F412309

General Info

Members Datasets Scaffolds Average Seq Length
335 197 335 273

Family's Representative Sequence

Representative Sequence 3300034816|Ga0373930_0000792|Ga0373930_0000792_199_1149
Length 316
Sequence VGHRDSSGCDPAACAGQPGRAIRLRALSLVGGERPPLSKSGTPKPRRRRTWLFVAGADEAAHRAAARSGADAIILELEDFTPPELRPKARAHAAEVLDEWRAAGALAGVRINPLETCGRDDLVGVLAGRPDFIMMSKVDSPAQVKALEAETGGAVDLVPNIENAAGLLNAYAIAKASKRVVAALVASEDMAASLGAVRSRRGGELAYVRSRFLVECRAAGVEAIDCPYTFSDVEGAAADARYARRLGYRMKSLVDPSHVAAVNRALTPNLARARRIVAAFEKARAQGKDRARLDGALIEVPAYAAAKRLLESDGQS

Samples

Sample ID Description Type Environment
1 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
149 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
150 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
152 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
153 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
154 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
157 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
162 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
166 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
167 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
194 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
195 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.19
Rhizosphere 98.81
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070676_10066422 3300005328 Bacteria 2155
2 Ga0070690_100000497 3300005330 Bacteria 19649
3 Ga0070670_100004995 3300005331 Bacteria 11159
4 Ga0070670_100326090 3300005331 Unclassified 1346
5 Ga0068869_100002100 3300005334 Bacteria 11972
6 Ga0068869_100003023 3300005334 Bacteria 10223
7 Ga0070666_10153687 3300005335 Bacteria 1606
8 Ga0070680_100001571 3300005336 Bacteria 16654
9 Ga0070680_100111580 3300005336 Bacteria 2276
10 Ga0070682_100016604 3300005337 Bacteria 4284
11 Ga0068868_100004467 3300005338 Bacteria 9813
12 Ga0070689_100009090 3300005340 Bacteria 7034
13 Ga0070689_100128926 3300005340 Bacteria 2027
14 Ga0070689_100199007 3300005340 Unclassified 1635
15 Ga0070691_10001745 3300005341 Bacteria 9442
16 Ga0070691_10105959 3300005341 Bacteria 1401
17 Ga0070687_100000268 3300005343 Bacteria 17660
18 Ga0070687_100169842 3300005343 Bacteria 1297
19 Ga0070692_10000432 3300005345 Bacteria 12705
20 Ga0070692_10035049 3300005345 Bacteria 2539
21 Ga0070668_100009967 3300005347 Bacteria 7039
22 Ga0070668_100233705 3300005347 Unclassified 1521
23 Ga0070669_100039985 3300005353 Bacteria 3408
24 Ga0070671_100024708 3300005355 Bacteria 4921
25 Ga0070671_100153948 3300005355 Bacteria 1942
26 Ga0070674_100253865 3300005356 Bacteria 1382
27 Ga0070673_100017095 3300005364 Bacteria 5147
28 Ga0070714_100056577 3300005435 Bacteria 3355
29 Ga0070701_10000083 3300005438 Bacteria 26254
30 Ga0070705_100000645 3300005440 Bacteria 19939
31 Ga0070705_100196203 3300005440 Bacteria 1380
32 Ga0070700_100000249 3300005441 Bacteria 29271
33 Ga0070694_100000382 3300005444 Bacteria 23947
34 Ga0070694_100006472 3300005444 Bacteria 7113
35 Ga0070694_100022921 3300005444 Bacteria 4008
36 Ga0070694_100034603 3300005444 Bacteria 3333
37 Ga0070694_100101742 3300005444 Bacteria 2033
38 Ga0070663_100133321 3300005455 Bacteria 1889
39 Ga0070681_10000281 3300005458 Bacteria 40930
40 Ga0070681_10030881 3300005458 Bacteria 5378
41 Ga0068867_100000534 3300005459 Bacteria 25071
42 Ga0068867_100001706 3300005459 Bacteria 15301
43 Ga0070698_100040611 3300005471 Bacteria 4780
44 Ga0070698_100146687 3300005471 Bacteria 2308
45 Ga0070699_100321171 3300005518 Bacteria 1391
46 Ga0070679_100007368 3300005530 Bacteria 10280
47 Ga0070679_100073416 3300005530 Bacteria 3413
48 Ga0068853_100260598 3300005539 Bacteria 1594
49 Ga0070672_100087553 3300005543 Bacteria 2506
50 Ga0070686_100000299 3300005544 Bacteria 33122
51 Ga0070686_100409523 3300005544 Unclassified 1033
52 Ga0070686_100426761 3300005544 Bacteria 1014
53 Ga0070695_100000816 3300005545 Bacteria 16788
54 Ga0070695_100009787 3300005545 Bacteria 5710
55 Ga0070695_100073265 3300005545 Bacteria 2247
56 Ga0070695_100217744 3300005545 Unclassified 1374
57 Ga0070695_100226385 3300005545 Bacteria 1350
58 Ga0070696_100002955 3300005546 Bacteria 11296
59 Ga0070696_100006964 3300005546 Bacteria 7545
60 Ga0070696_100049778 3300005546 Bacteria 2912
61 Ga0070696_100281085 3300005546 Bacteria 1269
62 Ga0070693_100000281 3300005547 Bacteria 23879
63 Ga0070693_100265755 3300005547 Bacteria 1143
64 Ga0070704_100000420 3300005549 Bacteria 19697
65 Ga0070704_100002847 3300005549 Bacteria 9807
66 Ga0070704_100115214 3300005549 Bacteria 2053
67 Ga0070704_100322452 3300005549 Bacteria 1295
68 Ga0070704_100367231 3300005549 Bacteria 1219
69 Ga0068855_100002028 3300005563 Bacteria 25117
70 Ga0070664_100421110 3300005564 Bacteria 1223
71 Ga0068857_100003057 3300005577 Bacteria 13841
72 Ga0068854_100003188 3300005578 Bacteria 10238
73 Ga0070702_100004547 3300005615 Bacteria 6347
74 Ga0070702_100381638 3300005615 Bacteria 1002
75 Ga0068859_100002465 3300005617 Bacteria 18831
76 Ga0068859_100017570 3300005617 Bacteria 7192
77 Ga0068859_100023069 3300005617 Bacteria 6240
78 Ga0068859_100067069 3300005617 Bacteria 3623
79 Ga0068864_100013535 3300005618 Bacteria 6763
80 Ga0068864_100585884 3300005618 Bacteria 1081
81 Ga0068866_10000506 3300005718 Bacteria 18014
82 Ga0068861_100000192 3300005719 Bacteria 32743
83 Ga0068861_100204624 3300005719 Bacteria 1659
84 Ga0068870_10008856 3300005840 Bacteria 4544
85 Ga0068870_10095825 3300005840 Bacteria 1668
86 Ga0068863_100024732 3300005841 Bacteria 5727
87 Ga0068858_100005818 3300005842 Bacteria 12045
88 Ga0068858_100010718 3300005842 Bacteria 8674
89 Ga0068860_100002610 3300005843 Bacteria 18852
90 Ga0068860_100003281 3300005843 Bacteria 16651
91 Ga0068862_100005986 3300005844 Bacteria 10126
92 Ga0068862_100328736 3300005844 Bacteria 1413
93 Ga0068862_100402189 3300005844 Bacteria 1281
94 Ga0081539_10001221 3300005985 Bacteria 45911
