 Bacteria 3434
43 Ga0070672_100872231 3300005543 Bacteria 794
44 Ga0070695_100018279 3300005545 Bacteria 4256
45 Ga0070695_100030118 3300005545 Bacteria 3377
46 Ga0070696_100055284 3300005546 Bacteria 2768
47 Ga0070696_100175618 3300005546 Bacteria 1586
48 Ga0070696_100411883 3300005546 Bacteria 1060
49 Ga0070693_100169249 3300005547 Unclassified 1398
50 Ga0070704_100018330 3300005549 Bacteria 4474
51 Ga0070704_100185712 3300005549 Bacteria 1667
52 Ga0070704_101062660 3300005549 Bacteria 734
53 Ga0068859_100433412 3300005617 Bacteria 1411
54 Ga0068866_10196754 3300005718 Bacteria 1202
55 Ga0068866_10487582 3300005718 Bacteria 813
56 Ga0068861_100099002 3300005719 Bacteria 2315
57 Ga0068861_100269454 3300005719 Bacteria 1461
58 Ga0068863_100360228 3300005841 Bacteria 1418
59 Ga0068860_100179003 3300005843 Bacteria 2049
60 Ga0068862_100149668 3300005844 Bacteria 2077
61 Ga0068862_100250560 3300005844 Bacteria 1614
62 Ga0068862_100620797 3300005844 Bacteria 1040
63 Ga0081455_10216670 3300005937 Bacteria 1422
64 Ga0081455_10218266 3300005937 Bacteria 1415
65 Ga0081538_10011202 3300005981 Bacteria 7284
66 Ga0081540_1173869 3300005983 Bacteria 816
67 Ga0081539_10000002 3300005985 Bacteria 601032
68 Ga0075427_10017526 3300006194 Bacteria 1118
69 Ga0075428_100000632 3300006844 Bacteria 36076
70 Ga0075428_100030167 3300006844 Bacteria 5998
71 Ga0075428_100229022 3300006844 Bacteria 2005
72 Ga0075430_100011228 3300006846 Bacteria 7597
73 Ga0075430_100057083 3300006846 Bacteria 3284
74 Ga0075430_100170246 3300006846 Unclassified 1812
75 Ga0075430_100316164 3300006846 Bacteria 1291
76 Ga0075431_100001140 3300006847 Bacteria 23868
77 Ga0075431_100043271 3300006847 Bacteria 4648
78 Ga0075431_100061393 3300006847 Bacteria 3878
79 Ga0075431_100074165 3300006847 Bacteria 3511
80 Ga0075431_100164748 3300006847 Bacteria 2279
81 Ga0075431_100332932 3300006847 Bacteria 1529
82 Ga0075433_10011217 3300006852 Bacteria 7211
83 Ga0075433_10011794 3300006852 Bacteria 7040
84 Ga0075433_10035412 3300006852 Bacteria 4292
85 Ga0075433_10043241 3300006852 Bacteria 3909
86 Ga0075433_10047845 3300006852 Bacteria 3720
87 Ga0075433_10215856 3300006852 Bacteria 1704
88 Ga0075433_10510721 3300006852 Bacteria 1057
89 Ga0075433_11123838 3300006852 Bacteria 683
90 Ga0075434_100000331 3300006871 Bacteria 34017
91 Ga0075434_100017950 3300006871 Bacteria 6827
92 Ga0075434_100049964 3300006871 Bacteria 4154
93 Ga0075434_100078842 3300006871 Bacteria 3290
94 Ga0075434_100108580 3300006871 Bacteria 2785
95 Ga0075434_100144917 3300006871 Bacteria 2395
96 Ga0075434_100380747 3300006871 Bacteria 1432
97 Ga0075434_100467647 3300006871 Unclassified 1282
98 Ga0075434_100676131 3300006871 Unclassified 1050
99 Ga0075434_100866480 3300006871 Unclassified 918
100 Ga0075434_100889649 3300006871 Bacteria 905
101 Ga0075434_101149711 3300006871 Bacteria 789
102 Ga0075429_100001406 3300006880 Bacteria 19700
103 Ga0075429_100033237 3300006880 Bacteria 4481
104 Ga0075429_100061598 3300006880 Bacteria 3269
105 Ga0075429_100340429 3300006880 Bacteria 1313
106 Ga0075429_100521315 3300006880 Bacteria 1041
107 Ga0075436_100056114 3300006914 Bacteria 2721
108 Ga0075436_100095707 3300006914 Bacteria 2065
109 Ga0097620_100433429 3300006931 Bacteria 1411
110 Ga0075435_100011953 3300007076 Bacteria 6413
111 Ga0075435_100045900 3300007076 Bacteria 3503
112 Ga0075435_100051046 3300007076 Bacteria 3330
113 Ga0075435_100077808 3300007076 Bacteria 2720
114 Ga0075435_100212282 3300007076 Bacteria 1642
115 Ga0075435_100448405 3300007076 Bacteria 1113
116 Ga0099794_10002836 3300007265 Bacteria 6496
117 Ga0111539_10054924 3300009094 Bacteria 4736
118 Ga0111539_10118313 3300009094 Bacteria 3106
119 Ga0111539_10786486 3300009094 Bacteria 1107
120 Ga0111539_11821559 3300009094 Unclassified 706
121 Ga0114129_10001745 3300009147 Bacteria 29582
122 Ga0114129_10017933 3300009147 Bacteria 10078
123 Ga0114129_10021512 3300009147 Bacteria 9155
124 Ga0114129_10026003 3300009147 Bacteria 8289
125 Ga0114129_10028977 3300009147 Bacteria 7843
126 Ga0114129_10060544 3300009147 Bacteria 5293
127 Ga0114129_10099708 3300009147 Bacteria 4020
128 Ga0114129_10272828 3300009147 Bacteria 2262
129 Ga0114129_10418912 3300009147 Bacteria 1762
130 Ga0114129_10442991 3300009147 Bacteria 1705
131 Ga0114129_10628914 3300009147 Bacteria 1387
132 Ga0114129_10670015 3300009147 Bacteria 1337
133 Ga0114129_10886122 3300009147 Bacteria 1132
134 Ga0105243_10380867 3300009148 Bacteria 1305
135 Ga0105243_10439665 3300009148 Bacteria 1221
136 Ga0105241_10201173 3300009174 Bacteria 1664
137 Ga0105249_11020797 3300009553 Bacteria 896
138 Ga0157373_10189883 3300013100 Bacteria 1448
