F412309
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 335 | 197 | 335 | 273 |
Family's Representative Sequence
| Representative Sequence | 3300034816|Ga0373930_0000792|Ga0373930_0000792_199_1149 |
| Length | 316 |
| Sequence | VGHRDSSGCDPAACAGQPGRAIRLRALSLVGGERPPLSKSGTPKPRRRRTWLFVAGADEAAHRAAARSGADAIILELEDFTPPELRPKARAHAAEVLDEWRAAGALAGVRINPLETCGRDDLVGVLAGRPDFIMMSKVDSPAQVKALEAETGGAVDLVPNIENAAGLLNAYAIAKASKRVVAALVASEDMAASLGAVRSRRGGELAYVRSRFLVECRAAGVEAIDCPYTFSDVEGAAADARYARRLGYRMKSLVDPSHVAAVNRALTPNLARARRIVAAFEKARAQGKDRARLDGALIEVPAYAAAKRLLESDGQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 3 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 5 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 55 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 56 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 57 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 58 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 59 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 60 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 125 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 130 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 133 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 134 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 135 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 136 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 137 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 139 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 140 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 142 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 143 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 145 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 146 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 147 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 148 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 149 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 150 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 151 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 152 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 153 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 154 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 155 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 156 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 157 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 158 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 159 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 171 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 172 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 177 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 179 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 180 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 182 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 193 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 194 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 195 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.19 |
| Rhizosphere | 98.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070676_10066422 | 3300005328 | Bacteria | 2155 |
| 2 | Ga0070690_100000497 | 3300005330 | Bacteria | 19649 |
| 3 | Ga0070670_100004995 | 3300005331 | Bacteria | 11159 |
| 4 | Ga0070670_100326090 | 3300005331 | Unclassified | 1346 |
| 5 | Ga0068869_100002100 | 3300005334 | Bacteria | 11972 |
| 6 | Ga0068869_100003023 | 3300005334 | Bacteria | 10223 |
| 7 | Ga0070666_10153687 | 3300005335 | Bacteria | 1606 |
| 8 | Ga0070680_100001571 | 3300005336 | Bacteria | 16654 |
| 9 | Ga0070680_100111580 | 3300005336 | Bacteria | 2276 |
| 10 | Ga0070682_100016604 | 3300005337 | Bacteria | 4284 |
| 11 | Ga0068868_100004467 | 3300005338 | Bacteria | 9813 |
| 12 | Ga0070689_100009090 | 3300005340 | Bacteria | 7034 |
| 13 | Ga0070689_100128926 | 3300005340 | Bacteria | 2027 |
| 14 | Ga0070689_100199007 | 3300005340 | Unclassified | 1635 |
| 15 | Ga0070691_10001745 | 3300005341 | Bacteria | 9442 |
| 16 | Ga0070691_10105959 | 3300005341 | Bacteria | 1401 |
| 17 | Ga0070687_100000268 | 3300005343 | Bacteria | 17660 |
| 18 | Ga0070687_100169842 | 3300005343 | Bacteria | 1297 |
| 19 | Ga0070692_10000432 | 3300005345 | Bacteria | 12705 |
| 20 | Ga0070692_10035049 | 3300005345 | Bacteria | 2539 |
| 21 | Ga0070668_100009967 | 3300005347 | Bacteria | 7039 |
| 22 | Ga0070668_100233705 | 3300005347 | Unclassified | 1521 |
| 23 | Ga0070669_100039985 | 3300005353 | Bacteria | 3408 |
| 24 | Ga0070671_100024708 | 3300005355 | Bacteria | 4921 |
| 25 | Ga0070671_100153948 | 3300005355 | Bacteria | 1942 |
| 26 | Ga0070674_100253865 | 3300005356 | Bacteria | 1382 |
| 27 | Ga0070673_100017095 | 3300005364 | Bacteria | 5147 |
| 28 | Ga0070714_100056577 | 3300005435 | Bacteria | 3355 |
| 29 | Ga0070701_10000083 | 3300005438 | Bacteria | 26254 |
| 30 | Ga0070705_100000645 | 3300005440 | Bacteria | 19939 |
| 31 | Ga0070705_100196203 | 3300005440 | Bacteria | 1380 |
| 32 | Ga0070700_100000249 | 3300005441 | Bacteria | 29271 |
| 33 | Ga0070694_100000382 | 3300005444 | Bacteria | 23947 |
| 34 | Ga0070694_100006472 | 3300005444 | Bacteria | 7113 |
| 35 | Ga0070694_100022921 | 3300005444 | Bacteria | 4008 |
| 36 | Ga0070694_100034603 | 3300005444 | Bacteria | 3333 |
| 37 | Ga0070694_100101742 | 3300005444 | Bacteria | 2033 |
| 38 | Ga0070663_100133321 | 3300005455 | Bacteria | 1889 |
| 39 | Ga0070681_10000281 | 3300005458 | Bacteria | 40930 |
| 40 | Ga0070681_10030881 | 3300005458 | Bacteria | 5378 |
| 41 | Ga0068867_100000534 | 3300005459 | Bacteria | 25071 |
| 42 | Ga0068867_100001706 | 3300005459 | Bacteria | 15301 |
| 43 | Ga0070698_100040611 | 3300005471 | Bacteria | 4780 |
| 44 | Ga0070698_100146687 | 3300005471 | Bacteria | 2308 |
| 45 | Ga0070699_100321171 | 3300005518 | Bacteria | 1391 |
| 46 | Ga0070679_100007368 | 3300005530 | Bacteria | 10280 |
| 47 | Ga0070679_100073416 | 3300005530 | Bacteria | 3413 |
| 48 | Ga0068853_100260598 | 3300005539 | Bacteria | 1594 |
| 49 | Ga0070672_100087553 | 3300005543 | Bacteria | 2506 |
| 50 | Ga0070686_100000299 | 3300005544 | Bacteria | 33122 |
| 51 | Ga0070686_100409523 | 3300005544 | Unclassified | 1033 |