95 Ga0097621_100004557 3300006237 Bacteria 9670
96 Ga0097621_100348628 3300006237 Bacteria 1316
97 Ga0068871_100006222 3300006358 Bacteria 8418
98 Ga0075428_100012898 3300006844 Bacteria 9297
99 Ga0075428_100084931 3300006844 Bacteria 3453
100 Ga0075430_100074840 3300006846 Bacteria 2839
101 Ga0075431_100003399 3300006847 Bacteria 15428
102 Ga0075431_100023520 3300006847 Bacteria 6305
103 Ga0075431_100060716 3300006847 Bacteria 3901
104 Ga0075433_10046433 3300006852 Bacteria 3777
105 Ga0075434_100000013 3300006871 Bacteria 83380
106 Ga0075429_100000901 3300006880 Bacteria 23511
107 Ga0075429_100100749 3300006880 Bacteria 2521
108 Ga0068865_100000300 3300006881 Bacteria 27230
109 Ga0075436_100005856 3300006914 Bacteria 8445
110 Ga0075436_100011736 3300006914 Bacteria 6014
111 Ga0075436_100094933 3300006914 Bacteria 2074
112 Ga0075436_100223874 3300006914 Unclassified 1335
113 Ga0097620_100002465 3300006931 Bacteria 18831
114 Ga0097620_100017569 3300006931 Bacteria 7192
115 Ga0097620_100023071 3300006931 Bacteria 6240
116 Ga0097620_100067069 3300006931 Bacteria 3623
117 Ga0075435_100000852 3300007076 Bacteria 19080
118 Ga0075435_100003697 3300007076 Bacteria 10424
119 Ga0075435_100052323 3300007076 Bacteria 3292
120 Ga0099794_10027392 3300007265 Unclassified 2642
121 Ga0105250_10135956 3300009092 Unclassified 1016
122 Ga0111539_10042374 3300009094 Bacteria 5466
123 Ga0111539_10090749 3300009094 Bacteria 3590
124 Ga0111539_10261768 3300009094 Bacteria 2013
125 Ga0105245_10000821 3300009098 Bacteria 28312
126 Ga0105247_10018367 3300009101 Bacteria 4196
127 Ga0114129_10057361 3300009147 Bacteria 5450
128 Ga0114129_10073781 3300009147 Bacteria 4753
129 Ga0114129_10122767 3300009147 Bacteria 3574
130 Ga0114129_10151351 3300009147 Bacteria 3175
131 Ga0105243_10001374 3300009148 Bacteria 21561
132 Ga0105241_10081780 3300009174 Bacteria 2531
133 Ga0105242_10007413 3300009176 Bacteria 8448
134 Ga0105242_10222358 3300009176 Bacteria 1688
135 Ga0105248_10005793 3300009177 Bacteria 13581
136 Ga0105248_10054514 3300009177 Bacteria 4484
137 Ga0105249_10000348 3300009553 Bacteria 46377
138 Ga0105249_10281024 3300009553 Bacteria 1662
139 Ga0105249_10321030 3300009553 Unclassified 1560
140 Ga0105239_10203197 3300010375 Bacteria 2220
141 Ga0157378_10001675 3300013297 Bacteria 19966
142 Ga0163162_10065618 3300013306 Bacteria 3678
143 Ga0163162_10193428 3300013306 Bacteria 2162
144 Ga0157375_10024939 3300013308 Bacteria 5544
145 Ga0157375_10027711 3300013308 Bacteria 5300
146 Ga0157380_10320906 3300014326 Bacteria 1436
147 Ga0157377_10276995 3300014745 Bacteria 1098
148 Ga0157379_10000219 3300014968 Bacteria 44603
149 Ga0157379_10233506 3300014968 Bacteria 1668
150 Ga0207642_10000533 3300025899 Bacteria 11649
151 Ga0207680_10103122 3300025903 Bacteria 1837
152 Ga0207680_10220972 3300025903 Bacteria 1299
153 Ga0207645_10074626 3300025907 Bacteria 2171
154 Ga0207643_10010779 3300025908 Bacteria 4928
155 Ga0207643_10033481 3300025908 Bacteria 2875
156 Ga0207643_10058782 3300025908 Bacteria 2192
157 Ga0207707_10009521 3300025912 Bacteria 8428
158 Ga0207707_10022575 3300025912 Bacteria 5500
159 Ga0207660_10109231 3300025917 Bacteria 2079
160 Ga0207662_10000155 3300025918 Bacteria 32464
161 Ga0207662_10262050 3300025918 Bacteria 1138
162 Ga0207652_10013379 3300025921 Bacteria 6644
163 Ga0207652_10192527 3300025921 Bacteria 1834
164 Ga0207646_10187959 3300025922 Bacteria 1866
165 Ga0207646_10471293 3300025922 Bacteria 1132
166 Ga0207650_10003272 3300025925 Bacteria 11165
167 Ga0207650_10059181 3300025925 Unclassified 2855
168 Ga0207650_10158044 3300025925 Bacteria 1794
169 Ga0207687_10004271 3300025927 Bacteria 9555
170 Ga0207664_10042076 3300025929 Bacteria 3564
171 Ga0207644_10103349 3300025931 Bacteria 2144
172 Ga0207706_10093321 3300025933 Bacteria 2647
173 Ga0207686_10000347 3300025934 Bacteria 33269
174 Ga0207686_10089329 3300025934 Bacteria 2030
175 Ga0207709_10000647 3300025935 Bacteria 28268
176 Ga0207670_10201411 3300025936 Unclassified 1513
177 Ga0207669_10163815 3300025937 Bacteria 1574
178 Ga0207704_10002446 3300025938 Bacteria 8354
179 Ga0207691_10022855 3300025940 Bacteria 5894
180 Ga0207691_10044431 3300025940 Bacteria 4090
181 Ga0207691_10257081 3300025940 Bacteria 1506
182 Ga0207711_10009594 3300025941 Bacteria 8067
183 Ga0207689_10001602 3300025942 Bacteria 21425
184 Ga0207689_10002111 3300025942 Bacteria 18686
185 Ga0207667_10038575 3300025949 Bacteria 5100
186 Ga0207651_10121603 3300025960 Bacteria 1981
187 Ga0207651_10175183 3300025960 Bacteria 1696
188 Ga0207712_10004246 3300025961 Bacteria 9039
189 Ga0207712_10274255 3300025961 Bacteria 1373
190 Ga0207712_10354675 3300025961 Unclassified 1220
191 Ga0207668_10003111 3300025972 Bacteria 9720
192 Ga0207668_10003330 3300025972 Bacteria 9410
193 Ga0207640_10002134 3300025981 Bacteria 10621
194 Ga0207658_10022667 3300025986 Bacteria 4374
195 Ga0207677_10002515 3300026023 Bacteria 9609
196 Ga0207677_10262428 3300026023 Bacteria 1409
197 Ga0207703_10001278 3300026035 Bacteria 23343
198 Ga0207703_10005929 3300026035 Bacteria 9790
199 Ga0207703_10315561 3300026035 Bacteria 1430
200 Ga0207639_10269568 3300026041 Bacteria 1493
201 Ga0207678_10070304 3300026067 Bacteria 3001
202 Ga0207708_10000502 3300026075 Bacteria 30107
203 Ga0207641_10149343 3300026088 Unclassified 2115
204 Ga0207641_10167998 3300026088 Bacteria 2000
205 Ga0207641_10226777 3300026088 Bacteria 1735
206 Ga0207641_10340471 3300026088 Bacteria 1427
207 Ga0207648_10001446 3300026089 Bacteria 26151
208 Ga0207648_10002261 3300026089 Bacteria 20835
209 Ga0207648_10022751 3300026089 Bacteria 5624
210 Ga0207676_10001174 3300026095 Bacteria 19678
211 Ga0207674_10002529 3300026116 Bacteria 23045
212 Ga0207675_100000334 3300026118 Bacteria 45029
213 Ga0207675_100071050 3300026118 Bacteria 3254
214 Ga0207675_100249957 3300026118 Bacteria 1716