139 Ga0157378_10210896 3300013297 Bacteria 1842
140 Ga0157378_10294926 3300013297 Bacteria 1567
141 Ga0163162_10554214 3300013306 Bacteria 1278
142 Ga0163162_10718226 3300013306 Bacteria 1120
143 Ga0157375_10207641 3300013308 Bacteria 2115
144 Ga0157375_10345056 3300013308 Bacteria 1654
145 Ga0157375_10646708 3300013308 Bacteria 1214
146 Ga0163163_10170116 3300014325 Bacteria 2225
147 Ga0157380_10615073 3300014326 Bacteria 1077
148 Ga0157380_10871792 3300014326 Unclassified 924
149 Ga0157377_10177570 3300014745 Bacteria 1336
150 Ga0157379_10356473 3300014968 Bacteria 1340
151 Ga0163161_10253143 3300017792 Bacteria 1373
152 Ga0207653_10039676 3300025885 Bacteria 1542
153 Ga0207642_10017368 3300025899 Bacteria 2735
154 Ga0207645_10061565 3300025907 Bacteria 2398
155 Ga0207684_10009724 3300025910 Bacteria 8479
156 Ga0207684_10045417 3300025910 Bacteria 3726
157 Ga0207707_10166135 3300025912 Bacteria 1929
158 Ga0207660_10796321 3300025917 Unclassified 771
159 Ga0207652_10180707 3300025921 Unclassified 1896
160 Ga0207646_10121036 3300025922 Bacteria 2351
161 Ga0207646_10227441 3300025922 Bacteria 1685
162 Ga0207646_10378450 3300025922 Bacteria 1279
163 Ga0207687_10133876 3300025927 Bacteria 1872
164 Ga0207690_10629270 3300025932 Bacteria 878
165 Ga0207706_10015189 3300025933 Bacteria 6968
166 Ga0207706_10031900 3300025933 Bacteria 4694
167 Ga0207709_10312337 3300025935 Bacteria 1173
168 Ga0207709_10415988 3300025935 Bacteria 1031
169 Ga0207669_10502050 3300025937 Unclassified 971
170 Ga0207704_10382023 3300025938 Bacteria 1106
171 Ga0207691_10009823 3300025940 Bacteria 9188
172 Ga0207689_10017708 3300025942 Bacteria 6021
173 Ga0207712_10147852 3300025961 Bacteria 1811
174 Ga0207712_10829626 3300025961 Bacteria 814
175 Ga0207712_10832412 3300025961 Bacteria 813
176 Ga0207641_10305573 3300026088 Bacteria 1504
177 Ga0207641_10570280 3300026088 Bacteria 1105
178 Ga0207648_10319504 3300026089 Bacteria 1395
179 Ga0207648_10350404 3300026089 Unclassified 1331
180 Ga0207675_100163824 3300026118 Bacteria 2122
181 Ga0207675_100221340 3300026118 Bacteria 1824
182 Ga0207675_100476490 3300026118 Bacteria 1240
183 Ga0207675_100860550 3300026118 Bacteria 922
184 Ga0209588_1033346 3300027671 Bacteria 1651
185 Ga0207428_10001754 3300027907 Bacteria 22214
186 Ga0207428_10003735 3300027907 Bacteria 14616
187 Ga0207428_10031901 3300027907 Bacteria 4339
188 Ga0268265_10211047 3300028380 Bacteria 1692
189 Ga0268265_10341017 3300028380 Bacteria 1364
190 Ga0268265_10362594 3300028380 Bacteria 1327
191 Ga0307408_100002186 3300031548 Bacteria 13985
192 Ga0307408_100067291 3300031548 Bacteria 2634
193 Ga0307408_100083795 3300031548 Bacteria 2390
194 Ga0307412_10018941 3300031911 Bacteria 4156
195 Ga0307416_100002121 3300032002 Bacteria 11208
196 Ga0307411_10529045 3300032005 Bacteria 1002
197 Ga0307415_100731950 3300032126 Bacteria 896
198 Ga0373930_0008771 3300034816 Bacteria 1774
199 Ga0373928_0068574 3300035084 Unclassified 872
200 Ga0373940_0008476 3300035088 Bacteria 2360
201 Ga0373951_0013479 3300035091 Bacteria 1838
202 Ga0373932_0026166 3300035112 Bacteria 1585
203 Ga0373939_0066676 3300035114 Bacteria 1161
204 Ga0373939_0186228 3300035114 Bacteria 777
205 Ga0373941_0028258 3300035115 Bacteria 1645
206 Ga0373960_0003843 3300035121 Bacteria 3415
207 Ga0373961_0042054 3300035241 Bacteria 1323
208 Ga0373931_0004846 3300035691 Bacteria 6181
209 Ga0373931_0021143 3300035691 Bacteria 3263
210 Ga0373931_0265857 3300035691 Bacteria 1048
211 Ga0395899_0018685 3300037312 Bacteria 5268
212 Ga0395900_0009521 3300037418 Bacteria 9963
213 Ga0395898_0016944 3300037466 Bacteria 7440
214 Ga0395901_0007936 3300038443 Bacteria 10708
215 Ga0439435_0023798 3300042436 Bacteria 1611
216 Ga0439460_0008062 3300042461 Bacteria 2655
217 Ga0450893_0017434 3300042532 Bacteria 1220
218 Ga0451577_0820844 3300042876 Bacteria 839
219 Ga0451576_0113732 3300045051 Bacteria 2817
220 Ga0451576_0222537 3300045051 Bacteria 1970
221 Ga0451576_0423663 3300045051 Bacteria 1396
222 Ga0495603_0059911 3300046455 Bacteria 2250
223 Ga0495580_0000240 3300046472 Bacteria 43439
224 Ga0495584_0189219 3300046491 Bacteria 1046
225 Ga0495594_0103034 3300046499 Bacteria 1606
226 Ga0495642_0128743 3300046528 Bacteria 1089
227 Ga0495642_0249647 3300046528 Unclassified 776
228 Ga0495659_0069632 3300046664 Bacteria 1316
229 Ga0495669_0047076 3300046684 Bacteria 1926
230 Ga0495669_0072945 3300046684 Bacteria 1567
231 Ga0495670_0123201 3300046691 Bacteria 1348
232 Ga0495636_0059640 3300047318 Bacteria 1611
233 Ga0495677_0162301 3300047445 Bacteria 863
234 Ga0496101_0656256 3300048904 Bacteria 829
235 Ga0496102_0003719 3300048905 Bacteria 12892
236 Ga0496103_0105703 3300048906 Bacteria 1785