| 52 | Ga0070686_100426761 | 3300005544 | Bacteria | 1014 |
| 53 | Ga0070695_100000816 | 3300005545 | Bacteria | 16788 |
| 54 | Ga0070695_100009787 | 3300005545 | Bacteria | 5710 |
| 55 | Ga0070695_100073265 | 3300005545 | Bacteria | 2247 |
| 56 | Ga0070695_100217744 | 3300005545 | Unclassified | 1374 |
| 57 | Ga0070695_100226385 | 3300005545 | Bacteria | 1350 |
| 58 | Ga0070696_100002955 | 3300005546 | Bacteria | 11296 |
| 59 | Ga0070696_100006964 | 3300005546 | Bacteria | 7545 |
| 60 | Ga0070696_100049778 | 3300005546 | Bacteria | 2912 |
| 61 | Ga0070696_100281085 | 3300005546 | Bacteria | 1269 |
| 62 | Ga0070693_100000281 | 3300005547 | Bacteria | 23879 |
| 63 | Ga0070693_100265755 | 3300005547 | Bacteria | 1143 |
| 64 | Ga0070704_100000420 | 3300005549 | Bacteria | 19697 |
| 65 | Ga0070704_100002847 | 3300005549 | Bacteria | 9807 |
| 66 | Ga0070704_100115214 | 3300005549 | Bacteria | 2053 |
| 67 | Ga0070704_100322452 | 3300005549 | Bacteria | 1295 |
| 68 | Ga0070704_100367231 | 3300005549 | Bacteria | 1219 |
| 69 | Ga0068855_100002028 | 3300005563 | Bacteria | 25117 |
| 70 | Ga0070664_100421110 | 3300005564 | Bacteria | 1223 |
| 71 | Ga0068857_100003057 | 3300005577 | Bacteria | 13841 |
| 72 | Ga0068854_100003188 | 3300005578 | Bacteria | 10238 |
| 73 | Ga0070702_100004547 | 3300005615 | Bacteria | 6347 |
| 74 | Ga0070702_100381638 | 3300005615 | Bacteria | 1002 |
| 75 | Ga0068859_100002465 | 3300005617 | Bacteria | 18831 |
| 76 | Ga0068859_100017570 | 3300005617 | Bacteria | 7192 |
| 77 | Ga0068859_100023069 | 3300005617 | Bacteria | 6240 |
| 78 | Ga0068859_100067069 | 3300005617 | Bacteria | 3623 |
| 79 | Ga0068864_100013535 | 3300005618 | Bacteria | 6763 |
| 80 | Ga0068864_100585884 | 3300005618 | Bacteria | 1081 |
| 81 | Ga0068866_10000506 | 3300005718 | Bacteria | 18014 |
| 82 | Ga0068861_100000192 | 3300005719 | Bacteria | 32743 |
| 83 | Ga0068861_100204624 | 3300005719 | Bacteria | 1659 |
| 84 | Ga0068870_10008856 | 3300005840 | Bacteria | 4544 |
| 85 | Ga0068870_10095825 | 3300005840 | Bacteria | 1668 |
| 86 | Ga0068863_100024732 | 3300005841 | Bacteria | 5727 |
| 87 | Ga0068858_100005818 | 3300005842 | Bacteria | 12045 |
| 88 | Ga0068858_100010718 | 3300005842 | Bacteria | 8674 |
| 89 | Ga0068860_100002610 | 3300005843 | Bacteria | 18852 |
| 90 | Ga0068860_100003281 | 3300005843 | Bacteria | 16651 |
| 91 | Ga0068862_100005986 | 3300005844 | Bacteria | 10126 |
| 92 | Ga0068862_100328736 | 3300005844 | Bacteria | 1413 |
| 93 | Ga0068862_100402189 | 3300005844 | Bacteria | 1281 |
| 94 | Ga0081539_10001221 | 3300005985 | Bacteria | 45911 |
| 95 | Ga0097621_100004557 | 3300006237 | Bacteria | 9670 |
| 96 | Ga0097621_100348628 | 3300006237 | Bacteria | 1316 |
| 97 | Ga0068871_100006222 | 3300006358 | Bacteria | 8418 |
| 98 | Ga0075428_100012898 | 3300006844 | Bacteria | 9297 |
| 99 | Ga0075428_100084931 | 3300006844 | Bacteria | 3453 |
| 100 | Ga0075430_100074840 | 3300006846 | Bacteria | 2839 |
| 101 | Ga0075431_100003399 | 3300006847 | Bacteria | 15428 |
| 102 | Ga0075431_100023520 | 3300006847 | Bacteria | 6305 |
| 103 | Ga0075431_100060716 | 3300006847 | Bacteria | 3901 |
| 104 | Ga0075433_10046433 | 3300006852 | Bacteria | 3777 |
| 105 | Ga0075434_100000013 | 3300006871 | Bacteria | 83380 |
| 106 | Ga0075429_100000901 | 3300006880 | Bacteria | 23511 |
| 107 | Ga0075429_100100749 | 3300006880 | Bacteria | 2521 |
| 108 | Ga0068865_100000300 | 3300006881 | Bacteria | 27230 |
| 109 | Ga0075436_100005856 | 3300006914 | Bacteria | 8445 |
| 110 | Ga0075436_100011736 | 3300006914 | Bacteria | 6014 |
| 111 | Ga0075436_100094933 | 3300006914 | Bacteria | 2074 |
| 112 | Ga0075436_100223874 | 3300006914 | Unclassified | 1335 |
| 113 | Ga0097620_100002465 | 3300006931 | Bacteria | 18831 |
| 114 | Ga0097620_100017569 | 3300006931 | Bacteria | 7192 |
| 115 | Ga0097620_100023071 | 3300006931 | Bacteria | 6240 |
| 116 | Ga0097620_100067069 | 3300006931 | Bacteria | 3623 |
| 117 | Ga0075435_100000852 | 3300007076 | Bacteria | 19080 |
| 118 | Ga0075435_100003697 | 3300007076 | Bacteria | 10424 |
| 119 | Ga0075435_100052323 | 3300007076 | Bacteria | 3292 |
| 120 | Ga0099794_10027392 | 3300007265 | Unclassified | 2642 |
| 121 | Ga0105250_10135956 | 3300009092 | Unclassified | 1016 |
| 122 | Ga0111539_10042374 | 3300009094 | Bacteria | 5466 |
| 123 | Ga0111539_10090749 | 3300009094 | Bacteria | 3590 |
| 124 | Ga0111539_10261768 | 3300009094 | Bacteria | 2013 |
| 125 | Ga0105245_10000821 | 3300009098 | Bacteria | 28312 |
| 126 | Ga0105247_10018367 | 3300009101 | Bacteria | 4196 |
| 127 | Ga0114129_10057361 | 3300009147 | Bacteria | 5450 |
| 128 | Ga0114129_10073781 | 3300009147 | Bacteria | 4753 |
| 129 | Ga0114129_10122767 | 3300009147 | Bacteria | 3574 |
| 130 | Ga0114129_10151351 | 3300009147 | Bacteria | 3175 |
| 131 | Ga0105243_10001374 | 3300009148 | Bacteria | 21561 |
| 132 | Ga0105241_10081780 | 3300009174 | Bacteria | 2531 |
| 133 | Ga0105242_10007413 | 3300009176 | Bacteria | 8448 |
| 134 | Ga0105242_10222358 | 3300009176 | Bacteria | 1688 |
| 135 | Ga0105248_10005793 | 3300009177 | Bacteria | 13581 |
| 136 | Ga0105248_10054514 | 3300009177 | Bacteria | 4484 |
| 137 | Ga0105249_10000348 | 3300009553 | Bacteria | 46377 |
| 138 | Ga0105249_10281024 | 3300009553 | Bacteria | 1662 |
| 139 | Ga0105249_10321030 | 3300009553 | Unclassified | 1560 |
| 140 | Ga0105239_10203197 | 3300010375 | Bacteria | 2220 |
| 141 | Ga0157378_10001675 | 3300013297 | Bacteria | 19966 |
| 142 | Ga0163162_10065618 | 3300013306 | Bacteria | 3678 |
| 143 | Ga0163162_10193428 | 3300013306 | Bacteria | 2162 |
| 144 | Ga0157375_10024939 | 3300013308 | Bacteria | 5544 |
| 145 | Ga0157375_10027711 | 3300013308 | Bacteria | 5300 |
| 146 | Ga0157380_10320906 | 3300014326 | Bacteria | 1436 |
| 147 | Ga0157377_10276995 | 3300014745 | Bacteria | 1098 |
| 148 | Ga0157379_10000219 | 3300014968 | Bacteria | 44603 |
| 149 | Ga0157379_10233506 | 3300014968 | Bacteria | 1668 |
| 150 | Ga0207642_10000533 | 3300025899 | Bacteria | 11649 |
| 151 | Ga0207680_10103122 | 3300025903 | Bacteria | 1837 |
| 152 | Ga0207680_10220972 | 3300025903 | Bacteria | 1299 |
| 153 | Ga0207645_10074626 | 3300025907 | Bacteria | 2171 |