215 Ga0207698_10160448 3300026142 Unclassified 1966
216 Ga0207698_10374118 3300026142 Bacteria 1353
217 Ga0209967_1003162 3300027364 Bacteria 2161
218 Ga0209996_1002953 3300027395 Bacteria 2123
219 Ga0209968_1007407 3300027526 Bacteria 1661
220 Ga0209999_1004411 3300027543 Bacteria 2530
221 Ga0207428_10069586 3300027907 Bacteria 2767
222 Ga0207428_10151073 3300027907 Unclassified 1768
223 Ga0268266_10026500 3300028379 Bacteria 4933
224 Ga0268265_10003429 3300028380 Bacteria 11406
225 Ga0268264_10002240 3300028381 Bacteria 17151
226 Ga0307408_100115727 3300031548 Bacteria 2068
227 Ga0307408_100354647 3300031548 Unclassified 1246
228 Ga0307405_10141802 3300031731 Bacteria 1677
229 Ga0307407_10125384 3300031903 Bacteria 1635
230 Ga0307412_10044294 3300031911 Bacteria 2903
231 Ga0307416_100273075 3300032002 Bacteria 1661
232 Ga0307416_100709024 3300032002 Unclassified 1096
233 Ga0307411_10164575 3300032005 Bacteria 1666
234 Ga0373930_0000792 3300034816 Bacteria 4501
235 Ga0373938_0007419 3300034957 Bacteria 1928
236 Ga0373940_0001330 3300035088 Bacteria 4407
237 Ga0373944_0060942 3300035089 Bacteria 1210
238 Ga0373949_0003409 3300035090 Bacteria 3793
239 Ga0373949_0049266 3300035090 Unclassified 1057
240 Ga0373951_0005820 3300035091 Bacteria 2848
241 Ga0373923_0034389 3300035111 Bacteria 2057
242 Ga0373932_0003854 3300035112 Bacteria 3577
243 Ga0373939_0004151 3300035114 Unclassified 3415
244 Ga0373939_0007471 3300035114 Bacteria 2655
245 Ga0373945_0005160 3300035116 Bacteria 4173
246 Ga0373942_0005132 3300035207 Bacteria 3036
247 Ga0373931_0000452 3300035691 Bacteria 16749
248 Ga0373931_0014473 3300035691 Bacteria 3857
249 Ga0373931_0059081 3300035691 Bacteria 2061
250 Ga0373931_0243052 3300035691 Unclassified 1092
251 Ga0373931_0398946 3300035691 Unclassified 870
252 Ga0373927_0010513 3300035695 Bacteria 6168
253 Ga0373933_0220128 3300035724 Bacteria 1218
254 Ga0373947_0146445 3300035725 Bacteria 1518
255 Ga0373937_0129492 3300036401 Bacteria 2356
256 Ga0373925_0219360 3300037068 Bacteria 1517
257 Ga0439439_0029399 3300041406 Bacteria 1395
258 Ga0451807_0017135 3300041486 Bacteria 2085
259 Ga0439443_000328 3300042003 Bacteria 3958
260 Ga0439446_0006978 3300042156 Bacteria 2960
261 Ga0439434_0002530 3300042435 Bacteria 5322
262 Ga0439435_0000038 3300042436 Bacteria 14468
263 Ga0439435_0003248 3300042436 Bacteria 3358
264 Ga0439460_0000260 3300042461 Bacteria 10871
265 Ga0451576_0017056 3300045051 Bacteria 7992
266 Ga0451576_0090466 3300045051 Bacteria 3183
267 Ga0451576_0349708 3300045051 Bacteria 1547
268 Ga0451576_0843273 3300045051 Unclassified 962
269 Ga0495603_0053006 3300046455 Bacteria 2407
270 Ga0495580_0013907 3300046472 Bacteria 6126
271 Ga0495582_0229680 3300046473 Bacteria 1062
272 Ga0495594_0045009 3300046499 Bacteria 2422
273 Ga0495630_0299684 3300046517 Bacteria 1228
274 Ga0495666_0020142 3300046526 Bacteria 3308
275 Ga0495586_0002644 3300046535 Bacteria 9686
276 Ga0495647_0000634 3300046681 Bacteria 10380
277 Ga0495658_0014117 3300046683 Bacteria 4074
278 Ga0495669_0192720 3300046684 Bacteria 973
279 Ga0495676_0032303 3300047321 Bacteria 4420
280 Ga0496102_0020329 3300048905 Bacteria 5868
281 Ga0496114_0620747 3300048917 Bacteria 952
282 Ga0496114_0666457 3300048917 Bacteria 914
283 Ga0501036_0088134 3300049572 Bacteria 2623
284 Ga0501039_0017722 3300049575 Bacteria 5463
285 Ga0501039_0115466 3300049575 Bacteria 2101
286 Ga0501039_0128755 3300049575 Bacteria 1986
287 Ga0501040_0033905 3300049576 Bacteria 3460
288 Ga0501041_0074657 3300049577 Bacteria 2084
289 Ga0501041_0212838 3300049577 Bacteria 1212
290 Ga0501042_0372563 3300049578 Bacteria 1033
291 Ga0501046_0096670 3300049580 Bacteria 2269
292 Ga0501048_0072749 3300049582 Bacteria 2427
293 Ga0501069_0086865 3300049585 Bacteria 1766
294 Ga0501071_0004929 3300049587 Bacteria 8520
295 Ga0501071_0025684 3300049587 Bacteria 4128
296 Ga0501071_0321143 3300049587 Bacteria 1176
297 Ga0501071_0330392 3300049587 Unclassified 1159
298 Ga0501072_0052347 3300049588 Bacteria 3215
299 Ga0501074_0167968 3300049590 Bacteria 1566
300 Ga0501075_0013204 3300049591 Bacteria 5891
301 Ga0501075_0097819 3300049591 Bacteria 2227
302 Ga0501076_0063133 3300049592 Bacteria 2951
303 Ga0501080_0000418 3300049742 Bacteria 32644
304 Ga0501080_0188875 3300049742 Bacteria 1894
305 Ga0501080_0189925 3300049742 Bacteria 1888
306 Ga0501081_0036686 3300049743 Bacteria 3343
307 Ga0501045_0031954 3300049824 Bacteria 3813
308 Ga0501045_0081906 3300049824 Bacteria 2380
309 nmdc:mga05p37_134313_c1 3300050507 Bacteria 3035
310 nmdc:mga05p37_200_c1 3300050507 Bacteria 59779
311 nmdc:mga05p37_38025_c1 3300050507 Bacteria 5902
312 nmdc:mga05p37_78704_c1 3300050507 Bacteria 4060
313 nmdc:mga09592_103887_c1 3300050508 Bacteria 2435
314 nmdc:mga09592_10_c1 3300050508 Bacteria 106937
315 nmdc:mga09592_179019_c1 3300050508 Bacteria 1834
316 nmdc:mga09592_269739_c1 3300050508 Bacteria 1476
317 nmdc:mga09592_328_c1 3300050508 Bacteria 34777
318 nmdc:mga0qj67_199053_c1 3300050509 Bacteria 1628
319 nmdc:mga06r32_355171_c1 3300050510 Bacteria 1450
320 nmdc:mga06r32_41847_c1 3300050510 Bacteria 4354
321 nmdc:mga08y16_11238_c1 3300050511 Bacteria 9405
322 nmdc:mga08y16_117281_c1 3300050511 Bacteria 2771
323 nmdc:mga08y16_15605_c1 3300050511 Bacteria 7987
324 nmdc:mga08y16_251728_c1 3300050511 Bacteria 1825
325 nmdc:mga0n895_46_c1 3300050512 Bacteria 73853
326 nmdc:mga0rr50_1113_c1 3300050513 Bacteria 14599
327 nmdc:mga0rr50_32804_c1 3300050513 Bacteria 3704
328 nmdc:mga08x19_1643_c1 3300050514 Bacteria 13812
329 nmdc:mga08x19_3204_c1 3300050514 Bacteria 9815
330 nmdc:mga08x19_51888_c1 3300050514 Bacteria 2636
331 nmdc:mga08x19_60019_c1 3300050514 Bacteria 2463
332 nmdc:mga0a205_166909_c1 3300050515 Bacteria 2097
333 nmdc:mga0a205_29225_c1 3300050515 Bacteria 5275
334 Ga0530510_0033776 3300061734 Bacteria 3683
335 Ga0530510_0172986 3300061734 Bacteria 1600