237 Ga0496106_0279153 3300048909 Bacteria 1338
238 Ga0496106_0932707 3300048909 Unclassified 684
239 Ga0496108_0737884 3300048911 Bacteria 852
240 Ga0496109_0149035 3300048912 Bacteria 2190
241 Ga0496111_0384362 3300048914 Unclassified 1038
242 Ga0496112_0033321 3300048915 Bacteria 5007
243 Ga0501033_0353006 3300049570 Bacteria 1030
244 Ga0501033_0544893 3300049570 Bacteria 800
245 Ga0501039_0707917 3300049575 Unclassified 787
246 Ga0501040_0251363 3300049576 Unclassified 1261
247 Ga0501040_0833978 3300049576 Bacteria 667
248 Ga0501040_0901793 3300049576 Unclassified 640
249 Ga0501041_0623217 3300049577 Bacteria 689
250 Ga0501042_0455490 3300049578 Unclassified 928
251 Ga0501042_0502824 3300049578 Bacteria 880
252 Ga0501046_0384546 3300049580 Bacteria 1015
253 Ga0501071_0186744 3300049587 Bacteria 1554
254 Ga0501071_0425002 3300049587 Bacteria 1016
255 Ga0501072_0056620 3300049588 Bacteria 3089
256 Ga0501072_0171696 3300049588 Bacteria 1730
257 Ga0501072_0314384 3300049588 Bacteria 1245
258 Ga0501072_0752636 3300049588 Bacteria 764
259 Ga0501075_0036564 3300049591 Bacteria 3666
260 Ga0501075_0057997 3300049591 Bacteria 2916
261 Ga0501076_0023468 3300049592 Bacteria 4756
262 Ga0501076_0321529 3300049592 Bacteria 1269
263 Ga0501077_0059044 3300049593 Bacteria 2435
264 Ga0501077_0395642 3300049593 Bacteria 883
265 Ga0501079_0239142 3300049741 Bacteria 1419
266 Ga0501079_0278891 3300049741 Bacteria 1307
267 Ga0501079_0548002 3300049741 Bacteria 909
268 Ga0501081_0243831 3300049743 Unclassified 1311
269 Ga0501081_0508647 3300049743 Unclassified 898
270 Ga0501081_0854490 3300049743 Unclassified 685
271 Ga0501083_0496270 3300049744 Unclassified 795
272 Ga0501035_0837100 3300049822 Unclassified 733
273 Ga0501045_0464999 3300049824 Bacteria 940
274 nmdc:mga05p37_150977_c1 3300050507 Bacteria 2842
275 nmdc:mga05p37_179469_c1 3300050507 Bacteria 2577
276 nmdc:mga05p37_23058_c1 3300050507 Bacteria 7553
277 nmdc:mga05p37_23565_c1 3300050507 Bacteria 7470
278 nmdc:mga05p37_248076_c1 3300050507 Bacteria 2137
279 nmdc:mga05p37_44161_c1 3300050507 Bacteria 1292
280 nmdc:mga05p37_47147_c1 3300050507 Bacteria 5300
281 nmdc:mga05p37_50182_c1 3300050507 Bacteria 5131
282 nmdc:mga05p37_569031_c1 3300050507 Bacteria 1286
283 nmdc:mga05p37_64018_c1 3300050507 Bacteria 4525
284 nmdc:mga05p37_79549_c1 3300050507 Bacteria 4037
285 nmdc:mga05p37_8077_c1 3300050507 Bacteria 10458
286 nmdc:mga09592_2319_c1 3300050508 Bacteria 15357
287 nmdc:mga09592_41662_c1 3300050508 Bacteria 3861
288 nmdc:mga09592_674699_c1 3300050508 Bacteria 881
289 nmdc:mga0qj67_197163_c1 3300050509 Bacteria 1636
290 nmdc:mga0qj67_6904_c1 3300050509 Bacteria 8356
291 nmdc:mga0qj67_88682_c1 3300050509 Bacteria 2484
292 nmdc:mga0qj67_979534_c1 3300050509 Unclassified 664
293 nmdc:mga06r32_107974_c1 3300050510 Bacteria 2736
294 nmdc:mga06r32_127302_c1 3300050510 Bacteria 2516
295 nmdc:mga06r32_2599_c1 3300050510 Bacteria 16129
296 nmdc:mga06r32_349876_c1 3300050510 Bacteria 1462
297 nmdc:mga06r32_4391_c1 3300050510 Bacteria 12609
298 nmdc:mga06r32_7176_c1 3300050510 Bacteria 10042
299 nmdc:mga08y16_15084_c1 3300050511 Bacteria 8125
300 nmdc:mga08y16_25942_c1 3300050511 Bacteria 6183
301 nmdc:mga08y16_46712_c1 3300050511 Bacteria 4533
302 nmdc:mga08y16_593965_c1 3300050511 Bacteria 1116
303 nmdc:mga0n895_1031090_c1 3300050512 Bacteria 803
304 nmdc:mga0n895_114198_c1 3300050512 Bacteria 2719
305 nmdc:mga0n895_132641_c1 3300050512 Bacteria 2517
306 nmdc:mga0n895_202879_c1 3300050512 Bacteria 2014
307 nmdc:mga0n895_350529_c1 3300050512 Bacteria 1495
308 nmdc:mga0n895_393644_c1 3300050512 Bacteria 1402
309 nmdc:mga0n895_4232_c1 3300050512 Bacteria 11736
310 nmdc:mga0n895_458049_c1 3300050512 Unclassified 1287
311 nmdc:mga0n895_6538_c1 3300050512 Bacteria 9917
312 nmdc:mga0n895_8865_c1 3300050512 Bacteria 8755
313 nmdc:mga0rr50_254724_c1 3300050513 Bacteria 1459
314 nmdc:mga0rr50_260827_c1 3300050513 Bacteria 1442
315 nmdc:mga0rr50_335638_c1 3300050513 Bacteria 1269
316 nmdc:mga0rr50_386551_c1 3300050513 Bacteria 1181
317 nmdc:mga0rr50_50439_c1 3300050513 Bacteria 3084
318 nmdc:mga0rr50_99678_c1 3300050513 Bacteria 2280
319 nmdc:mga08x19_254925_c1 3300050514 Unclassified 1212
320 nmdc:mga08x19_51700_c1 3300050514 Bacteria 2640
321 nmdc:mga08x19_69728_c1 3300050514 Bacteria 2290
322 nmdc:mga0a205_16370_c1 3300050515 Bacteria 6947
323 nmdc:mga0a205_233069_c1 3300050515 Bacteria 1724
324 nmdc:mga0a205_24881_c1 3300050515 Bacteria 5698
325 nmdc:mga0a205_24929_c1 3300050515 Bacteria 5693
326 nmdc:mga0a205_46483_c1 3300050515 Bacteria 4187
327 nmdc:mga0a205_900300_c1 3300050515 Unclassified 732
328 nmdc:mga0a205_9452_c1 3300050515 Bacteria 8915