| 154 | Ga0207643_10010779 | 3300025908 | Bacteria | 4928 |
| 155 | Ga0207643_10033481 | 3300025908 | Bacteria | 2875 |
| 156 | Ga0207643_10058782 | 3300025908 | Bacteria | 2192 |
| 157 | Ga0207707_10009521 | 3300025912 | Bacteria | 8428 |
| 158 | Ga0207707_10022575 | 3300025912 | Bacteria | 5500 |
| 159 | Ga0207660_10109231 | 3300025917 | Bacteria | 2079 |
| 160 | Ga0207662_10000155 | 3300025918 | Bacteria | 32464 |
| 161 | Ga0207662_10262050 | 3300025918 | Bacteria | 1138 |
| 162 | Ga0207652_10013379 | 3300025921 | Bacteria | 6644 |
| 163 | Ga0207652_10192527 | 3300025921 | Bacteria | 1834 |
| 164 | Ga0207646_10187959 | 3300025922 | Bacteria | 1866 |
| 165 | Ga0207646_10471293 | 3300025922 | Bacteria | 1132 |
| 166 | Ga0207650_10003272 | 3300025925 | Bacteria | 11165 |
| 167 | Ga0207650_10059181 | 3300025925 | Unclassified | 2855 |
| 168 | Ga0207650_10158044 | 3300025925 | Bacteria | 1794 |
| 169 | Ga0207687_10004271 | 3300025927 | Bacteria | 9555 |
| 170 | Ga0207664_10042076 | 3300025929 | Bacteria | 3564 |
| 171 | Ga0207644_10103349 | 3300025931 | Bacteria | 2144 |
| 172 | Ga0207706_10093321 | 3300025933 | Bacteria | 2647 |
| 173 | Ga0207686_10000347 | 3300025934 | Bacteria | 33269 |
| 174 | Ga0207686_10089329 | 3300025934 | Bacteria | 2030 |
| 175 | Ga0207709_10000647 | 3300025935 | Bacteria | 28268 |
| 176 | Ga0207670_10201411 | 3300025936 | Unclassified | 1513 |
| 177 | Ga0207669_10163815 | 3300025937 | Bacteria | 1574 |
| 178 | Ga0207704_10002446 | 3300025938 | Bacteria | 8354 |
| 179 | Ga0207691_10022855 | 3300025940 | Bacteria | 5894 |
| 180 | Ga0207691_10044431 | 3300025940 | Bacteria | 4090 |
| 181 | Ga0207691_10257081 | 3300025940 | Bacteria | 1506 |
| 182 | Ga0207711_10009594 | 3300025941 | Bacteria | 8067 |
| 183 | Ga0207689_10001602 | 3300025942 | Bacteria | 21425 |
| 184 | Ga0207689_10002111 | 3300025942 | Bacteria | 18686 |
| 185 | Ga0207667_10038575 | 3300025949 | Bacteria | 5100 |
| 186 | Ga0207651_10121603 | 3300025960 | Bacteria | 1981 |
| 187 | Ga0207651_10175183 | 3300025960 | Bacteria | 1696 |
| 188 | Ga0207712_10004246 | 3300025961 | Bacteria | 9039 |
| 189 | Ga0207712_10274255 | 3300025961 | Bacteria | 1373 |
| 190 | Ga0207712_10354675 | 3300025961 | Unclassified | 1220 |
| 191 | Ga0207668_10003111 | 3300025972 | Bacteria | 9720 |
| 192 | Ga0207668_10003330 | 3300025972 | Bacteria | 9410 |
| 193 | Ga0207640_10002134 | 3300025981 | Bacteria | 10621 |
| 194 | Ga0207658_10022667 | 3300025986 | Bacteria | 4374 |
| 195 | Ga0207677_10002515 | 3300026023 | Bacteria | 9609 |
| 196 | Ga0207677_10262428 | 3300026023 | Bacteria | 1409 |
| 197 | Ga0207703_10001278 | 3300026035 | Bacteria | 23343 |
| 198 | Ga0207703_10005929 | 3300026035 | Bacteria | 9790 |
| 199 | Ga0207703_10315561 | 3300026035 | Bacteria | 1430 |
| 200 | Ga0207639_10269568 | 3300026041 | Bacteria | 1493 |
| 201 | Ga0207678_10070304 | 3300026067 | Bacteria | 3001 |
| 202 | Ga0207708_10000502 | 3300026075 | Bacteria | 30107 |
| 203 | Ga0207641_10149343 | 3300026088 | Unclassified | 2115 |
| 204 | Ga0207641_10167998 | 3300026088 | Bacteria | 2000 |
| 205 | Ga0207641_10226777 | 3300026088 | Bacteria | 1735 |
| 206 | Ga0207641_10340471 | 3300026088 | Bacteria | 1427 |
| 207 | Ga0207648_10001446 | 3300026089 | Bacteria | 26151 |
| 208 | Ga0207648_10002261 | 3300026089 | Bacteria | 20835 |
| 209 | Ga0207648_10022751 | 3300026089 | Bacteria | 5624 |
| 210 | Ga0207676_10001174 | 3300026095 | Bacteria | 19678 |
| 211 | Ga0207674_10002529 | 3300026116 | Bacteria | 23045 |
| 212 | Ga0207675_100000334 | 3300026118 | Bacteria | 45029 |
| 213 | Ga0207675_100071050 | 3300026118 | Bacteria | 3254 |
| 214 | Ga0207675_100249957 | 3300026118 | Bacteria | 1716 |
| 215 | Ga0207698_10160448 | 3300026142 | Unclassified | 1966 |
| 216 | Ga0207698_10374118 | 3300026142 | Bacteria | 1353 |
| 217 | Ga0209967_1003162 | 3300027364 | Bacteria | 2161 |
| 218 | Ga0209996_1002953 | 3300027395 | Bacteria | 2123 |
| 219 | Ga0209968_1007407 | 3300027526 | Bacteria | 1661 |
| 220 | Ga0209999_1004411 | 3300027543 | Bacteria | 2530 |
| 221 | Ga0207428_10069586 | 3300027907 | Bacteria | 2767 |
| 222 | Ga0207428_10151073 | 3300027907 | Unclassified | 1768 |
| 223 | Ga0268266_10026500 | 3300028379 | Bacteria | 4933 |
| 224 | Ga0268265_10003429 | 3300028380 | Bacteria | 11406 |
| 225 | Ga0268264_10002240 | 3300028381 | Bacteria | 17151 |
| 226 | Ga0307408_100115727 | 3300031548 | Bacteria | 2068 |
| 227 | Ga0307408_100354647 | 3300031548 | Unclassified | 1246 |
| 228 | Ga0307405_10141802 | 3300031731 | Bacteria | 1677 |
| 229 | Ga0307407_10125384 | 3300031903 | Bacteria | 1635 |
| 230 | Ga0307412_10044294 | 3300031911 | Bacteria | 2903 |
| 231 | Ga0307416_100273075 | 3300032002 | Bacteria | 1661 |
| 232 | Ga0307416_100709024 | 3300032002 | Unclassified | 1096 |
| 233 | Ga0307411_10164575 | 3300032005 | Bacteria | 1666 |
| 234 | Ga0373930_0000792 | 3300034816 | Bacteria | 4501 |
| 235 | Ga0373938_0007419 | 3300034957 | Bacteria | 1928 |
| 236 | Ga0373940_0001330 | 3300035088 | Bacteria | 4407 |
| 237 | Ga0373944_0060942 | 3300035089 | Bacteria | 1210 |
| 238 | Ga0373949_0003409 | 3300035090 | Bacteria | 3793 |
| 239 | Ga0373949_0049266 | 3300035090 | Unclassified | 1057 |
| 240 | Ga0373951_0005820 | 3300035091 | Bacteria | 2848 |
| 241 | Ga0373923_0034389 | 3300035111 | Bacteria | 2057 |
| 242 | Ga0373932_0003854 | 3300035112 | Bacteria | 3577 |
| 243 | Ga0373939_0004151 | 3300035114 | Unclassified | 3415 |
| 244 | Ga0373939_0007471 | 3300035114 | Bacteria | 2655 |
| 245 | Ga0373945_0005160 | 3300035116 | Bacteria | 4173 |
| 246 | Ga0373942_0005132 | 3300035207 | Bacteria | 3036 |
| 247 | Ga0373931_0000452 | 3300035691 | Bacteria | 16749 |
| 248 | Ga0373931_0014473 | 3300035691 | Bacteria | 3857 |
| 249 | Ga0373931_0059081 | 3300035691 | Bacteria | 2061 |
| 250 | Ga0373931_0243052 | 3300035691 | Unclassified | 1092 |
| 251 | Ga0373931_0398946 | 3300035691 | Unclassified | 870 |
| 252 | Ga0373927_0010513 | 3300035695 | Bacteria | 6168 |
| 253 | Ga0373933_0220128 | 3300035724 | Bacteria | 1218 |
| 254 | Ga0373947_0146445 | 3300035725 | Bacteria | 1518 |
| 255 | Ga0373937_0129492 | 3300036401 | Bacteria | 2356 |
| 256 | Ga0373925_0219360 | 3300037068 | Bacteria | 1517 |