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025960 Ga0207651_10121603 Ga0207651_101216032 221
2 3300049576 Ga0501040_0033905 Ga0501040_0033905_1431_2249 243
3 3300049582 Ga0501048_0072749 Ga0501048_0072749_640_1458 243
4 3300049824 Ga0501045_0081906 Ga0501045_0081906_335_1153 243
5 3300025908 Ga0207643_10058782 Ga0207643_100587822 245
6 3300048917 Ga0496114_0666457 Ga0496114_0666457_20_898 246
7 3300006914 Ga0075436_100011736 Ga0075436_1000117366 251
8 3300050514 nmdc:mga08x19_1643_c1 nmdc:mga08x19_1643_c1_5376_6194 251
9 3300005471 Ga0070698_100040611 Ga0070698_1000406116 255
10 3300006847 Ga0075431_100023520 Ga0075431_1000235206 255
11 3300006880 Ga0075429_100000901 Ga0075429_10000090122 255
12 3300005458 Ga0070681_10000281 Ga0070681_1000028111 259
13 3300005530 Ga0070679_100073416 Ga0070679_1000734164 259
14 3300005545 Ga0070695_100009787 Ga0070695_1000097874 259
15 3300005546 Ga0070696_100281085 Ga0070696_1002810852 259
16 3300025912 Ga0207707_10009521 Ga0207707_100095214 259
17 3300025917 Ga0207660_10109231 Ga0207660_101092313 259
18 3300025921 Ga0207652_10192527 Ga0207652_101925272 259
19 3300026088 Ga0207641_10167998 Ga0207641_101679982 259
20 3300035691 Ga0373931_0014473 Ga0373931_0014473_606_1388 260
21 3300049575 Ga0501039_0017722 Ga0501039_0017722_2498_3340 261
22 3300049577 Ga0501041_0212838 Ga0501041_0212838_93_935 261
23 3300049587 Ga0501071_0004929 Ga0501071_0004929_3311_4153 261
24 3300049742 Ga0501080_0000418 Ga0501080_0000418_5699_6541 261
25 3300005330 Ga0070690_100000497 Ga0070690_10000049715 262
26 3300005334 Ga0068869_100002100 Ga0068869_1000021005 262
27 3300005335 Ga0070666_10153687 Ga0070666_101536872 262
28 3300005336 Ga0070680_100001571 Ga0070680_1000015714 262
29 3300005337 Ga0070682_100016604 Ga0070682_1000166042 262
30 3300005338 Ga0068868_100004467 Ga0068868_1000044676 262
31 3300005340 Ga0070689_100009090 Ga0070689_1000090903 262
32 3300005341 Ga0070691_10001745 Ga0070691_100017457 262
33 3300005343 Ga0070687_100000268 Ga0070687_1000002686 262
34 3300005345 Ga0070692_10000432 Ga0070692_1000043211 262
35 3300005355 Ga0070671_100153948 Ga0070671_1001539483 262
36 3300005356 Ga0070674_100253865 Ga0070674_1002538652 262
37 3300005438 Ga0070701_10000083 Ga0070701_1000008320 262
38 3300005440 Ga0070705_100000645 Ga0070705_1000006453 262
39 3300005441 Ga0070700_100000249 Ga0070700_10000024920 262
40 3300005444 Ga0070694_100000382 Ga0070694_1000003827 262
41 3300005458 Ga0070681_10030881 Ga0070681_100308814 262
42 3300005459 Ga0068867_100000534 Ga0068867_10000053420 262
43 3300005530 Ga0070679_100007368 Ga0070679_10000736811 262
44 3300005539 Ga0068853_100260598 Ga0068853_1002605983 262
45 3300005544 Ga0070686_100000299 Ga0070686_1000002997 262
46 3300005545 Ga0070695_100000816 Ga0070695_1000008168 262
47 3300005546 Ga0070696_100002955 Ga0070696_1000029559 262
48 3300005547 Ga0070693_100000281 Ga0070693_1000002817 262
49 3300005549 Ga0070704_100000420 Ga0070704_10000042020 262
50 3300005563 Ga0068855_100002028 Ga0068855_10000202820 262
51 3300005578 Ga0068854_100003188 Ga0068854_1000031889 262
52 3300005615 Ga0070702_100004547 Ga0070702_1000045474 262
53 3300005617 Ga0068859_100017570 Ga0068859_1000175704 262
54 3300005718 Ga0068866_10000506 Ga0068866_1000050613 262
55 3300005719 Ga0068861_100000192 Ga0068861_1000001928 262
56 3300005840 Ga0068870_10095825 Ga0068870_100958252 262
57 3300005842 Ga0068858_100005818 Ga0068858_10000581811 262
58 3300005843 Ga0068860_100002610 Ga0068860_1000026107 262
59 3300005844 Ga0068862_100005986 Ga0068862_1000059869 262
60 3300006237 Ga0097621_100004557 Ga0097621_10000455712 262
61 3300006358 Ga0068871_100006222 Ga0068871_1000062225 262
62 3300006881 Ga0068865_100000300 Ga0068865_10000030012 262
63 3300006931 Ga0097620_100017569 Ga0097620_1000175694 262
64 3300009092 Ga0105250_10135956 Ga0105250_101359561 262
65 3300009098 Ga0105245_10000821 Ga0105245_1000082118 262
66 3300009148 Ga0105243_10001374 Ga0105243_1000137413 262
67 3300009174 Ga0105241_10081780 Ga0105241_100817803 262
68 3300009176 Ga0105242_10007413 Ga0105242_100074139 262
69 3300009553 Ga0105249_10000348 Ga0105249_1000034840 262
70 3300010375 Ga0105239_10203197 Ga0105239_102031973 262
71 3300013297 Ga0157378_10001675 Ga0157378_1000167515 262
72 3300014745 Ga0157377_10276995 Ga0157377_102769952 262
73 3300014968 Ga0157379_10233506 Ga0157379_102335062 262
74 3300025899 Ga0207642_10000533 Ga0207642_100005339 262
75 3300025903 Ga0207680_10103122 Ga0207680_101031223 262
76 3300025908 Ga0207643_10033481 Ga0207643_100334813 262
77 3300025912 Ga0207707_10022575 Ga0207707_100225754 262
78 3300025918 Ga0207662_10000155 Ga0207662_1000015525 262
79 3300025921 Ga0207652_10013379 Ga0207652_100133793 262
80 3300025927 Ga0207687_10004271 Ga0207687_100042717 262
81 3300025931 Ga0207644_10103349 Ga0207644_101033493 262
82 3300025933 Ga0207706_10093321 Ga0207706_100933213 262
83 3300025934 Ga0207686_10000347 Ga0207686_100003474 262
84 3300025935 Ga0207709_10000647 Ga0207709_100006477 262
85 3300025937 Ga0207669_10163815 Ga0207669_101638153 262
86 3300025938 Ga0207704_10002446 Ga0207704_100024469 262