329 Ga0501084_0063192 3300054114 Bacteria 3099
330 Ga0501084_0787948 3300054114 Bacteria 801
331 Ga0590071_030531 3300059421 Bacteria 1283
332 Ga0501082_0319031 3300060353 Bacteria 1354
333 Ga0501082_0645592 3300060353 Bacteria 926
334 Ga0501082_0700535 3300060353 Unclassified 886
335 Ga0530510_0049679 3300061734 Bacteria 3030
336 Ga0530510_0351435 3300061734 Bacteria 1107

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049592 Ga0501076_0321529 Ga0501076_0321529_235_780 152
2 3300005445 Ga0070708_100036034 Ga0070708_1000360342 163
3 3300005467 Ga0070706_100188895 Ga0070706_1001888952 163
4 3300005468 Ga0070707_100048747 Ga0070707_1000487472 163
5 3300005518 Ga0070699_100122232 Ga0070699_1001222322 163
6 3300005536 Ga0070697_100101819 Ga0070697_1001018192 163
7 3300025922 Ga0207646_10227441 Ga0207646_102274412 163
8 3300049578 Ga0501042_0502824 Ga0501042_0502824_12_560 164
9 3300025938 Ga0207704_10382023 Ga0207704_103820231 169
10 3300009147 Ga0114129_10886122 Ga0114129_108861222 171
11 3300050507 nmdc:mga05p37_569031_c1 nmdc:mga05p37_569031_c1_107_658 171
12 3300059421 Ga0590071_030531 Ga0590071_030531_697_1245 172
13 3300049591 Ga0501075_0057997 Ga0501075_0057997_806_1354 173
14 3300049576 Ga0501040_0833978 Ga0501040_0833978_101_649 174
15 3300049824 Ga0501045_0464999 Ga0501045_0464999_359_907 174
16 3300014745 Ga0157377_10177570 Ga0157377_101775702 175
17 3300049743 Ga0501081_0243831 Ga0501081_0243831_157_705 175
18 3300005290 Ga0065712_10174252 Ga0065712_101742522 180
19 3300005328 Ga0070676_10043287 Ga0070676_100432872 180
20 3300005334 Ga0068869_100012417 Ga0068869_1000124177 180
21 3300005336 Ga0070680_100235179 Ga0070680_1002351792 180
22 3300005345 Ga0070692_10189265 Ga0070692_101892652 180
23 3300005406 Ga0070703_10038863 Ga0070703_100388632 180
24 3300005441 Ga0070700_100237775 Ga0070700_1002377752 180
25 3300005444 Ga0070694_100215516 Ga0070694_1002155162 180
26 3300005445 Ga0070708_100033154 Ga0070708_1000331542 180
27 3300005445 Ga0070708_100184030 Ga0070708_1001840302 180
28 3300005445 Ga0070708_100588291 Ga0070708_1005882912 180
29 3300005457 Ga0070662_100025632 Ga0070662_1000256323 180
30 3300005459 Ga0068867_100232542 Ga0068867_1002325423 180
31 3300005467 Ga0070706_100015740 Ga0070706_1000157403 180
32 3300005467 Ga0070706_100614379 Ga0070706_1006143792 180
33 3300005468 Ga0070707_100240652 Ga0070707_1002406522 180
34 3300005468 Ga0070707_100391043 Ga0070707_1003910432 180
35 3300005471 Ga0070698_100243249 Ga0070698_1002432491 180
36 3300005471 Ga0070698_101575254 Ga0070698_1015752541 180
37 3300005518 Ga0070699_100212172 Ga0070699_1002121722 180
38 3300005536 Ga0070697_100045576 Ga0070697_1000455764 180
39 3300005536 Ga0070697_100398664 Ga0070697_1003986642 180
40 3300005545 Ga0070695_100030118 Ga0070695_1000301183 180
41 3300005546 Ga0070696_100175618 Ga0070696_1001756182 180
42 3300005547 Ga0070693_100169249 Ga0070693_1001692493 180
43 3300005844 Ga0068862_100149668 Ga0068862_1001496683 180
44 3300005981 Ga0081538_10011202 Ga0081538_100112028 180
45 3300006844 Ga0075428_100229022 Ga0075428_1002290223 180
46 3300006846 Ga0075430_100316164 Ga0075430_1003161642 180
47 3300006847 Ga0075431_100043271 Ga0075431_1000432711 180
48 3300006852 Ga0075433_10047845 Ga0075433_100478452 180
49 3300006852 Ga0075433_11123838 Ga0075433_111238381 180
50 3300006871 Ga0075434_100017950 Ga0075434_1000179507 180
51 3300006871 Ga0075434_100380747 Ga0075434_1003807471 180
52 3300006871 Ga0075434_100467647 Ga0075434_1004676472 180
53 3300007076 Ga0075435_100045900 Ga0075435_1000459004 180
54 3300009147 Ga0114129_10021512 Ga0114129_100215122 180
55 3300009147 Ga0114129_10670015 Ga0114129_106700152 180
56 3300009148 Ga0105243_10439665 Ga0105243_104396651 180
57 3300009553 Ga0105249_11020797 Ga0105249_110207972 180
58 3300013306 Ga0163162_10718226 Ga0163162_107182262 180
59 3300013308 Ga0157375_10207641 Ga0157375_102076413 180
60 3300014325 Ga0163163_10170116 Ga0163163_101701163 180
61 3300025885 Ga0207653_10039676 Ga0207653_100396762 180
62 3300025907 Ga0207645_10061565 Ga0207645_100615652 180
63 3300025910 Ga0207684_10045417 Ga0207684_100454174 180
64 3300025922 Ga0207646_10378450 Ga0207646_103784502 180
65 3300025927 Ga0207687_10133876 Ga0207687_101338762 180
66 3300025933 Ga0207706_10015189 Ga0207706_100151895 180
67 3300025942 Ga0207689_10017708 Ga0207689_100177087 180
68 3300025961 Ga0207712_10832412 Ga0207712_108324122 180
69 3300026089 Ga0207648_10350404 Ga0207648_103504042 180
70 3300026118 Ga0207675_100163824 Ga0207675_1001638242 180
71 3300028380 Ga0268265_10341017 Ga0268265_103410172 180
72 3300035121 Ga0373960_0003843 Ga0373960_0003843_1381_1926 180