| 257 | Ga0439439_0029399 | 3300041406 | Bacteria | 1395 |
| 258 | Ga0451807_0017135 | 3300041486 | Bacteria | 2085 |
| 259 | Ga0439443_000328 | 3300042003 | Bacteria | 3958 |
| 260 | Ga0439446_0006978 | 3300042156 | Bacteria | 2960 |
| 261 | Ga0439434_0002530 | 3300042435 | Bacteria | 5322 |
| 262 | Ga0439435_0000038 | 3300042436 | Bacteria | 14468 |
| 263 | Ga0439435_0003248 | 3300042436 | Bacteria | 3358 |
| 264 | Ga0439460_0000260 | 3300042461 | Bacteria | 10871 |
| 265 | Ga0451576_0017056 | 3300045051 | Bacteria | 7992 |
| 266 | Ga0451576_0090466 | 3300045051 | Bacteria | 3183 |
| 267 | Ga0451576_0349708 | 3300045051 | Bacteria | 1547 |
| 268 | Ga0451576_0843273 | 3300045051 | Unclassified | 962 |
| 269 | Ga0495603_0053006 | 3300046455 | Bacteria | 2407 |
| 270 | Ga0495580_0013907 | 3300046472 | Bacteria | 6126 |
| 271 | Ga0495582_0229680 | 3300046473 | Bacteria | 1062 |
| 272 | Ga0495594_0045009 | 3300046499 | Bacteria | 2422 |
| 273 | Ga0495630_0299684 | 3300046517 | Bacteria | 1228 |
| 274 | Ga0495666_0020142 | 3300046526 | Bacteria | 3308 |
| 275 | Ga0495586_0002644 | 3300046535 | Bacteria | 9686 |
| 276 | Ga0495647_0000634 | 3300046681 | Bacteria | 10380 |
| 277 | Ga0495658_0014117 | 3300046683 | Bacteria | 4074 |
| 278 | Ga0495669_0192720 | 3300046684 | Bacteria | 973 |
| 279 | Ga0495676_0032303 | 3300047321 | Bacteria | 4420 |
| 280 | Ga0496102_0020329 | 3300048905 | Bacteria | 5868 |
| 281 | Ga0496114_0620747 | 3300048917 | Bacteria | 952 |
| 282 | Ga0496114_0666457 | 3300048917 | Bacteria | 914 |
| 283 | Ga0501036_0088134 | 3300049572 | Bacteria | 2623 |
| 284 | Ga0501039_0017722 | 3300049575 | Bacteria | 5463 |
| 285 | Ga0501039_0115466 | 3300049575 | Bacteria | 2101 |
| 286 | Ga0501039_0128755 | 3300049575 | Bacteria | 1986 |
| 287 | Ga0501040_0033905 | 3300049576 | Bacteria | 3460 |
| 288 | Ga0501041_0074657 | 3300049577 | Bacteria | 2084 |
| 289 | Ga0501041_0212838 | 3300049577 | Bacteria | 1212 |
| 290 | Ga0501042_0372563 | 3300049578 | Bacteria | 1033 |
| 291 | Ga0501046_0096670 | 3300049580 | Bacteria | 2269 |
| 292 | Ga0501048_0072749 | 3300049582 | Bacteria | 2427 |
| 293 | Ga0501069_0086865 | 3300049585 | Bacteria | 1766 |
| 294 | Ga0501071_0004929 | 3300049587 | Bacteria | 8520 |
| 295 | Ga0501071_0025684 | 3300049587 | Bacteria | 4128 |
| 296 | Ga0501071_0321143 | 3300049587 | Bacteria | 1176 |
| 297 | Ga0501071_0330392 | 3300049587 | Unclassified | 1159 |
| 298 | Ga0501072_0052347 | 3300049588 | Bacteria | 3215 |
| 299 | Ga0501074_0167968 | 3300049590 | Bacteria | 1566 |
| 300 | Ga0501075_0013204 | 3300049591 | Bacteria | 5891 |
| 301 | Ga0501075_0097819 | 3300049591 | Bacteria | 2227 |
| 302 | Ga0501076_0063133 | 3300049592 | Bacteria | 2951 |
| 303 | Ga0501080_0000418 | 3300049742 | Bacteria | 32644 |
| 304 | Ga0501080_0188875 | 3300049742 | Bacteria | 1894 |
| 305 | Ga0501080_0189925 | 3300049742 | Bacteria | 1888 |
| 306 | Ga0501081_0036686 | 3300049743 | Bacteria | 3343 |
| 307 | Ga0501045_0031954 | 3300049824 | Bacteria | 3813 |
| 308 | Ga0501045_0081906 | 3300049824 | Bacteria | 2380 |
| 309 | nmdc:mga05p37_134313_c1 | 3300050507 | Bacteria | 3035 |
| 310 | nmdc:mga05p37_200_c1 | 3300050507 | Bacteria | 59779 |
| 311 | nmdc:mga05p37_38025_c1 | 3300050507 | Bacteria | 5902 |
| 312 | nmdc:mga05p37_78704_c1 | 3300050507 | Bacteria | 4060 |
| 313 | nmdc:mga09592_103887_c1 | 3300050508 | Bacteria | 2435 |
| 314 | nmdc:mga09592_10_c1 | 3300050508 | Bacteria | 106937 |
| 315 | nmdc:mga09592_179019_c1 | 3300050508 | Bacteria | 1834 |
| 316 | nmdc:mga09592_269739_c1 | 3300050508 | Bacteria | 1476 |
| 317 | nmdc:mga09592_328_c1 | 3300050508 | Bacteria | 34777 |
| 318 | nmdc:mga0qj67_199053_c1 | 3300050509 | Bacteria | 1628 |
| 319 | nmdc:mga06r32_355171_c1 | 3300050510 | Bacteria | 1450 |
| 320 | nmdc:mga06r32_41847_c1 | 3300050510 | Bacteria | 4354 |
| 321 | nmdc:mga08y16_11238_c1 | 3300050511 | Bacteria | 9405 |
| 322 | nmdc:mga08y16_117281_c1 | 3300050511 | Bacteria | 2771 |
| 323 | nmdc:mga08y16_15605_c1 | 3300050511 | Bacteria | 7987 |
| 324 | nmdc:mga08y16_251728_c1 | 3300050511 | Bacteria | 1825 |
| 325 | nmdc:mga0n895_46_c1 | 3300050512 | Bacteria | 73853 |
| 326 | nmdc:mga0rr50_1113_c1 | 3300050513 | Bacteria | 14599 |
| 327 | nmdc:mga0rr50_32804_c1 | 3300050513 | Bacteria | 3704 |
| 328 | nmdc:mga08x19_1643_c1 | 3300050514 | Bacteria | 13812 |
| 329 | nmdc:mga08x19_3204_c1 | 3300050514 | Bacteria | 9815 |
| 330 | nmdc:mga08x19_51888_c1 | 3300050514 | Bacteria | 2636 |
| 331 | nmdc:mga08x19_60019_c1 | 3300050514 | Bacteria | 2463 |
| 332 | nmdc:mga0a205_166909_c1 | 3300050515 | Bacteria | 2097 |
| 333 | nmdc:mga0a205_29225_c1 | 3300050515 | Bacteria | 5275 |
| 334 | Ga0530510_0033776 | 3300061734 | Bacteria | 3683 |
| 335 | Ga0530510_0172986 | 3300061734 | Bacteria | 1600 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025960 | Ga0207651_10121603 | Ga0207651_101216032 | 221 |
| 2 | 3300049576 | Ga0501040_0033905 | Ga0501040_0033905_1431_2249 | 243 |
| 3 | 3300049582 | Ga0501048_0072749 | Ga0501048_0072749_640_1458 | 243 |
| 4 | 3300049824 | Ga0501045_0081906 | Ga0501045_0081906_335_1153 | 243 |
| 5 | 3300025908 | Ga0207643_10058782 | Ga0207643_100587822 | 245 |
| 6 | 3300048917 | Ga0496114_0666457 | Ga0496114_0666457_20_898 | 246 |
| 7 | 3300006914 | Ga0075436_100011736 | Ga0075436_1000117366 | 251 |
| 8 | 3300050514 | nmdc:mga08x19_1643_c1 | nmdc:mga08x19_1643_c1_5376_6194 | 251 |
| 9 | 3300005471 | Ga0070698_100040611 | Ga0070698_1000406116 | 255 |
| 10 | 3300006847 | Ga0075431_100023520 | Ga0075431_1000235206 | 255 |
| 11 | 3300006880 | Ga0075429_100000901 | Ga0075429_10000090122 | 255 |
| 12 | 3300005458 | Ga0070681_10000281 | Ga0070681_1000028111 | 259 |
| 13 | 3300005530 | Ga0070679_100073416 | Ga0070679_1000734164 | 259 |
| 14 | 3300005545 | Ga0070695_100009787 | Ga0070695_1000097874 | 259 |
| 15 | 3300005546 | Ga0070696_100281085 | Ga0070696_1002810852 | 259 |
| 16 | 3300025912 | Ga0207707_10009521 | Ga0207707_100095214 | 259 |
| 17 | 3300025917 | Ga0207660_10109231 | Ga0207660_101092313 | 259 |
| 18 | 3300025921 | Ga0207652_10192527 | Ga0207652_101925272 | 259 |
| 19 | 3300026088 | Ga0207641_10167998 | Ga0207641_101679982 | 259 |
| 20 | 3300035691 | Ga0373931_0014473 | Ga0373931_0014473_606_1388 | 260 |