87 3300025942 Ga0207689_10002111 Ga0207689_1000211113 262
88 3300025949 Ga0207667_10038575 Ga0207667_100385757 262
89 3300025961 Ga0207712_10004246 Ga0207712_100042464 262
90 3300025981 Ga0207640_10002134 Ga0207640_100021347 262
91 3300026023 Ga0207677_10002515 Ga0207677_100025153 262
92 3300026035 Ga0207703_10005929 Ga0207703_100059293 262
93 3300026041 Ga0207639_10269568 Ga0207639_102695683 262
94 3300026075 Ga0207708_10000502 Ga0207708_100005027 262
95 3300026088 Ga0207641_10340471 Ga0207641_103404712 262
96 3300026089 Ga0207648_10001446 Ga0207648_1000144620 262
97 3300026118 Ga0207675_100000334 Ga0207675_10000033426 262
98 3300028380 Ga0268265_10003429 Ga0268265_100034298 262
99 3300035089 Ga0373944_0060942 Ga0373944_0060942_191_982 262
100 3300035090 Ga0373949_0049266 Ga0373949_0049266_253_1044 262
101 3300035111 Ga0373923_0034389 Ga0373923_0034389_293_1084 262
102 3300035114 Ga0373939_0007471 Ga0373939_0007471_1843_2634 262
103 3300035116 Ga0373945_0005160 Ga0373945_0005160_2880_3671 262
104 3300035691 Ga0373931_0059081 Ga0373931_0059081_928_1719 262
105 3300035691 Ga0373931_0398946 Ga0373931_0398946_15_806 262
106 3300035695 Ga0373927_0010513 Ga0373927_0010513_4886_5677 262
107 3300035725 Ga0373947_0146445 Ga0373947_0146445_498_1289 262
108 3300037068 Ga0373925_0219360 Ga0373925_0219360_338_1129 262
109 3300045051 Ga0451576_0090466 Ga0451576_0090466_2031_2822 262
110 3300046455 Ga0495603_0053006 Ga0495603_0053006_222_1013 262
111 3300046472 Ga0495580_0013907 Ga0495580_0013907_3190_3981 262
112 3300046473 Ga0495582_0229680 Ga0495582_0229680_123_914 262
113 3300046499 Ga0495594_0045009 Ga0495594_0045009_1145_1936 262
114 3300046517 Ga0495630_0299684 Ga0495630_0299684_234_1025 262
115 3300046526 Ga0495666_0020142 Ga0495666_0020142_982_1773 262
116 3300046535 Ga0495586_0002644 Ga0495586_0002644_2360_3151 262
117 3300046681 Ga0495647_0000634 Ga0495647_0000634_7730_8521 262
118 3300046683 Ga0495658_0014117 Ga0495658_0014117_2215_3006 262
119 3300047321 Ga0495676_0032303 Ga0495676_0032303_1319_2110 262
120 3300048917 Ga0496114_0620747 Ga0496114_0620747_134_925 262
121 3300005444 Ga0070694_100022921 Ga0070694_1000229212 263
122 3300006914 Ga0075436_100005856 Ga0075436_1000058564 263
123 3300049580 Ga0501046_0096670 Ga0501046_0096670_590_1432 263
124 3300049591 Ga0501075_0013204 Ga0501075_0013204_108_950 263
125 3300049743 Ga0501081_0036686 Ga0501081_0036686_825_1667 263
126 3300050513 nmdc:mga0rr50_32804_c1 nmdc:mga0rr50_32804_c1_1420_2214 263
127 3300050514 nmdc:mga08x19_3204_c1 nmdc:mga08x19_3204_c1_4643_5437 263
128 3300061734 Ga0530510_0033776 Ga0530510_0033776_2049_2891 263
129 3300005546 Ga0070696_100006964 Ga0070696_1000069643 264
130 3300005549 Ga0070704_100322452 Ga0070704_1003224522 264
131 3300031903 Ga0307407_10125384 Ga0307407_101253841 265
132 3300032005 Ga0307411_10164575 Ga0307411_101645751 265
133 3300049587 Ga0501071_0025684 Ga0501071_0025684_2897_3694 265
134 3300005549 Ga0070704_100002847 Ga0070704_1000028476 267
135 3300006844 Ga0075428_100084931 Ga0075428_1000849314 267
136 3300007265 Ga0099794_10027392 Ga0099794_100273924 267
137 3300009147 Ga0114129_10057361 Ga0114129_100573615 267
138 3300025922 Ga0207646_10471293 Ga0207646_104712931 267
139 3300031548 Ga0307408_100115727 Ga0307408_1001157271 267
140 3300031731 Ga0307405_10141802 Ga0307405_101418021 267
141 3300041486 Ga0451807_0017135 Ga0451807_0017135_1074_1913 267
142 3300050507 nmdc:mga05p37_78704_c1 nmdc:mga05p37_78704_c1_824_1657 267
143 3300050508 nmdc:mga09592_328_c1 nmdc:mga09592_328_c1_14848_15681 267
144 3300005341 Ga0070691_10105959 Ga0070691_101059592 269
145 3300005440 Ga0070705_100196203 Ga0070705_1001962031 269
146 3300005444 Ga0070694_100101742 Ga0070694_1001017423 269
147 3300005545 Ga0070695_100217744 Ga0070695_1002177442 269
148 3300005549 Ga0070704_100115214 Ga0070704_1001152143 269
149 3300009094 Ga0111539_10042374 Ga0111539_100423746 269
150 3300014326 Ga0157380_10320906 Ga0157380_103209061 269
151 3300027907 Ga0207428_10069586 Ga0207428_100695863 269
152 3300050508 nmdc:mga09592_179019_c1 nmdc:mga09592_179019_c1_41_853 269
153 3300050511 nmdc:mga08y16_15605_c1 nmdc:mga08y16_15605_c1_687_1499 269
154 3300005544 Ga0070686_100426761 Ga0070686_1004267612 270
155 3300005547 Ga0070693_100265755 Ga0070693_1002657551 270
156 3300006847 Ga0075431_100003399 Ga0075431_10000339916 270
157 3300006852 Ga0075433_10046433 Ga0075433_100464332 270
158 3300006914 Ga0075436_100223874 Ga0075436_1002238742 270
159 3300007076 Ga0075435_100003697 Ga0075435_10000369710 270
160 3300035691 Ga0373931_0243052 Ga0373931_0243052_59_874 270
161 3300049742 Ga0501080_0188875 Ga0501080_0188875_187_999 270
162 3300050510 nmdc:mga06r32_41847_c1 nmdc:mga06r32_41847_c1_1439_2251 270
163 3300050514 nmdc:mga08x19_51888_c1 nmdc:mga08x19_51888_c1_1533_2348 270
164 3300050515 nmdc:mga0a205_166909_c1 nmdc:mga0a205_166909_c1_278_1093 270
165 3300050515 nmdc:mga0a205_29225_c1 nmdc:mga0a205_29225_c1_3299_4114 270
166 3300006844 Ga0075428_100012898 Ga0075428_1000128987 271
167 3300006880 Ga0075429_100100749 Ga0075429_1001007492 271
168 3300009147 Ga0114129_10073781 Ga0114129_100737815 271