73 3300042532 Ga0450893_0017434 Ga0450893_0017434_265_810 180
74 3300045051 Ga0451576_0113732 Ga0451576_0113732_605_1150 180
75 3300048911 Ga0496108_0737884 Ga0496108_0737884_141_686 180
76 3300048912 Ga0496109_0149035 Ga0496109_0149035_1558_2103 180
77 3300048914 Ga0496111_0384362 Ga0496111_0384362_127_672 180
78 3300048915 Ga0496112_0033321 Ga0496112_0033321_1236_1781 180
79 3300049576 Ga0501040_0901793 Ga0501040_0901793_18_563 180
80 3300050507 nmdc:mga05p37_44161_c1 nmdc:mga05p37_44161_c1_628_1173 180
81 3300050507 nmdc:mga05p37_50182_c1 nmdc:mga05p37_50182_c1_56_601 180
82 3300050509 nmdc:mga0qj67_197163_c1 nmdc:mga0qj67_197163_c1_569_1114 180
83 3300050510 nmdc:mga06r32_127302_c1 nmdc:mga06r32_127302_c1_975_1520 180
84 3300050510 nmdc:mga06r32_7176_c1 nmdc:mga06r32_7176_c1_4269_4814 180
85 3300050512 nmdc:mga0n895_350529_c1 nmdc:mga0n895_350529_c1_765_1310 180
86 3300050512 nmdc:mga0n895_393644_c1 nmdc:mga0n895_393644_c1_627_1172 180
87 3300050512 nmdc:mga0n895_458049_c1 nmdc:mga0n895_458049_c1_721_1266 180
88 3300050513 nmdc:mga0rr50_99678_c1 nmdc:mga0rr50_99678_c1_1085_1630 180
89 3300050515 nmdc:mga0a205_24929_c1 nmdc:mga0a205_24929_c1_2192_2737 180
90 3300003203 JGI25406J46586_10015956 JGI25406J46586_100159563 181
91 3300005336 Ga0070680_100582908 Ga0070680_1005829082 181
92 3300005353 Ga0070669_100153768 Ga0070669_1001537682 181
93 3300005356 Ga0070674_100487742 Ga0070674_1004877422 181
94 3300005366 Ga0070659_100438081 Ga0070659_1004380812 181
95 3300005440 Ga0070705_100002975 Ga0070705_1000029752 181
96 3300005440 Ga0070705_100145563 Ga0070705_1001455632 181
97 3300005444 Ga0070694_100034946 Ga0070694_1000349462 181
98 3300005444 Ga0070694_100316040 Ga0070694_1003160402 181
99 3300005444 Ga0070694_100529848 Ga0070694_1005298482 181
100 3300005455 Ga0070663_101142777 Ga0070663_1011427771 181
101 3300005458 Ga0070681_10135884 Ga0070681_101358842 181
102 3300005459 Ga0068867_100435961 Ga0068867_1004359612 181
103 3300005518 Ga0070699_100123862 Ga0070699_1001238623 181
104 3300005543 Ga0070672_100044337 Ga0070672_1000443374 181
105 3300005543 Ga0070672_100872231 Ga0070672_1008722311 181
106 3300005545 Ga0070695_100018279 Ga0070695_1000182792 181
107 3300005546 Ga0070696_100055284 Ga0070696_1000552843 181
108 3300005546 Ga0070696_100411883 Ga0070696_1004118832 181
109 3300005549 Ga0070704_100018330 Ga0070704_1000183304 181
110 3300005549 Ga0070704_100185712 Ga0070704_1001857122 181
111 3300005549 Ga0070704_101062660 Ga0070704_1010626601 181
112 3300005617 Ga0068859_100433412 Ga0068859_1004334122 181
113 3300005718 Ga0068866_10196754 Ga0068866_101967542 181
114 3300005718 Ga0068866_10487582 Ga0068866_104875821 181
115 3300005719 Ga0068861_100099002 Ga0068861_1000990023 181
116 3300005719 Ga0068861_100269454 Ga0068861_1002694542 181
117 3300005841 Ga0068863_100360228 Ga0068863_1003602282 181
118 3300005843 Ga0068860_100179003 Ga0068860_1001790032 181
119 3300005844 Ga0068862_100250560 Ga0068862_1002505603 181
120 3300005844 Ga0068862_100620797 Ga0068862_1006207971 181
121 3300005937 Ga0081455_10216670 Ga0081455_102166702 181
122 3300005937 Ga0081455_10218266 Ga0081455_102182662 181
123 3300005983 Ga0081540_1173869 Ga0081540_11738692 181
124 3300005985 Ga0081539_10000002 Ga0081539_10000002613 181
125 3300006194 Ga0075427_10017526 Ga0075427_100175262 181
126 3300006844 Ga0075428_100000632 Ga0075428_10000063217 181
127 3300006844 Ga0075428_100030167 Ga0075428_1000301673 181
128 3300006846 Ga0075430_100011228 Ga0075430_1000112284 181
129 3300006846 Ga0075430_100057083 Ga0075430_1000570833 181
130 3300006846 Ga0075430_100170246 Ga0075430_1001702463 181
131 3300006847 Ga0075431_100001140 Ga0075431_10000114026 181
132 3300006847 Ga0075431_100061393 Ga0075431_1000613932 181
133 3300006847 Ga0075431_100074165 Ga0075431_1000741652 181
134 3300006847 Ga0075431_100164748 Ga0075431_1001647482 181
135 3300006847 Ga0075431_100332932 Ga0075431_1003329323 181
136 3300006852 Ga0075433_10011217 Ga0075433_100112177 181
137 3300006852 Ga0075433_10011794 Ga0075433_100117944 181
138 3300006852 Ga0075433_10035412 Ga0075433_100354123 181
139 3300006852 Ga0075433_10043241 Ga0075433_100432413 181
140 3300006852 Ga0075433_10215856 Ga0075433_102158562 181
141 3300006852 Ga0075433_10510721 Ga0075433_105107211 181
142 3300006871 Ga0075434_100000331 Ga0075434_10000033124 181
143 3300006871 Ga0075434_100049964 Ga0075434_1000499642 181
144 3300006871 Ga0075434_100078842 Ga0075434_1000788423 181
145 3300006871 Ga0075434_100108580 Ga0075434_1001085803 181
146 3300006871 Ga0075434_100144917 Ga0075434_1001449173 181
147 3300006871 Ga0075434_100676131 Ga0075434_1006761312 181
148 3300006871 Ga0075434_100866480 Ga0075434_1008664802 181