| 21 | 3300049575 | Ga0501039_0017722 | Ga0501039_0017722_2498_3340 | 261 |
| 22 | 3300049577 | Ga0501041_0212838 | Ga0501041_0212838_93_935 | 261 |
| 23 | 3300049587 | Ga0501071_0004929 | Ga0501071_0004929_3311_4153 | 261 |
| 24 | 3300049742 | Ga0501080_0000418 | Ga0501080_0000418_5699_6541 | 261 |
| 25 | 3300005330 | Ga0070690_100000497 | Ga0070690_10000049715 | 262 |
| 26 | 3300005334 | Ga0068869_100002100 | Ga0068869_1000021005 | 262 |
| 27 | 3300005335 | Ga0070666_10153687 | Ga0070666_101536872 | 262 |
| 28 | 3300005336 | Ga0070680_100001571 | Ga0070680_1000015714 | 262 |
| 29 | 3300005337 | Ga0070682_100016604 | Ga0070682_1000166042 | 262 |
| 30 | 3300005338 | Ga0068868_100004467 | Ga0068868_1000044676 | 262 |
| 31 | 3300005340 | Ga0070689_100009090 | Ga0070689_1000090903 | 262 |
| 32 | 3300005341 | Ga0070691_10001745 | Ga0070691_100017457 | 262 |
| 33 | 3300005343 | Ga0070687_100000268 | Ga0070687_1000002686 | 262 |
| 34 | 3300005345 | Ga0070692_10000432 | Ga0070692_1000043211 | 262 |
| 35 | 3300005355 | Ga0070671_100153948 | Ga0070671_1001539483 | 262 |
| 36 | 3300005356 | Ga0070674_100253865 | Ga0070674_1002538652 | 262 |
| 37 | 3300005438 | Ga0070701_10000083 | Ga0070701_1000008320 | 262 |
| 38 | 3300005440 | Ga0070705_100000645 | Ga0070705_1000006453 | 262 |
| 39 | 3300005441 | Ga0070700_100000249 | Ga0070700_10000024920 | 262 |
| 40 | 3300005444 | Ga0070694_100000382 | Ga0070694_1000003827 | 262 |
| 41 | 3300005458 | Ga0070681_10030881 | Ga0070681_100308814 | 262 |
| 42 | 3300005459 | Ga0068867_100000534 | Ga0068867_10000053420 | 262 |
| 43 | 3300005530 | Ga0070679_100007368 | Ga0070679_10000736811 | 262 |
| 44 | 3300005539 | Ga0068853_100260598 | Ga0068853_1002605983 | 262 |
| 45 | 3300005544 | Ga0070686_100000299 | Ga0070686_1000002997 | 262 |
| 46 | 3300005545 | Ga0070695_100000816 | Ga0070695_1000008168 | 262 |
| 47 | 3300005546 | Ga0070696_100002955 | Ga0070696_1000029559 | 262 |
| 48 | 3300005547 | Ga0070693_100000281 | Ga0070693_1000002817 | 262 |
| 49 | 3300005549 | Ga0070704_100000420 | Ga0070704_10000042020 | 262 |
| 50 | 3300005563 | Ga0068855_100002028 | Ga0068855_10000202820 | 262 |
| 51 | 3300005578 | Ga0068854_100003188 | Ga0068854_1000031889 | 262 |
| 52 | 3300005615 | Ga0070702_100004547 | Ga0070702_1000045474 | 262 |
| 53 | 3300005617 | Ga0068859_100017570 | Ga0068859_1000175704 | 262 |
| 54 | 3300005718 | Ga0068866_10000506 | Ga0068866_1000050613 | 262 |
| 55 | 3300005719 | Ga0068861_100000192 | Ga0068861_1000001928 | 262 |
| 56 | 3300005840 | Ga0068870_10095825 | Ga0068870_100958252 | 262 |
| 57 | 3300005842 | Ga0068858_100005818 | Ga0068858_10000581811 | 262 |
| 58 | 3300005843 | Ga0068860_100002610 | Ga0068860_1000026107 | 262 |
| 59 | 3300005844 | Ga0068862_100005986 | Ga0068862_1000059869 | 262 |
| 60 | 3300006237 | Ga0097621_100004557 | Ga0097621_10000455712 | 262 |
| 61 | 3300006358 | Ga0068871_100006222 | Ga0068871_1000062225 | 262 |
| 62 | 3300006881 | Ga0068865_100000300 | Ga0068865_10000030012 | 262 |
| 63 | 3300006931 | Ga0097620_100017569 | Ga0097620_1000175694 | 262 |
| 64 | 3300009092 | Ga0105250_10135956 | Ga0105250_101359561 | 262 |
| 65 | 3300009098 | Ga0105245_10000821 | Ga0105245_1000082118 | 262 |
| 66 | 3300009148 | Ga0105243_10001374 | Ga0105243_1000137413 | 262 |
| 67 | 3300009174 | Ga0105241_10081780 | Ga0105241_100817803 | 262 |
| 68 | 3300009176 | Ga0105242_10007413 | Ga0105242_100074139 | 262 |
| 69 | 3300009553 | Ga0105249_10000348 | Ga0105249_1000034840 | 262 |
| 70 | 3300010375 | Ga0105239_10203197 | Ga0105239_102031973 | 262 |
| 71 | 3300013297 | Ga0157378_10001675 | Ga0157378_1000167515 | 262 |
| 72 | 3300014745 | Ga0157377_10276995 | Ga0157377_102769952 | 262 |
| 73 | 3300014968 | Ga0157379_10233506 | Ga0157379_102335062 | 262 |
| 74 | 3300025899 | Ga0207642_10000533 | Ga0207642_100005339 | 262 |
| 75 | 3300025903 | Ga0207680_10103122 | Ga0207680_101031223 | 262 |
| 76 | 3300025908 | Ga0207643_10033481 | Ga0207643_100334813 | 262 |
| 77 | 3300025912 | Ga0207707_10022575 | Ga0207707_100225754 | 262 |
| 78 | 3300025918 | Ga0207662_10000155 | Ga0207662_1000015525 | 262 |
| 79 | 3300025921 | Ga0207652_10013379 | Ga0207652_100133793 | 262 |
| 80 | 3300025927 | Ga0207687_10004271 | Ga0207687_100042717 | 262 |
| 81 | 3300025931 | Ga0207644_10103349 | Ga0207644_101033493 | 262 |
| 82 | 3300025933 | Ga0207706_10093321 | Ga0207706_100933213 | 262 |
| 83 | 3300025934 | Ga0207686_10000347 | Ga0207686_100003474 | 262 |
| 84 | 3300025935 | Ga0207709_10000647 | Ga0207709_100006477 | 262 |
| 85 | 3300025937 | Ga0207669_10163815 | Ga0207669_101638153 | 262 |
| 86 | 3300025938 | Ga0207704_10002446 | Ga0207704_100024469 | 262 |
| 87 | 3300025942 | Ga0207689_10002111 | Ga0207689_1000211113 | 262 |
| 88 | 3300025949 | Ga0207667_10038575 | Ga0207667_100385757 | 262 |
| 89 | 3300025961 | Ga0207712_10004246 | Ga0207712_100042464 | 262 |
| 90 | 3300025981 | Ga0207640_10002134 | Ga0207640_100021347 | 262 |
| 91 | 3300026023 | Ga0207677_10002515 | Ga0207677_100025153 | 262 |
| 92 | 3300026035 | Ga0207703_10005929 | Ga0207703_100059293 | 262 |
| 93 | 3300026041 | Ga0207639_10269568 | Ga0207639_102695683 | 262 |
| 94 | 3300026075 | Ga0207708_10000502 | Ga0207708_100005027 | 262 |
| 95 | 3300026088 | Ga0207641_10340471 | Ga0207641_103404712 | 262 |
| 96 | 3300026089 | Ga0207648_10001446 | Ga0207648_1000144620 | 262 |
| 97 | 3300026118 | Ga0207675_100000334 | Ga0207675_10000033426 | 262 |
| 98 | 3300028380 | Ga0268265_10003429 | Ga0268265_100034298 | 262 |
| 99 | 3300035089 | Ga0373944_0060942 | Ga0373944_0060942_191_982 | 262 |
| 100 | 3300035090 | Ga0373949_0049266 | Ga0373949_0049266_253_1044 | 262 |
| 101 | 3300035111 | Ga0373923_0034389 | Ga0373923_0034389_293_1084 | 262 |
| 102 | 3300035114 | Ga0373939_0007471 | Ga0373939_0007471_1843_2634 | 262 |
| 103 | 3300035116 | Ga0373945_0005160 | Ga0373945_0005160_2880_3671 | 262 |
| 104 | 3300035691 | Ga0373931_0059081 | Ga0373931_0059081_928_1719 | 262 |
| 105 | 3300035691 | Ga0373931_0398946 | Ga0373931_0398946_15_806 | 262 |
| 106 | 3300035695 | Ga0373927_0010513 | Ga0373927_0010513_4886_5677 | 262 |
| 107 | 3300035725 | Ga0373947_0146445 | Ga0373947_0146445_498_1289 | 262 |