169 3300049575 Ga0501039_0128755 Ga0501039_0128755_430_1245 271
170 3300049577 Ga0501041_0074657 Ga0501041_0074657_66_881 271
171 3300049587 Ga0501071_0330392 Ga0501071_0330392_230_1048 271
172 3300049742 Ga0501080_0189925 Ga0501080_0189925_995_1810 271
173 3300050507 nmdc:mga05p37_38025_c1 nmdc:mga05p37_38025_c1_2413_3231 271
174 3300050508 nmdc:mga09592_103887_c1 nmdc:mga09592_103887_c1_1503_2321 271
175 3300005545 Ga0070695_100226385 Ga0070695_1002263852 272
176 3300006871 Ga0075434_100000013 Ga0075434_10000001366 272
177 3300006914 Ga0075436_100094933 Ga0075436_1000949333 272
178 3300007076 Ga0075435_100000852 Ga0075435_1000008525 272
179 3300009147 Ga0114129_10122767 Ga0114129_101227672 272
180 3300009147 Ga0114129_10151351 Ga0114129_101513513 272
181 3300031548 Ga0307408_100354647 Ga0307408_1003546472 272
182 3300032002 Ga0307416_100709024 Ga0307416_1007090242 272
183 3300041406 Ga0439439_0029399 Ga0439439_0029399_182_1000 272
184 3300042156 Ga0439446_0006978 Ga0439446_0006978_1699_2517 272
185 3300042435 Ga0439434_0002530 Ga0439434_0002530_834_1652 272
186 3300042436 Ga0439435_0003248 Ga0439435_0003248_977_1795 272
187 3300045051 Ga0451576_0843273 Ga0451576_0843273_108_932 272
188 3300049572 Ga0501036_0088134 Ga0501036_0088134_462_1310 272
189 3300049575 Ga0501039_0115466 Ga0501039_0115466_512_1360 272
190 3300049590 Ga0501074_0167968 Ga0501074_0167968_335_1183 272
191 3300049591 Ga0501075_0097819 Ga0501075_0097819_724_1572 272
192 3300049592 Ga0501076_0063133 Ga0501076_0063133_662_1510 272
193 3300049824 Ga0501045_0031954 Ga0501045_0031954_1351_2199 272
194 3300050507 nmdc:mga05p37_134313_c1 nmdc:mga05p37_134313_c1_179_1000 272
195 3300050512 nmdc:mga0n895_46_c1 nmdc:mga0n895_46_c1_1851_2687 272
196 3300050513 nmdc:mga0rr50_1113_c1 nmdc:mga0rr50_1113_c1_1031_1867 272
197 3300061734 Ga0530510_0172986 Ga0530510_0172986_482_1330 272
198 3300005336 Ga0070680_100111580 Ga0070680_1001115803 273
199 3300005345 Ga0070692_10035049 Ga0070692_100350492 273
200 3300005347 Ga0070668_100233705 Ga0070668_1002337052 273
201 3300005435 Ga0070714_100056577 Ga0070714_1000565774 273
202 3300005444 Ga0070694_100006472 Ga0070694_1000064727 273
203 3300005444 Ga0070694_100034603 Ga0070694_1000346033 273
204 3300005455 Ga0070663_100133321 Ga0070663_1001333212 273
205 3300005518 Ga0070699_100321171 Ga0070699_1003211712 273
206 3300005545 Ga0070695_100073265 Ga0070695_1000732653 273
207 3300005719 Ga0068861_100204624 Ga0068861_1002046242 273
208 3300005985 Ga0081539_10001221 Ga0081539_1000122125 273
209 3300006846 Ga0075430_100074840 Ga0075430_1000748405 273
210 3300007076 Ga0075435_100052323 Ga0075435_1000523233 273
211 3300025929 Ga0207664_10042076 Ga0207664_100420764 273
212 3300025940 Ga0207691_10044431 Ga0207691_100444315 273
213 3300026023 Ga0207677_10262428 Ga0207677_102624282 273
214 3300026067 Ga0207678_10070304 Ga0207678_100703042 273
215 3300026089 Ga0207648_10022751 Ga0207648_100227515 273
216 3300026118 Ga0207675_100249957 Ga0207675_1002499572 273
217 3300026142 Ga0207698_10374118 Ga0207698_103741182 273
218 3300027526 Ga0209968_1007407 Ga0209968_10074073 273
219 3300031911 Ga0307412_10044294 Ga0307412_100442943 273
220 3300032002 Ga0307416_100273075 Ga0307416_1002730753 273
221 3300036401 Ga0373937_0129492 Ga0373937_0129492_990_1814 273
222 3300042003 Ga0439443_000328 Ga0439443_000328_672_1496 273
223 3300042436 Ga0439435_0000038 Ga0439435_0000038_2004_2828 273
224 3300042461 Ga0439460_0000260 Ga0439460_0000260_9326_10150 273
225 3300049585 Ga0501069_0086865 Ga0501069_0086865_832_1656 273
226 3300049587 Ga0501071_0321143 Ga0501071_0321143_55_879 273
227 3300049588 Ga0501072_0052347 Ga0501072_0052347_1588_2412 273
228 3300050508 nmdc:mga09592_269739_c1 nmdc:mga09592_269739_c1_477_1301 273
229 3300050509 nmdc:mga0qj67_199053_c1 nmdc:mga0qj67_199053_c1_192_1016 273
230 3300050514 nmdc:mga08x19_60019_c1 nmdc:mga08x19_60019_c1_669_1493 273
231 3300035724 Ga0373933_0220128 Ga0373933_0220128_110_937 274
232 3300046684 Ga0495669_0192720 Ga0495669_0192720_26_859 274
233 3300005340 Ga0070689_100199007 Ga0070689_1001990072 275
234 3300005355 Ga0070671_100024708 Ga0070671_1000247082 275
235 3300005471 Ga0070698_100146687 Ga0070698_1001466873 275
236 3300005543 Ga0070672_100087553 Ga0070672_1000875533 275
237 3300005546 Ga0070696_100049778 Ga0070696_1000497782 275
238 3300005617 Ga0068859_100023069 Ga0068859_1000230694 275
239 3300005618 Ga0068864_100585884 Ga0068864_1005858841 275
240 3300005844 Ga0068862_100402189 Ga0068862_1004021892 275
241 3300006237 Ga0097621_100348628 Ga0097621_1003486281 275
242 3300006847 Ga0075431_100060716 Ga0075431_1000607165 275
243 3300006931 Ga0097620_100023071 Ga0097620_1000230717 275
244 3300009094 Ga0111539_10090749 Ga0111539_100907494 275
245 3300009094 Ga0111539_10261768 Ga0111539_102617684 275
246 3300009177 Ga0105248_10054514 Ga0105248_100545141 275
247 3300009553 Ga0105249_10321030 Ga0105249_103210302 275
248 3300013306 Ga0163162_10193428 Ga0163162_101934282 275
249 3300013308 Ga0157375_10024939 Ga0157375_100249395 275
250 3300013308 Ga0157375_10027711 Ga0157375_100277115 275
251 3300025903 Ga0207680_10220972 Ga0207680_102209722 275