149 3300006871 Ga0075434_100889649 Ga0075434_1008896492 181
150 3300006871 Ga0075434_101149711 Ga0075434_1011497111 181
151 3300006880 Ga0075429_100001406 Ga0075429_1000014062 181
152 3300006880 Ga0075429_100033237 Ga0075429_1000332372 181
153 3300006880 Ga0075429_100061598 Ga0075429_1000615983 181
154 3300006880 Ga0075429_100340429 Ga0075429_1003404292 181
155 3300006880 Ga0075429_100521315 Ga0075429_1005213152 181
156 3300006914 Ga0075436_100056114 Ga0075436_1000561142 181
157 3300006914 Ga0075436_100095707 Ga0075436_1000957072 181
158 3300006931 Ga0097620_100433429 Ga0097620_1004334292 181
159 3300007076 Ga0075435_100011953 Ga0075435_1000119532 181
160 3300007076 Ga0075435_100051046 Ga0075435_1000510462 181
161 3300007076 Ga0075435_100077808 Ga0075435_1000778083 181
162 3300007076 Ga0075435_100212282 Ga0075435_1002122822 181
163 3300007076 Ga0075435_100448405 Ga0075435_1004484052 181
164 3300007265 Ga0099794_10002836 Ga0099794_100028367 181
165 3300009094 Ga0111539_10054924 Ga0111539_100549242 181
166 3300009094 Ga0111539_10118313 Ga0111539_101183133 181
167 3300009094 Ga0111539_10786486 Ga0111539_107864862 181
168 3300009094 Ga0111539_11821559 Ga0111539_118215592 181
169 3300009147 Ga0114129_10001745 Ga0114129_1000174517 181
170 3300009147 Ga0114129_10017933 Ga0114129_100179336 181
171 3300009147 Ga0114129_10026003 Ga0114129_100260032 181
172 3300009147 Ga0114129_10028977 Ga0114129_100289774 181
173 3300009147 Ga0114129_10060544 Ga0114129_100605447 181
174 3300009147 Ga0114129_10099708 Ga0114129_100997083 181
175 3300009147 Ga0114129_10272828 Ga0114129_102728281 181
176 3300009147 Ga0114129_10418912 Ga0114129_104189122 181
177 3300009147 Ga0114129_10442991 Ga0114129_104429912 181
178 3300009147 Ga0114129_10628914 Ga0114129_106289142 181
179 3300009148 Ga0105243_10380867 Ga0105243_103808672 181
180 3300009174 Ga0105241_10201173 Ga0105241_102011732 181
181 3300013100 Ga0157373_10189883 Ga0157373_101898832 181
182 3300013297 Ga0157378_10210896 Ga0157378_102108962 181
183 3300013297 Ga0157378_10294926 Ga0157378_102949262 181
184 3300013306 Ga0163162_10554214 Ga0163162_105542142 181
185 3300013308 Ga0157375_10345056 Ga0157375_103450563 181
186 3300013308 Ga0157375_10646708 Ga0157375_106467082 181
187 3300014326 Ga0157380_10615073 Ga0157380_106150732 181
188 3300014326 Ga0157380_10871792 Ga0157380_108717922 181
189 3300014968 Ga0157379_10356473 Ga0157379_103564732 181
190 3300017792 Ga0163161_10253143 Ga0163161_102531432 181
191 3300025899 Ga0207642_10017368 Ga0207642_100173684 181
192 3300025910 Ga0207684_10009724 Ga0207684_100097243 181
193 3300025912 Ga0207707_10166135 Ga0207707_101661352 181
194 3300025917 Ga0207660_10796321 Ga0207660_107963212 181
195 3300025921 Ga0207652_10180707 Ga0207652_101807073 181
196 3300025922 Ga0207646_10121036 Ga0207646_101210363 181
197 3300025932 Ga0207690_10629270 Ga0207690_106292702 181
198 3300025933 Ga0207706_10031900 Ga0207706_100319005 181
199 3300025935 Ga0207709_10312337 Ga0207709_103123372 181
200 3300025935 Ga0207709_10415988 Ga0207709_104159882 181
201 3300025937 Ga0207669_10502050 Ga0207669_105020501 181
202 3300025940 Ga0207691_10009823 Ga0207691_1000982310 181
203 3300025961 Ga0207712_10147852 Ga0207712_101478522 181
204 3300025961 Ga0207712_10829626 Ga0207712_108296261 181
205 3300026088 Ga0207641_10305573 Ga0207641_103055732 181
206 3300026088 Ga0207641_10570280 Ga0207641_105702802 181
207 3300026089 Ga0207648_10319504 Ga0207648_103195042 181
208 3300026118 Ga0207675_100221340 Ga0207675_1002213403 181
209 3300026118 Ga0207675_100476490 Ga0207675_1004764902 181
210 3300026118 Ga0207675_100860550 Ga0207675_1008605502 181
211 3300027671 Ga0209588_1033346 Ga0209588_10333462 181
212 3300027907 Ga0207428_10001754 Ga0207428_1000175418 181
213 3300027907 Ga0207428_10003735 Ga0207428_100037352 181
214 3300027907 Ga0207428_10031901 Ga0207428_100319014 181
215 3300028380 Ga0268265_10211047 Ga0268265_102110473 181
216 3300028380 Ga0268265_10362594 Ga0268265_103625942 181
217 3300031548 Ga0307408_100002186 Ga0307408_1000021866 181
218 3300031548 Ga0307408_100067291 Ga0307408_1000672913 181
219 3300031548 Ga0307408_100083795 Ga0307408_1000837953 181
220 3300031911 Ga0307412_10018941 Ga0307412_100189415 181
221 3300032002 Ga0307416_100002121 Ga0307416_1000021219 181
222 3300032005 Ga0307411_10529045 Ga0307411_105290452 181
223 3300032126 Ga0307415_100731950 Ga0307415_1007319502 181
224 3300034816 Ga0373930_0008771 Ga0373930_0008771_665_1213 181
225 3300035084 Ga0373928_0068574 Ga0373928_0068574_126_674 181
226 3300035088 Ga0373940_0008476 Ga0373940_0008476_138_686 181
227 3300035091 Ga0373951_0013479 Ga0373951_0013479_886_1434 181