| 108 | 3300037068 | Ga0373925_0219360 | Ga0373925_0219360_338_1129 | 262 |
| 109 | 3300045051 | Ga0451576_0090466 | Ga0451576_0090466_2031_2822 | 262 |
| 110 | 3300046455 | Ga0495603_0053006 | Ga0495603_0053006_222_1013 | 262 |
| 111 | 3300046472 | Ga0495580_0013907 | Ga0495580_0013907_3190_3981 | 262 |
| 112 | 3300046473 | Ga0495582_0229680 | Ga0495582_0229680_123_914 | 262 |
| 113 | 3300046499 | Ga0495594_0045009 | Ga0495594_0045009_1145_1936 | 262 |
| 114 | 3300046517 | Ga0495630_0299684 | Ga0495630_0299684_234_1025 | 262 |
| 115 | 3300046526 | Ga0495666_0020142 | Ga0495666_0020142_982_1773 | 262 |
| 116 | 3300046535 | Ga0495586_0002644 | Ga0495586_0002644_2360_3151 | 262 |
| 117 | 3300046681 | Ga0495647_0000634 | Ga0495647_0000634_7730_8521 | 262 |
| 118 | 3300046683 | Ga0495658_0014117 | Ga0495658_0014117_2215_3006 | 262 |
| 119 | 3300047321 | Ga0495676_0032303 | Ga0495676_0032303_1319_2110 | 262 |
| 120 | 3300048917 | Ga0496114_0620747 | Ga0496114_0620747_134_925 | 262 |
| 121 | 3300005444 | Ga0070694_100022921 | Ga0070694_1000229212 | 263 |
| 122 | 3300006914 | Ga0075436_100005856 | Ga0075436_1000058564 | 263 |
| 123 | 3300049580 | Ga0501046_0096670 | Ga0501046_0096670_590_1432 | 263 |
| 124 | 3300049591 | Ga0501075_0013204 | Ga0501075_0013204_108_950 | 263 |
| 125 | 3300049743 | Ga0501081_0036686 | Ga0501081_0036686_825_1667 | 263 |
| 126 | 3300050513 | nmdc:mga0rr50_32804_c1 | nmdc:mga0rr50_32804_c1_1420_2214 | 263 |
| 127 | 3300050514 | nmdc:mga08x19_3204_c1 | nmdc:mga08x19_3204_c1_4643_5437 | 263 |
| 128 | 3300061734 | Ga0530510_0033776 | Ga0530510_0033776_2049_2891 | 263 |
| 129 | 3300005546 | Ga0070696_100006964 | Ga0070696_1000069643 | 264 |
| 130 | 3300005549 | Ga0070704_100322452 | Ga0070704_1003224522 | 264 |
| 131 | 3300031903 | Ga0307407_10125384 | Ga0307407_101253841 | 265 |
| 132 | 3300032005 | Ga0307411_10164575 | Ga0307411_101645751 | 265 |
| 133 | 3300049587 | Ga0501071_0025684 | Ga0501071_0025684_2897_3694 | 265 |
| 134 | 3300005549 | Ga0070704_100002847 | Ga0070704_1000028476 | 267 |
| 135 | 3300006844 | Ga0075428_100084931 | Ga0075428_1000849314 | 267 |
| 136 | 3300007265 | Ga0099794_10027392 | Ga0099794_100273924 | 267 |
| 137 | 3300009147 | Ga0114129_10057361 | Ga0114129_100573615 | 267 |
| 138 | 3300025922 | Ga0207646_10471293 | Ga0207646_104712931 | 267 |
| 139 | 3300031548 | Ga0307408_100115727 | Ga0307408_1001157271 | 267 |
| 140 | 3300031731 | Ga0307405_10141802 | Ga0307405_101418021 | 267 |
| 141 | 3300041486 | Ga0451807_0017135 | Ga0451807_0017135_1074_1913 | 267 |
| 142 | 3300050507 | nmdc:mga05p37_78704_c1 | nmdc:mga05p37_78704_c1_824_1657 | 267 |
| 143 | 3300050508 | nmdc:mga09592_328_c1 | nmdc:mga09592_328_c1_14848_15681 | 267 |
| 144 | 3300005341 | Ga0070691_10105959 | Ga0070691_101059592 | 269 |
| 145 | 3300005440 | Ga0070705_100196203 | Ga0070705_1001962031 | 269 |
| 146 | 3300005444 | Ga0070694_100101742 | Ga0070694_1001017423 | 269 |
| 147 | 3300005545 | Ga0070695_100217744 | Ga0070695_1002177442 | 269 |
| 148 | 3300005549 | Ga0070704_100115214 | Ga0070704_1001152143 | 269 |
| 149 | 3300009094 | Ga0111539_10042374 | Ga0111539_100423746 | 269 |
| 150 | 3300014326 | Ga0157380_10320906 | Ga0157380_103209061 | 269 |
| 151 | 3300027907 | Ga0207428_10069586 | Ga0207428_100695863 | 269 |
| 152 | 3300050508 | nmdc:mga09592_179019_c1 | nmdc:mga09592_179019_c1_41_853 | 269 |
| 153 | 3300050511 | nmdc:mga08y16_15605_c1 | nmdc:mga08y16_15605_c1_687_1499 | 269 |
| 154 | 3300005544 | Ga0070686_100426761 | Ga0070686_1004267612 | 270 |
| 155 | 3300005547 | Ga0070693_100265755 | Ga0070693_1002657551 | 270 |
| 156 | 3300006847 | Ga0075431_100003399 | Ga0075431_10000339916 | 270 |
| 157 | 3300006852 | Ga0075433_10046433 | Ga0075433_100464332 | 270 |
| 158 | 3300006914 | Ga0075436_100223874 | Ga0075436_1002238742 | 270 |
| 159 | 3300007076 | Ga0075435_100003697 | Ga0075435_10000369710 | 270 |
| 160 | 3300035691 | Ga0373931_0243052 | Ga0373931_0243052_59_874 | 270 |
| 161 | 3300049742 | Ga0501080_0188875 | Ga0501080_0188875_187_999 | 270 |
| 162 | 3300050510 | nmdc:mga06r32_41847_c1 | nmdc:mga06r32_41847_c1_1439_2251 | 270 |
| 163 | 3300050514 | nmdc:mga08x19_51888_c1 | nmdc:mga08x19_51888_c1_1533_2348 | 270 |
| 164 | 3300050515 | nmdc:mga0a205_166909_c1 | nmdc:mga0a205_166909_c1_278_1093 | 270 |
| 165 | 3300050515 | nmdc:mga0a205_29225_c1 | nmdc:mga0a205_29225_c1_3299_4114 | 270 |
| 166 | 3300006844 | Ga0075428_100012898 | Ga0075428_1000128987 | 271 |
| 167 | 3300006880 | Ga0075429_100100749 | Ga0075429_1001007492 | 271 |
| 168 | 3300009147 | Ga0114129_10073781 | Ga0114129_100737815 | 271 |
| 169 | 3300049575 | Ga0501039_0128755 | Ga0501039_0128755_430_1245 | 271 |
| 170 | 3300049577 | Ga0501041_0074657 | Ga0501041_0074657_66_881 | 271 |
| 171 | 3300049587 | Ga0501071_0330392 | Ga0501071_0330392_230_1048 | 271 |
| 172 | 3300049742 | Ga0501080_0189925 | Ga0501080_0189925_995_1810 | 271 |
| 173 | 3300050507 | nmdc:mga05p37_38025_c1 | nmdc:mga05p37_38025_c1_2413_3231 | 271 |
| 174 | 3300050508 | nmdc:mga09592_103887_c1 | nmdc:mga09592_103887_c1_1503_2321 | 271 |
| 175 | 3300005545 | Ga0070695_100226385 | Ga0070695_1002263852 | 272 |
| 176 | 3300006871 | Ga0075434_100000013 | Ga0075434_10000001366 | 272 |
| 177 | 3300006914 | Ga0075436_100094933 | Ga0075436_1000949333 | 272 |
| 178 | 3300007076 | Ga0075435_100000852 | Ga0075435_1000008525 | 272 |
| 179 | 3300009147 | Ga0114129_10122767 | Ga0114129_101227672 | 272 |
| 180 | 3300009147 | Ga0114129_10151351 | Ga0114129_101513513 | 272 |
| 181 | 3300031548 | Ga0307408_100354647 | Ga0307408_1003546472 | 272 |
| 182 | 3300032002 | Ga0307416_100709024 | Ga0307416_1007090242 | 272 |
| 183 | 3300041406 | Ga0439439_0029399 | Ga0439439_0029399_182_1000 | 272 |
| 184 | 3300042156 | Ga0439446_0006978 | Ga0439446_0006978_1699_2517 | 272 |
| 185 | 3300042435 | Ga0439434_0002530 | Ga0439434_0002530_834_1652 | 272 |
| 186 | 3300042436 | Ga0439435_0003248 | Ga0439435_0003248_977_1795 | 272 |
| 187 | 3300045051 | Ga0451576_0843273 | Ga0451576_0843273_108_932 | 272 |
| 188 | 3300049572 | Ga0501036_0088134 | Ga0501036_0088134_462_1310 | 272 |
| 189 | 3300049575 | Ga0501039_0115466 | Ga0501039_0115466_512_1360 | 272 |
| 190 | 3300049590 | Ga0501074_0167968 | Ga0501074_0167968_335_1183 | 272 |