252 3300025922 Ga0207646_10187959 Ga0207646_101879593 275
253 3300025925 Ga0207650_10158044 Ga0207650_101580442 275
254 3300025936 Ga0207670_10201411 Ga0207670_102014113 275
255 3300025940 Ga0207691_10022855 Ga0207691_100228551 275
256 3300025940 Ga0207691_10257081 Ga0207691_102570811 275
257 3300025960 Ga0207651_10175183 Ga0207651_101751832 275
258 3300025961 Ga0207712_10354675 Ga0207712_103546751 275
259 3300025972 Ga0207668_10003111 Ga0207668_100031115 275
260 3300025986 Ga0207658_10022667 Ga0207658_100226672 275
261 3300026035 Ga0207703_10315561 Ga0207703_103155612 275
262 3300026088 Ga0207641_10226777 Ga0207641_102267772 275
263 3300026142 Ga0207698_10160448 Ga0207698_101604483 275
264 3300027907 Ga0207428_10151073 Ga0207428_101510732 275
265 3300028379 Ga0268266_10026500 Ga0268266_100265004 275
266 3300035114 Ga0373939_0004151 Ga0373939_0004151_1816_2673 275
267 3300045051 Ga0451576_0017056 Ga0451576_0017056_668_1525 275
268 3300050511 nmdc:mga08y16_117281_c1 nmdc:mga08y16_117281_c1_525_1382 275
269 3300050511 nmdc:mga08y16_251728_c1 nmdc:mga08y16_251728_c1_795_1625 275
270 3300005331 Ga0070670_100326090 Ga0070670_1003260901 276
271 3300005347 Ga0070668_100009967 Ga0070668_1000099674 276
272 3300005544 Ga0070686_100409523 Ga0070686_1004095231 276
273 3300005617 Ga0068859_100067069 Ga0068859_1000670694 276
274 3300005844 Ga0068862_100328736 Ga0068862_1003287361 276
275 3300006931 Ga0097620_100067069 Ga0097620_1000670694 276
276 3300025925 Ga0207650_10059181 Ga0207650_100591812 276
277 3300025972 Ga0207668_10003330 Ga0207668_100033303 276
278 3300049578 Ga0501042_0372563 Ga0501042_0372563_185_1021 277
279 3300005615 Ga0070702_100381638 Ga0070702_1003816382 278
280 3300009176 Ga0105242_10222358 Ga0105242_102223582 278
281 3300025934 Ga0207686_10089329 Ga0207686_100893291 278
282 3300027364 Ga0209967_1003162 Ga0209967_10031622 278
283 3300027395 Ga0209996_1002953 Ga0209996_10029532 278
284 3300027543 Ga0209999_1004411 Ga0209999_10044113 278
285 3300025941 Ga0207711_10009594 Ga0207711_100095945 280
286 3300034816 Ga0373930_0000792 Ga0373930_0000792_199_1149 282
287 3300034957 Ga0373938_0007419 Ga0373938_0007419_593_1543 282
288 3300035088 Ga0373940_0001330 Ga0373940_0001330_3269_4219 282
289 3300035090 Ga0373949_0003409 Ga0373949_0003409_1816_2766 282
290 3300035091 Ga0373951_0005820 Ga0373951_0005820_859_1809 282
291 3300035112 Ga0373932_0003854 Ga0373932_0003854_862_1812 282
292 3300035207 Ga0373942_0005132 Ga0373942_0005132_1232_2182 282
293 3300035691 Ga0373931_0000452 Ga0373931_0000452_1915_2865 282
294 3300045051 Ga0451576_0349708 Ga0451576_0349708_203_1153 282
295 3300050507 nmdc:mga05p37_200_c1 nmdc:mga05p37_200_c1_32654_33604 282
296 3300050508 nmdc:mga09592_10_c1 nmdc:mga09592_10_c1_79812_80762 282
297 3300050510 nmdc:mga06r32_355171_c1 nmdc:mga06r32_355171_c1_198_1148 282
298 3300050511 nmdc:mga08y16_11238_c1 nmdc:mga08y16_11238_c1_5618_6568 282
299 3300005328 Ga0070676_10066422 Ga0070676_100664223 285
300 3300005331 Ga0070670_100004995 Ga0070670_1000049956 285
301 3300005334 Ga0068869_100003023 Ga0068869_1000030238 285
302 3300005340 Ga0070689_100128926 Ga0070689_1001289262 285
303 3300005343 Ga0070687_100169842 Ga0070687_1001698421 285
304 3300005353 Ga0070669_100039985 Ga0070669_1000399851 285
305 3300005364 Ga0070673_100017095 Ga0070673_1000170953 285
306 3300005459 Ga0068867_100001706 Ga0068867_10000170610 285
307 3300005549 Ga0070704_100367231 Ga0070704_1003672312 285
308 3300005564 Ga0070664_100421110 Ga0070664_1004211101 285
309 3300005577 Ga0068857_100003057 Ga0068857_10000305712 285
310 3300005617 Ga0068859_100002465 Ga0068859_10000246512 285
311 3300005618 Ga0068864_100013535 Ga0068864_1000135354 285
312 3300005840 Ga0068870_10008856 Ga0068870_100088563 285
313 3300005841 Ga0068863_100024732 Ga0068863_1000247325 285
314 3300005842 Ga0068858_100010718 Ga0068858_1000107187 285
315 3300005843 Ga0068860_100003281 Ga0068860_1000032816 285
316 3300006931 Ga0097620_100002465 Ga0097620_10000246512 285
317 3300009101 Ga0105247_10018367 Ga0105247_100183672 285
318 3300009177 Ga0105248_10005793 Ga0105248_100057937 285
319 3300009553 Ga0105249_10281024 Ga0105249_102810242 285
320 3300013306 Ga0163162_10065618 Ga0163162_100656183 285
321 3300014968 Ga0157379_10000219 Ga0157379_1000021921 285
322 3300025907 Ga0207645_10074626 Ga0207645_100746263 285
323 3300025908 Ga0207643_10010779 Ga0207643_100107795 285
324 3300025918 Ga0207662_10262050 Ga0207662_102620502 285
325 3300025925 Ga0207650_10003272 Ga0207650_100032726 285
326 3300025942 Ga0207689_10001602 Ga0207689_100016028 285
327 3300025961 Ga0207712_10274255 Ga0207712_102742552 285
328 3300026035 Ga0207703_10001278 Ga0207703_1000127811 285
329 3300026088 Ga0207641_10149343 Ga0207641_101493432 285
330 3300026089 Ga0207648_10002261 Ga0207648_1000226110 285
331 3300026095 Ga0207676_10001174 Ga0207676_1000117411 285
332 3300026116 Ga0207674_10002529 Ga0207674_1000252916 285
333 3300026118 Ga0207675_100071050 Ga0207675_1000710502 285
334 3300028381 Ga0268264_10002240 Ga0268264_1000224011 285
335 3300048905 Ga0496102_0020329 Ga0496102_0020329_648_1505 285

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03328

HpcH_HpaI

HpcH/HpaI aldolase/citrate lyase family

49

256

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5vxc-assembly1.cif.gz_A crystal structure analysis of human clybl in complex with free coash 0.9227 13 284
1sgj-assembly1.cif.gz_C crystal structure of citrate lyase beta subunit 0.9076 13 234
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.9037 12 240
4l9z-assembly1.cif.gz_A crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa 0.9028 12 285
3qll-assembly1.cif.gz_A crystal structure of ripc from yersinia pestis 0.8917 12 240
ID Description Score Start End Superfamily
af_A0A0R4IAX5_410_529_1.20.1220.12 Mainly Alpha;Up-down Bundle;Malate Synthase G; Chain: A; Domain 4;Malate synthase, domain III 0.9498 240 280 1.20.1220.12
af_Q1JPT8_41_343_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9379 13 282 3.20.20.60
af_Q93167_15_324_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.911 8 284 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9065 12 240 3.20.20.60
3qllC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8943 12 240 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A2E6QJV7-F1-model_v4 CoA ester lyase 0.9724 16 284 GO:0000287
GO:0006107
GO:0016829
AF-A0A7C5LTA7-F1-model_v4 CoA ester lyase 0.9682 11 244 GO:0000287
GO:0006107
GO:0016829
AF-A0A220RJM3-F1-model_v4 deleted 0.9605 16 237
AF-A0A2V6RC67-F1-model_v4 CoA ester lyase 0.9513 11 284 GO:0000287
GO:0006107
GO:0016829
AF-A0A7Z9INP7-F1-model_v4 CoA ester lyase 0.9513 14 284 GO:0000287
GO:0006107
GO:0016829

Feature Viewer

pLDDT pTM Quality
91.23 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map