228 3300035112 Ga0373932_0026166 Ga0373932_0026166_504_1052 181
229 3300035114 Ga0373939_0066676 Ga0373939_0066676_305_853 181
230 3300035114 Ga0373939_0186228 Ga0373939_0186228_83_631 181
231 3300035115 Ga0373941_0028258 Ga0373941_0028258_297_845 181
232 3300035241 Ga0373961_0042054 Ga0373961_0042054_612_1160 181
233 3300035691 Ga0373931_0004846 Ga0373931_0004846_1866_2414 181
234 3300035691 Ga0373931_0021143 Ga0373931_0021143_1793_2341 181
235 3300035691 Ga0373931_0265857 Ga0373931_0265857_48_596 181
236 3300037312 Ga0395899_0018685 Ga0395899_0018685_1427_1975 181
237 3300037418 Ga0395900_0009521 Ga0395900_0009521_5999_6547 181
238 3300037466 Ga0395898_0016944 Ga0395898_0016944_6865_7413 181
239 3300038443 Ga0395901_0007936 Ga0395901_0007936_2976_3524 181
240 3300042436 Ga0439435_0023798 Ga0439435_0023798_111_659 181
241 3300042461 Ga0439460_0008062 Ga0439460_0008062_905_1453 181
242 3300042876 Ga0451577_0820844 Ga0451577_0820844_209_757 181
243 3300045051 Ga0451576_0222537 Ga0451576_0222537_778_1326 181
244 3300045051 Ga0451576_0423663 Ga0451576_0423663_645_1193 181
245 3300046455 Ga0495603_0059911 Ga0495603_0059911_1570_2139 181
246 3300046472 Ga0495580_0000240 Ga0495580_0000240_28641_29189 181
247 3300046491 Ga0495584_0189219 Ga0495584_0189219_298_867 181
248 3300046499 Ga0495594_0103034 Ga0495594_0103034_636_1205 181
249 3300046528 Ga0495642_0128743 Ga0495642_0128743_182_730 181
250 3300046528 Ga0495642_0249647 Ga0495642_0249647_62_631 181
251 3300046664 Ga0495659_0069632 Ga0495659_0069632_440_988 181
252 3300046684 Ga0495669_0047076 Ga0495669_0047076_659_1228 181
253 3300046684 Ga0495669_0072945 Ga0495669_0072945_367_915 181
254 3300046691 Ga0495670_0123201 Ga0495670_0123201_518_1087 181
255 3300047318 Ga0495636_0059640 Ga0495636_0059640_621_1169 181
256 3300047445 Ga0495677_0162301 Ga0495677_0162301_250_819 181
257 3300048904 Ga0496101_0656256 Ga0496101_0656256_69_638 181
258 3300048905 Ga0496102_0003719 Ga0496102_0003719_6513_7061 181
259 3300048906 Ga0496103_0105703 Ga0496103_0105703_606_1154 181
260 3300048909 Ga0496106_0279153 Ga0496106_0279153_667_1215 181
261 3300048909 Ga0496106_0932707 Ga0496106_0932707_31_600 181
262 3300049570 Ga0501033_0353006 Ga0501033_0353006_38_586 181
263 3300049570 Ga0501033_0544893 Ga0501033_0544893_45_593 181
264 3300049575 Ga0501039_0707917 Ga0501039_0707917_68_616 181
265 3300049576 Ga0501040_0251363 Ga0501040_0251363_78_626 181
266 3300049577 Ga0501041_0623217 Ga0501041_0623217_47_595 181
267 3300049578 Ga0501042_0455490 Ga0501042_0455490_194_742 181
268 3300049580 Ga0501046_0384546 Ga0501046_0384546_87_635 181
269 3300049587 Ga0501071_0186744 Ga0501071_0186744_419_967 181
270 3300049587 Ga0501071_0425002 Ga0501071_0425002_82_630 181
271 3300049588 Ga0501072_0056620 Ga0501072_0056620_454_1002 181
272 3300049588 Ga0501072_0171696 Ga0501072_0171696_1007_1555 181
273 3300049588 Ga0501072_0314384 Ga0501072_0314384_514_1062 181
274 3300049588 Ga0501072_0752636 Ga0501072_0752636_31_579 181
275 3300049591 Ga0501075_0036564 Ga0501075_0036564_1893_2441 181
276 3300049592 Ga0501076_0023468 Ga0501076_0023468_3100_3648 181
277 3300049593 Ga0501077_0059044 Ga0501077_0059044_62_610 181
278 3300049593 Ga0501077_0395642 Ga0501077_0395642_59_607 181
279 3300049741 Ga0501079_0239142 Ga0501079_0239142_747_1298 181
280 3300049741 Ga0501079_0278891 Ga0501079_0278891_740_1288 181
281 3300049741 Ga0501079_0548002 Ga0501079_0548002_155_703 181
282 3300049743 Ga0501081_0508647 Ga0501081_0508647_284_835 181
283 3300049743 Ga0501081_0854490 Ga0501081_0854490_68_616 181
284 3300049744 Ga0501083_0496270 Ga0501083_0496270_70_618 181
285 3300049822 Ga0501035_0837100 Ga0501035_0837100_87_635 181
286 3300050507 nmdc:mga05p37_150977_c1 nmdc:mga05p37_150977_c1_1040_1588 181
287 3300050507 nmdc:mga05p37_179469_c1 nmdc:mga05p37_179469_c1_1892_2440 181
288 3300050507 nmdc:mga05p37_23058_c1 nmdc:mga05p37_23058_c1_4469_5017 181
289 3300050507 nmdc:mga05p37_23565_c1 nmdc:mga05p37_23565_c1_4907_5455 181
290 3300050507 nmdc:mga05p37_248076_c1 nmdc:mga05p37_248076_c1_168_716 181
291 3300050507 nmdc:mga05p37_47147_c1 nmdc:mga05p37_47147_c1_3073_3618 181
292 3300050507 nmdc:mga05p37_64018_c1 nmdc:mga05p37_64018_c1_2493_3041 181
293 3300050507 nmdc:mga05p37_79549_c1 nmdc:mga05p37_79549_c1_718_1266 181
294 3300050507 nmdc:mga05p37_8077_c1 nmdc:mga05p37_8077_c1_7603_8151 181
295 3300050508 nmdc:mga09592_2319_c1 nmdc:mga09592_2319_c1_13829_14377 181
296 3300050508 nmdc:mga09592_41662_c1 nmdc:mga09592_41662_c1_1877_2425 181
297 3300050508 nmdc:mga09592_674699_c1 nmdc:mga09592_674699_c1_207_755 181
298 3300050509 nmdc:mga0qj67_6904_c1 nmdc:mga0qj67_6904_c1_4015_4563 181
299 3300050509 nmdc:mga0qj67_88682_c1 nmdc:mga0qj67_88682_c1_1796_2344 181
300 3300050509 nmdc:mga0qj67_979534_c1 nmdc:mga0qj67_979534_c1_73_642 181
301 3300050510 nmdc:mga06r32_107974_c1 nmdc:mga06r32_107974_c1_1955_2503 181
302 3300050510 nmdc:mga06r32_2599_c1 nmdc:mga06r32_2599_c1_14470_15018 181
303 3300050510 nmdc:mga06r32_349876_c1 nmdc:mga06r32_349876_c1_109_657 181
304 3300050510 nmdc:mga06r32_4391_c1 nmdc:mga06r32_4391_c1_9507_10055 181
305 3300050511 nmdc:mga08y16_15084_c1 nmdc:mga08y16_15084_c1_312_860 181
306 3300050511 nmdc:mga08y16_25942_c1 nmdc:mga08y16_25942_c1_5322_5891 181
307 3300050511 nmdc:mga08y16_46712_c1 nmdc:mga08y16_46712_c1_1087_1635 181
308 3300050511 nmdc:mga08y16_593965_c1 nmdc:mga08y16_593965_c1_266_814 181
309 3300050512 nmdc:mga0n895_1031090_c1 nmdc:mga0n895_1031090_c1_70_618 181
310 3300050512 nmdc:mga0n895_114198_c1 nmdc:mga0n895_114198_c1_581_1129 181
311 3300050512 nmdc:mga0n895_132641_c1 nmdc:mga0n895_132641_c1_576_1124 181
312 3300050512 nmdc:mga0n895_202879_c1 nmdc:mga0n895_202879_c1_1009_1557 181
313 3300050512 nmdc:mga0n895_4232_c1 nmdc:mga0n895_4232_c1_10086_10634 181
314 3300050512 nmdc:mga0n895_6538_c1 nmdc:mga0n895_6538_c1_8625_9173 181
315 3300050512 nmdc:mga0n895_8865_c1 nmdc:mga0n895_8865_c1_1890_2438 181
316 3300050513 nmdc:mga0rr50_254724_c1 nmdc:mga0rr50_254724_c1_19_567 181
317 3300050513 nmdc:mga0rr50_260827_c1 nmdc:mga0rr50_260827_c1_20_568 181
318 3300050513 nmdc:mga0rr50_335638_c1 nmdc:mga0rr50_335638_c1_322_870 181
319 3300050513 nmdc:mga0rr50_386551_c1 nmdc:mga0rr50_386551_c1_390_938 181
320 3300050513 nmdc:mga0rr50_50439_c1 nmdc:mga0rr50_50439_c1_458_1006 181
321 3300050514 nmdc:mga08x19_254925_c1 nmdc:mga08x19_254925_c1_94_642 181
322 3300050514 nmdc:mga08x19_51700_c1 nmdc:mga08x19_51700_c1_657_1205 181
323 3300050514 nmdc:mga08x19_69728_c1 nmdc:mga08x19_69728_c1_1523_2071 181
324 3300050515 nmdc:mga0a205_16370_c1 nmdc:mga0a205_16370_c1_2164_2712 181
325 3300050515 nmdc:mga0a205_233069_c1 nmdc:mga0a205_233069_c1_642_1190 181
326 3300050515 nmdc:mga0a205_24881_c1 nmdc:mga0a205_24881_c1_1649_2197 181
327 3300050515 nmdc:mga0a205_46483_c1 nmdc:mga0a205_46483_c1_96_644 181
328 3300050515 nmdc:mga0a205_900300_c1 nmdc:mga0a205_900300_c1_48_593 181
329 3300050515 nmdc:mga0a205_9452_c1 nmdc:mga0a205_9452_c1_4799_5347 181
330 3300054114 Ga0501084_0063192 Ga0501084_0063192_573_1121 181
331 3300054114 Ga0501084_0787948 Ga0501084_0787948_151_702 181
332 3300060353 Ga0501082_0319031 Ga0501082_0319031_329_877 181
333 3300060353 Ga0501082_0645592 Ga0501082_0645592_320_868 181
334 3300060353 Ga0501082_0700535 Ga0501082_0700535_171_719 181
335 3300061734 Ga0530510_0049679 Ga0530510_0049679_226_774 181
336 3300061734 Ga0530510_0351435 Ga0530510_0351435_347_895 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

7

186

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rdf-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 3, monomer-masked refinement 0.913 110 180
6re7-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2c, focussed refinement of f1 head and rotor 0.8757 7 105
6rea-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2d, focussed refinement of f1 head and rotor 0.8742 7 105
6rdp-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 1c, focussed refinement of f1 head and rotor 0.8728 7 105
6rdb-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 1, focussed refinement of f1 head and rotor 0.8723 7 105
ID Description Score Start End Superfamily
af_Q2FWE7_104_179_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.9485 107 180 3.30.2320.30
af_Q7JNG1_50_145_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9351 6 99 1.10.520.20
af_Q5A7P7_25_119_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9327 7 98 1.10.520.20
af_Q9DB20_36_129_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9275 7 98 1.10.520.20
af_Q96251_57_149_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9221 8 98 1.10.520.20
ID Description Score Start End GO Terms
AF-I1MJN8-F1-model_v4 ATP synthase subunit O, mitochondrial 0.9383 9 105 GO:0016020
GO:0046933
AF-A0A2G9HEK9-F1-model_v4 Uncharacterized protein 0.9354 9 98 GO:0016020
GO:0046933
AF-A0A6N7S8A8-F1-model_v4 ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) 0.9325 6 180 GO:0005886
GO:0045261
GO:0046933
AF-A0A7C4QZW0-F1-model_v4 F0F1 ATP synthase subunit delta 0.9325 1 105 GO:0016020
GO:0046933
AF-A0A7V0U4Q5-F1-model_v4 ATP synthase subunit delta (ATP synthase F(1) sector subunit delta) (F-type ATPase subunit delta) (F-ATPase subunit delta) 0.9316 1 179 GO:0005886
GO:0045261
GO:0046933

Feature Viewer

pLDDT pTM Quality
93.47 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map