| 191 | 3300049591 | Ga0501075_0097819 | Ga0501075_0097819_724_1572 | 272 |
| 192 | 3300049592 | Ga0501076_0063133 | Ga0501076_0063133_662_1510 | 272 |
| 193 | 3300049824 | Ga0501045_0031954 | Ga0501045_0031954_1351_2199 | 272 |
| 194 | 3300050507 | nmdc:mga05p37_134313_c1 | nmdc:mga05p37_134313_c1_179_1000 | 272 |
| 195 | 3300050512 | nmdc:mga0n895_46_c1 | nmdc:mga0n895_46_c1_1851_2687 | 272 |
| 196 | 3300050513 | nmdc:mga0rr50_1113_c1 | nmdc:mga0rr50_1113_c1_1031_1867 | 272 |
| 197 | 3300061734 | Ga0530510_0172986 | Ga0530510_0172986_482_1330 | 272 |
| 198 | 3300005336 | Ga0070680_100111580 | Ga0070680_1001115803 | 273 |
| 199 | 3300005345 | Ga0070692_10035049 | Ga0070692_100350492 | 273 |
| 200 | 3300005347 | Ga0070668_100233705 | Ga0070668_1002337052 | 273 |
| 201 | 3300005435 | Ga0070714_100056577 | Ga0070714_1000565774 | 273 |
| 202 | 3300005444 | Ga0070694_100006472 | Ga0070694_1000064727 | 273 |
| 203 | 3300005444 | Ga0070694_100034603 | Ga0070694_1000346033 | 273 |
| 204 | 3300005455 | Ga0070663_100133321 | Ga0070663_1001333212 | 273 |
| 205 | 3300005518 | Ga0070699_100321171 | Ga0070699_1003211712 | 273 |
| 206 | 3300005545 | Ga0070695_100073265 | Ga0070695_1000732653 | 273 |
| 207 | 3300005719 | Ga0068861_100204624 | Ga0068861_1002046242 | 273 |
| 208 | 3300005985 | Ga0081539_10001221 | Ga0081539_1000122125 | 273 |
| 209 | 3300006846 | Ga0075430_100074840 | Ga0075430_1000748405 | 273 |
| 210 | 3300007076 | Ga0075435_100052323 | Ga0075435_1000523233 | 273 |
| 211 | 3300025929 | Ga0207664_10042076 | Ga0207664_100420764 | 273 |
| 212 | 3300025940 | Ga0207691_10044431 | Ga0207691_100444315 | 273 |
| 213 | 3300026023 | Ga0207677_10262428 | Ga0207677_102624282 | 273 |
| 214 | 3300026067 | Ga0207678_10070304 | Ga0207678_100703042 | 273 |
| 215 | 3300026089 | Ga0207648_10022751 | Ga0207648_100227515 | 273 |
| 216 | 3300026118 | Ga0207675_100249957 | Ga0207675_1002499572 | 273 |
| 217 | 3300026142 | Ga0207698_10374118 | Ga0207698_103741182 | 273 |
| 218 | 3300027526 | Ga0209968_1007407 | Ga0209968_10074073 | 273 |
| 219 | 3300031911 | Ga0307412_10044294 | Ga0307412_100442943 | 273 |
| 220 | 3300032002 | Ga0307416_100273075 | Ga0307416_1002730753 | 273 |
| 221 | 3300036401 | Ga0373937_0129492 | Ga0373937_0129492_990_1814 | 273 |
| 222 | 3300042003 | Ga0439443_000328 | Ga0439443_000328_672_1496 | 273 |
| 223 | 3300042436 | Ga0439435_0000038 | Ga0439435_0000038_2004_2828 | 273 |
| 224 | 3300042461 | Ga0439460_0000260 | Ga0439460_0000260_9326_10150 | 273 |
| 225 | 3300049585 | Ga0501069_0086865 | Ga0501069_0086865_832_1656 | 273 |
| 226 | 3300049587 | Ga0501071_0321143 | Ga0501071_0321143_55_879 | 273 |
| 227 | 3300049588 | Ga0501072_0052347 | Ga0501072_0052347_1588_2412 | 273 |
| 228 | 3300050508 | nmdc:mga09592_269739_c1 | nmdc:mga09592_269739_c1_477_1301 | 273 |
| 229 | 3300050509 | nmdc:mga0qj67_199053_c1 | nmdc:mga0qj67_199053_c1_192_1016 | 273 |
| 230 | 3300050514 | nmdc:mga08x19_60019_c1 | nmdc:mga08x19_60019_c1_669_1493 | 273 |
| 231 | 3300035724 | Ga0373933_0220128 | Ga0373933_0220128_110_937 | 274 |
| 232 | 3300046684 | Ga0495669_0192720 | Ga0495669_0192720_26_859 | 274 |
| 233 | 3300005340 | Ga0070689_100199007 | Ga0070689_1001990072 | 275 |
| 234 | 3300005355 | Ga0070671_100024708 | Ga0070671_1000247082 | 275 |
| 235 | 3300005471 | Ga0070698_100146687 | Ga0070698_1001466873 | 275 |
| 236 | 3300005543 | Ga0070672_100087553 | Ga0070672_1000875533 | 275 |
| 237 | 3300005546 | Ga0070696_100049778 | Ga0070696_1000497782 | 275 |
| 238 | 3300005617 | Ga0068859_100023069 | Ga0068859_1000230694 | 275 |
| 239 | 3300005618 | Ga0068864_100585884 | Ga0068864_1005858841 | 275 |
| 240 | 3300005844 | Ga0068862_100402189 | Ga0068862_1004021892 | 275 |
| 241 | 3300006237 | Ga0097621_100348628 | Ga0097621_1003486281 | 275 |
| 242 | 3300006847 | Ga0075431_100060716 | Ga0075431_1000607165 | 275 |
| 243 | 3300006931 | Ga0097620_100023071 | Ga0097620_1000230717 | 275 |
| 244 | 3300009094 | Ga0111539_10090749 | Ga0111539_100907494 | 275 |
| 245 | 3300009094 | Ga0111539_10261768 | Ga0111539_102617684 | 275 |
| 246 | 3300009177 | Ga0105248_10054514 | Ga0105248_100545141 | 275 |
| 247 | 3300009553 | Ga0105249_10321030 | Ga0105249_103210302 | 275 |
| 248 | 3300013306 | Ga0163162_10193428 | Ga0163162_101934282 | 275 |
| 249 | 3300013308 | Ga0157375_10024939 | Ga0157375_100249395 | 275 |
| 250 | 3300013308 | Ga0157375_10027711 | Ga0157375_100277115 | 275 |
| 251 | 3300025903 | Ga0207680_10220972 | Ga0207680_102209722 | 275 |
| 252 | 3300025922 | Ga0207646_10187959 | Ga0207646_101879593 | 275 |
| 253 | 3300025925 | Ga0207650_10158044 | Ga0207650_101580442 | 275 |
| 254 | 3300025936 | Ga0207670_10201411 | Ga0207670_102014113 | 275 |
| 255 | 3300025940 | Ga0207691_10022855 | Ga0207691_100228551 | 275 |
| 256 | 3300025940 | Ga0207691_10257081 | Ga0207691_102570811 | 275 |
| 257 | 3300025960 | Ga0207651_10175183 | Ga0207651_101751832 | 275 |
| 258 | 3300025961 | Ga0207712_10354675 | Ga0207712_103546751 | 275 |
| 259 | 3300025972 | Ga0207668_10003111 | Ga0207668_100031115 | 275 |
| 260 | 3300025986 | Ga0207658_10022667 | Ga0207658_100226672 | 275 |
| 261 | 3300026035 | Ga0207703_10315561 | Ga0207703_103155612 | 275 |
| 262 | 3300026088 | Ga0207641_10226777 | Ga0207641_102267772 | 275 |
| 263 | 3300026142 | Ga0207698_10160448 | Ga0207698_101604483 | 275 |
| 264 | 3300027907 | Ga0207428_10151073 | Ga0207428_101510732 | 275 |
| 265 | 3300028379 | Ga0268266_10026500 | Ga0268266_100265004 | 275 |
| 266 | 3300035114 | Ga0373939_0004151 | Ga0373939_0004151_1816_2673 | 275 |
| 267 | 3300045051 | Ga0451576_0017056 | Ga0451576_0017056_668_1525 | 275 |
| 268 | 3300050511 | nmdc:mga08y16_117281_c1 | nmdc:mga08y16_117281_c1_525_1382 | 275 |
| 269 | 3300050511 | nmdc:mga08y16_251728_c1 | nmdc:mga08y16_251728_c1_795_1625 | 275 |
| 270 | 3300005331 | Ga0070670_100326090 | Ga0070670_1003260901 | 276 |
| 271 | 3300005347 | Ga0070668_100009967 | Ga0070668_1000099674 | 276 |
| 272 | 3300005544 | Ga0070686_100409523 | Ga0070686_1004095231 | 276 |
| 273 | 3300005617 | Ga0068859_100067069 | Ga0068859_1000670694 | 276 |
| 274 | 3300005844 | Ga0068862_100328736 | Ga0068862_1003287361 | 276 |
| 275 | 3300006931 | Ga0097620_100067069 | Ga0097620_1000670694 | 276 |
| 276 | 3300025925 | Ga0207650_10059181 | Ga0207650_100591812 | 276 |
| 277 | 3300025972 | Ga0207668_10003330 | Ga0207668_100033303 | 276 |
| 278 | 3300049578 | Ga0501042_0372563 | Ga0501042_0372563_185_1021 | 277 |
| 279 | 3300005615 | Ga0070702_100381638 | Ga0070702_1003816382 | 278 |
| 280 | 3300009176 | Ga0105242_10222358 | Ga0105242_102223582 | 278 |
| 281 | 3300025934 | Ga0207686_10089329 | Ga0207686_100893291 | 278 |
| 282 | 3300027364 | Ga0209967_1003162 | Ga0209967_10031622 | 278 |
| 283 | 3300027395 | Ga0209996_1002953 | Ga0209996_10029532 | 278 |
| 284 | 3300027543 | Ga0209999_1004411 | Ga0209999_10044113 | 278 |
| 285 | 3300025941 | Ga0207711_10009594 | Ga0207711_100095945 | 280 |
| 286 | 3300034816 | Ga0373930_0000792 | Ga0373930_0000792_199_1149 | 282 |
| 287 | 3300034957 | Ga0373938_0007419 | Ga0373938_0007419_593_1543 | 282 |
| 288 | 3300035088 | Ga0373940_0001330 | Ga0373940_0001330_3269_4219 | 282 |
| 289 | 3300035090 | Ga0373949_0003409 | Ga0373949_0003409_1816_2766 | 282 |
| 290 | 3300035091 | Ga0373951_0005820 | Ga0373951_0005820_859_1809 | 282 |
| 291 | 3300035112 | Ga0373932_0003854 | Ga0373932_0003854_862_1812 | 282 |
| 292 | 3300035207 | Ga0373942_0005132 | Ga0373942_0005132_1232_2182 | 282 |
| 293 | 3300035691 | Ga0373931_0000452 | Ga0373931_0000452_1915_2865 | 282 |
| 294 | 3300045051 | Ga0451576_0349708 | Ga0451576_0349708_203_1153 | 282 |
| 295 | 3300050507 | nmdc:mga05p37_200_c1 | nmdc:mga05p37_200_c1_32654_33604 | 282 |
| 296 | 3300050508 | nmdc:mga09592_10_c1 | nmdc:mga09592_10_c1_79812_80762 | 282 |
| 297 | 3300050510 | nmdc:mga06r32_355171_c1 | nmdc:mga06r32_355171_c1_198_1148 | 282 |
| 298 | 3300050511 | nmdc:mga08y16_11238_c1 | nmdc:mga08y16_11238_c1_5618_6568 | 282 |
| 299 | 3300005328 | Ga0070676_10066422 | Ga0070676_100664223 | 285 |
| 300 | 3300005331 | Ga0070670_100004995 | Ga0070670_1000049956 | 285 |
| 301 | 3300005334 | Ga0068869_100003023 | Ga0068869_1000030238 | 285 |
| 302 | 3300005340 | Ga0070689_100128926 | Ga0070689_1001289262 | 285 |
| 303 | 3300005343 | Ga0070687_100169842 | Ga0070687_1001698421 | 285 |
| 304 | 3300005353 | Ga0070669_100039985 | Ga0070669_1000399851 | 285 |
| 305 | 3300005364 | Ga0070673_100017095 | Ga0070673_1000170953 | 285 |
| 306 | 3300005459 | Ga0068867_100001706 | Ga0068867_10000170610 | 285 |
| 307 | 3300005549 | Ga0070704_100367231 | Ga0070704_1003672312 | 285 |
| 308 | 3300005564 | Ga0070664_100421110 | Ga0070664_1004211101 | 285 |
| 309 | 3300005577 | Ga0068857_100003057 | Ga0068857_10000305712 | 285 |
| 310 | 3300005617 | Ga0068859_100002465 | Ga0068859_10000246512 | 285 |
| 311 | 3300005618 | Ga0068864_100013535 | Ga0068864_1000135354 | 285 |
| 312 | 3300005840 | Ga0068870_10008856 | Ga0068870_100088563 | 285 |
| 313 | 3300005841 | Ga0068863_100024732 | Ga0068863_1000247325 | 285 |
| 314 | 3300005842 | Ga0068858_100010718 | Ga0068858_1000107187 | 285 |
| 315 | 3300005843 | Ga0068860_100003281 | Ga0068860_1000032816 | 285 |
| 316 | 3300006931 | Ga0097620_100002465 | Ga0097620_10000246512 | 285 |
| 317 | 3300009101 | Ga0105247_10018367 | Ga0105247_100183672 | 285 |
| 318 | 3300009177 | Ga0105248_10005793 | Ga0105248_100057937 | 285 |
| 319 | 3300009553 | Ga0105249_10281024 | Ga0105249_102810242 | 285 |
| 320 | 3300013306 | Ga0163162_10065618 | Ga0163162_100656183 | 285 |
| 321 | 3300014968 | Ga0157379_10000219 | Ga0157379_1000021921 | 285 |
| 322 | 3300025907 | Ga0207645_10074626 | Ga0207645_100746263 | 285 |
| 323 | 3300025908 | Ga0207643_10010779 | Ga0207643_100107795 | 285 |
| 324 | 3300025918 | Ga0207662_10262050 | Ga0207662_102620502 | 285 |
| 325 | 3300025925 | Ga0207650_10003272 | Ga0207650_100032726 | 285 |
| 326 | 3300025942 | Ga0207689_10001602 | Ga0207689_100016028 | 285 |
| 327 | 3300025961 | Ga0207712_10274255 | Ga0207712_102742552 | 285 |
| 328 | 3300026035 | Ga0207703_10001278 | Ga0207703_1000127811 | 285 |
| 329 | 3300026088 | Ga0207641_10149343 | Ga0207641_101493432 | 285 |
| 330 | 3300026089 | Ga0207648_10002261 | Ga0207648_1000226110 | 285 |
| 331 | 3300026095 | Ga0207676_10001174 | Ga0207676_1000117411 | 285 |
| 332 | 3300026116 | Ga0207674_10002529 | Ga0207674_1000252916 | 285 |
| 333 | 3300026118 | Ga0207675_100071050 | Ga0207675_1000710502 | 285 |
| 334 | 3300028381 | Ga0268264_10002240 | Ga0268264_1000224011 | 285 |
| 335 | 3300048905 | Ga0496102_0020329 | Ga0496102_0020329_648_1505 | 285 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5vxc-assembly1.cif.gz_A | crystal structure analysis of human clybl in complex with free coash | 0.9227 | 13 | 284 |
| 1sgj-assembly1.cif.gz_C | crystal structure of citrate lyase beta subunit | 0.9076 | 13 | 234 |
| 3qll-assembly1.cif.gz_A | crystal structure of ripc from yersinia pestis | 0.9037 | 12 | 240 |
| 4l9z-assembly1.cif.gz_A | crystal structure of rhodobacter sphaeroides malyl-coa lyase in complex with magnesium, oxalate, and coa | 0.9028 | 12 | 285 |
| 3qll-assembly1.cif.gz_A | crystal structure of ripc from yersinia pestis | 0.8917 | 12 | 240 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IAX5_410_529_1.20.1220.12 | Mainly Alpha;Up-down Bundle;Malate Synthase G; Chain: A; Domain 4;Malate synthase, domain III | 0.9498 | 240 | 280 | 1.20.1220.12 |
| af_Q1JPT8_41_343_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9379 | 13 | 282 | 3.20.20.60 |
| af_Q93167_15_324_3.20.20.60 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.911 | 8 | 284 | 3.20.20.60 |
| 3qllC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.9065 | 12 | 240 | 3.20.20.60 |
| 3qllC00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains | 0.8943 | 12 | 240 | 3.20.20.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2E6QJV7-F1-model_v4 | CoA ester lyase | 0.9724 | 16 | 284 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A7C5LTA7-F1-model_v4 | CoA ester lyase | 0.9682 | 11 | 244 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A220RJM3-F1-model_v4 | deleted | 0.9605 | 16 | 237 |
|
| AF-A0A2V6RC67-F1-model_v4 | CoA ester lyase | 0.9513 | 11 | 284 |
GO:0000287
GO:0006107 GO:0016829 |
| AF-A0A7Z9INP7-F1-model_v4 | CoA ester lyase | 0.9513 | 14 | 284 |
GO:0000287
GO:0006107 GO:0016829 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar