F412290

General Info

Members Datasets Scaffolds Average Seq Length
335 228 668 297

Family's Representative Sequence

Representative Sequence 3300028653|Ga0265323_10048565|Ga0265323_100485651
Length 347
Sequence MDVNSNGLPAENGKPNGTQRRLLDHEFVTNAISRSAENPTDRRRFMRRAGLAGLGVVAAGALASAGPGMAAAATTRDQGDAGEISDSAILNFALNLEYLEANFYSFAVHGAPIPGSLMTGTGTQGGISGGSQVPFKTQGIKQLAQEIAGDELAHVTFLRSALGSTAVSQPAIDLVKSFTAAAQAAGAVPAGTAFDPFANEEYFLLGAFIFEDVGVTAYKGAAPLISSKTYLDAAAGILSVEAYHAGAVRTRIYDLGLSDLANKISAARGALDDGKDVGVTVNGAENIVPSDANGLAYGRTPGEVLNIVYLTPKVTTSGGFFPDGVNGVLNTSGTAGAEGVQPDETAS

Samples

Sample ID Description Type Environment
1 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
50 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
61 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
104 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
105 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
106 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
107 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
113 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
116 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
117 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
118 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
119 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
120 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
121 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
122 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
128 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
134 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
135 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
141 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
145 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
175 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
176 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
181 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
184 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
200 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
201 2728369276 Kineococcus rhizosphaerae DSM 19711 Isolate Rhizosphere
202 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
203 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
204 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
205 2829745981 Methylorubrum rhodinum DSM 2163 Isolate Rhizosphere
206 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
207 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
208 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
209 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
210 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
211 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
212 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
213 2858882152 Micromonospora noduli MED15 Isolate Nodule
214 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
215 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
216 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
217 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
218 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
219 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
220 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
221 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
222 2915358134 Pseudonocardia pini CAP47R Isolate Unclassified
223 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
224 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
225 2956939328 Lolliginicoccus suaedae LNNU 331112 Isolate Rhizosphere
226 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
227 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
228 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 77.31
Metatranscriptomes 12.54
Isolates 10.15

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.37
Nodule 0.6
Rhizoplane 5.07
Rhizosphere 78.51
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265323_10048565 3300028653 Bacteria 1514
2 rootH2_10184943 3300003320 Bacteria 6208
3 Ga0055539_1004705 3300003752 Bacteria 1807
4 Ga0058862_10261107 3300004803 Bacteria 1681
5 Ga0070683_100032382 3300005329 Bacteria 4761
6 Ga0070683_100069947 3300005329 Bacteria 3273
7 Ga0068869_100281777 3300005334 Bacteria 1337
8 Ga0070680_100104985 3300005336 Bacteria 2348
9 Ga0070680_100136539 3300005336 Bacteria 2055
10 Ga0070682_100073068 3300005337 Bacteria 2199
11 Ga0070682_100120625 3300005337 Bacteria 1760
12 Ga0068868_100008574 3300005338 Bacteria 7321
13 Ga0068868_100032810 3300005338 Bacteria 3996
14 Ga0070660_100060345 3300005339 Bacteria 2943
15 Ga0070689_100085171 3300005340 Bacteria 2485
16 Ga0070668_100020728 3300005347 Bacteria 4964
17 Ga0070675_100013524 3300005354 Bacteria 6415
18 Ga0070673_100264609 3300005364 Bacteria 1503
19 Ga0070659_100004429 3300005366 Bacteria 10031
20 Ga0070659_100046349 3300005366 Bacteria 3408
21 Ga0070709_10008202 3300005434 Bacteria 5735
22 Ga0070709_10115617 3300005434 Bacteria 1810
23 Ga0070714_100006566 3300005435 Bacteria 8998
24 Ga0070714_100014942 3300005435 Bacteria 6241
25 Ga0070714_100057859 3300005435 Bacteria 3319
26 Ga0070714_100104774 3300005435 Bacteria 2496
27 Ga0070713_100027809 3300005436 Bacteria 4458
28 Ga0070711_100018798 3300005439 Bacteria 4419
29 Ga0070711_100104880 3300005439 Bacteria 2063
30 Ga0070700_100208276 3300005441 Bacteria 1378
31 Ga0070663_100111337 3300005455 Bacteria 2057
32 Ga0070678_100306986 3300005456 Bacteria 1350
33 Ga0070681_10105065 3300005458 Bacteria 2766
34 Ga0070681_10285215 3300005458 Bacteria 1562
35 Ga0068867_100481667 3300005459 Bacteria 1063
36 Ga0070679_100058727 3300005530 Bacteria 3833
37 Ga0070679_100066356 3300005530 Bacteria 3597
38 Ga0070679_100154431 3300005530 Bacteria 2271
39 Ga0070679_100165828 3300005530 Bacteria 2182
40 Ga0070679_100317681 3300005530 Bacteria 1507
41 Ga0070684_100101129 3300005535 Bacteria 2575
42 Ga0070684_100141876 3300005535 Bacteria 2172
43 Ga0070684_100449486 3300005535 Bacteria 1191
44 Ga0070693_100234358 3300005547 Bacteria 1209
45 Ga0068855_100190912 3300005563 Bacteria 2311
46 Ga0068855_100441769 3300005563 Bacteria 1421
47 Ga0070664_100014725 3300005564 Bacteria 6387
48 Ga0068857_100077893 3300005577 Bacteria 2958
49 Ga0068856_100286079 3300005614 Bacteria 1665
50 Ga0070702_100043002 3300005615 Bacteria 2543
51 Ga0068852_100035820 3300005616 Bacteria 4144
52 Ga0068861_100166702 3300005719 Bacteria 1822
53 Ga0068870_10034581 3300005840 Bacteria 2586
54 Ga0068863_100065714 3300005841 Bacteria 3431
55 Ga0070717_10006592 3300006028 Bacteria 8552
56 Ga0070717_10095839 3300006028 Bacteria 2512
57 Ga0075365_10004847 3300006038 Bacteria 7185
58 Ga0075363_100079845 3300006048 Bacteria 1788
59 Ga0070716_100011325 3300006173 Bacteria 4491
60 Ga0070716_100062687 3300006173 Bacteria 2156
61 Ga0070716_100262289 3300006173 Bacteria 1183
62 Ga0070712_100006798 3300006175 Bacteria 7117
63 Ga0070712_100199295 3300006175 Bacteria 1571
64 Ga0075370_10216033 3300006353 Bacteria 1133
65 Ga0068871_100104694 3300006358 Bacteria 2373
66 Ga0075428_100325314 3300006844 Bacteria 1652
67 Ga0075431_100430473 3300006847 Bacteria 1318
68 Ga0075436_100001371 3300006914 Bacteria 16587
69 Ga0075436_100399349 3300006914 Bacteria 996
70 Ga0105240_10278000 3300009093 Bacteria 1924
71 Ga0105240_10305140 3300009093 Bacteria 1820
72 Ga0105245_10168973 3300009098 Bacteria 2081
73 Ga0105245_10295061 3300009098 Bacteria 1589
74 Ga0105243_10121079 3300009148 Bacteria 2206
75 Ga0157371_10049494 3300013102 Bacteria 2985
76 Ga0157371_10129472 3300013102 Bacteria 1795
77 Ga0157370_10033984 3300013104 Bacteria 4968
78 Ga0157370_10246680 3300013104 Bacteria 1652
79 Ga0157369_10297138 3300013105 Bacteria 1680
80 Ga0157374_10117869 3300013296 Bacteria 2559
81 Ga0157374_10329426 3300013296 Bacteria 1514
82 Ga0157372_10116591 3300013307 Bacteria 3062
83 Ga0157372_10438214 3300013307 Bacteria 1523
84 Ga0157372_10871591 3300013307 Bacteria 1045
85 Ga0163163_10128762 3300014325 Bacteria 2570
86 Ga0157379_10461471 3300014968 Bacteria 1174
87 Ga0197907_10017609 3300020069 Bacteria 1332
88 Ga0197907_11378359 3300020069 Bacteria 1556
89 Ga0206356_10053459 3300020070 Bacteria 1250
90 Ga0206356_10494914 3300020070 Bacteria 1773
91 Ga0206356_10988974 3300020070 Bacteria 1527
92 Ga0206349_1776383 3300020075 Bacteria 1185
93 Ga0206355_1246916 3300020076 Bacteria 1240
94 Ga0206351_10814592 3300020077 Bacteria 1405
95 Ga0206352_10146919 3300020078 Bacteria 1254
96 Ga0206352_10590381 3300020078 Bacteria 1440
97 Ga0206352_11222250 3300020078 Bacteria 1262
98 Ga0206350_10543205 3300020080 Bacteria 1462
99 Ga0206350_10622609 3300020080 Bacteria 1803
100 Ga0206350_11013778 3300020080 Bacteria 1211
101 Ga0206354_10185102 3300020081 Bacteria 2956
102 Ga0206354_10891497 3300020081 Bacteria 3189
103 Ga0206353_10427632 3300020082 Bacteria 2841
104 Ga0213876_10007406 3300021384 Bacteria 5967
105 Ga0224712_10008254 3300022467 Bacteria 3076
106 Ga0224712_10026039 3300022467 Bacteria 2063
107 Ga0224712_10039626 3300022467 Bacteria 1767
108 Ga0224712_10072972 3300022467 Bacteria 1399
109 Ga0224712_10134695 3300022467 Bacteria 1082
110 Ga0209677_100452 3300025253 Bacteria 23791
111 Ga0207688_10028528 3300025901 Bacteria 3070
112 Ga0207647_10099787 3300025904 Bacteria 1724
113 Ga0207647_10186370 3300025904 Bacteria 1203
114 Ga0207699_10010084 3300025906 Bacteria 4726
115 Ga0207699_10089628 3300025906 Bacteria 1928
116 Ga0207643_10000112 3300025908 Bacteria 55805
117 Ga0207705_10008296 3300025909 Bacteria 7587
118 Ga0207707_10011564 3300025912 Bacteria 7685
119 Ga0207707_10015538 3300025912 Bacteria 6630
120 Ga0207693_10016330 3300025915 Bacteria 5935
121 Ga0207663_10084699 3300025916 Bacteria 2085
122 Ga0207660_10096194 3300025917 Bacteria 2204
123 Ga0207657_10089019 3300025919 Bacteria 2579
124 Ga0207649_10348223 3300025920 Bacteria 1096
125 Ga0207652_10066917 3300025921 Bacteria 3115
126 Ga0207652_10079798 3300025921 Bacteria 2859
127 Ga0207650_10045825 3300025925 Bacteria 3218
128 Ga0207659_10116238 3300025926 Bacteria 2042
129 Ga0207687_10101030 3300025927 Bacteria 2123
130 Ga0207687_10190139 3300025927 Bacteria 1597
131 Ga0207700_10017876 3300025928 Bacteria 4747
132 Ga0207700_10034360 3300025928 Bacteria 3639
133 Ga0207700_10129746 3300025928 Bacteria 2056
134 Ga0207664_10005161 3300025929 Bacteria 8901
135 Ga0207664_10013338 3300025929 Bacteria 5895
136 Ga0207664_10317339 3300025929 Bacteria 1374
137 Ga0207664_10469517 3300025929 Bacteria 1125
138 Ga0207644_10020698 3300025931 Bacteria 4476
139 Ga0207690_10254013 3300025932 Bacteria 1359
140 Ga0207665_10016049 3300025939 Bacteria 4919
141 Ga0207665_10023096 3300025939 Bacteria 4097
142 Ga0207665_10202865 3300025939 Bacteria 1446
143 Ga0207689_10007730 3300025942 Bacteria 9409
144 Ga0207661_10104948 3300025944 Bacteria 2380
145 Ga0207661_10284514 3300025944 Bacteria 1478
146 Ga0207679_10211069 3300025945 Bacteria 1628
147 Ga0207679_10501385 3300025945 Bacteria 1083
148 Ga0207667_10045381 3300025949 Bacteria 4655
149 Ga0207667_10388781 3300025949 Bacteria 1421
150 Ga0207668_10037759 3300025972 Bacteria 3235
151 Ga0207677_10012220 3300026023 Bacteria 4926
152 Ga0207703_10572364 3300026035 Bacteria 1067
153 Ga0207678_10000340 3300026067 Bacteria 42133
154 Ga0207678_10004165 3300026067 Bacteria 12981
155 Ga0207678_10078734 3300026067 Bacteria 2823
156 Ga0207678_10081613 3300026067 Bacteria 2768
157 Ga0207708_10013723 3300026075 Bacteria 6053
158 Ga0207702_10014884 3300026078 Bacteria 6453
159 Ga0207702_10119640 3300026078 Bacteria 2355
160 Ga0207702_10236628 3300026078 Bacteria 1709
161 Ga0207641_10015653 3300026088 Bacteria 6215
162 Ga0207648_10515753 3300026089 Bacteria 1095
163 Ga0207674_10139848 3300026116 Bacteria 2381
164 Ga0207674_10150877 3300026116 Bacteria 2281
165 Ga0268264_10626893 3300028381 Bacteria 1062
166 Ga0265326_10003756 3300028558 Bacteria 4953
167 Ga0307515_10013728 3300028794 Bacteria 15095
168 Ga0265338_10007189 3300028800 Bacteria 13923
169 Ga0307509_10216110 3300031507 Bacteria 1736
170 Ga0307518_10002271 3300031838 Bacteria 14063
171 Ga0307507_10029407 3300033179 Bacteria 5826
172 Ga0307507_10102961 3300033179 Bacteria 2378
173 Ga0373933_0430903 3300035724 Bacteria 862
174 Ga0373937_0268165 3300036401 Bacteria 1611
175 Ga0395900_0009425 3300037418 Bacteria 10007
176 Ga0395900_0290708 3300037418 Bacteria 1623
177 Ga0395898_0083756 3300037466 Bacteria 3074
178 Ga0436364_0103531 3300037853 Bacteria 1943
179 Ga0436364_0183141 3300037853 Bacteria 23094
180 Ga0395901_0388879 3300038443 Bacteria 1434
181 Ga0436365_0887380 3300039437 Bacteria 42160
182 Ga0439448_0012463 3300042005 Bacteria 2545
183 Ga0439463_070483 3300042016 Bacteria 896
184 Ga0439458_0037474 3300042157 Bacteria 1169
185 Ga0466972_0008064 3300044658 Bacteria 5278
186 Ga0466966_0166814 3300044684 Bacteria 1339
187 Ga0466963_0093120 3300044694 Bacteria 2054
188 Ga0466970_0223626 3300044765 Bacteria 1051
189 Ga0466970_0270845 3300044765 Bacteria 954
190 Ga0466967_0023417 3300045976 Bacteria 5059
191 Ga0466967_0321351 3300045976 Unclassified 1493
192 Ga0466967_0418306 3300045976 Bacteria 1306
193 Ga0495629_0034479 3300046459 Bacteria 3578
194 Ga0495638_0028828 3300046460 Bacteria 3582
195 Ga0495641_0018260 3300046461 Bacteria 3623
196 Ga0495653_0019905 3300046463 Bacteria 5440
197 Ga0495653_0059028 3300046463 Bacteria 2914
198 Ga0495653_0070842 3300046463 Bacteria 2608
199 Ga0495653_0126292 3300046463 Bacteria 1816
200 Ga0495650_0033623 3300046471 Bacteria 2280
201 Ga0495639_0120762 3300046475 Bacteria 1250
202 Ga0495664_0114519 3300046477 Bacteria 1629
203 Ga0495664_0203592 3300046477 Bacteria 1199
204 Ga0495628_0077007 3300046516 Bacteria 2595
205 Ga0495628_0116509 3300046516 Bacteria 2052
206 Ga0495630_0209640 3300046517 Bacteria 1487
207 Ga0495652_0020940 3300046529 Bacteria 5812
208 Ga0495665_0084518 3300046531 Bacteria 1668
209 Ga0495640_0044112 3300046533 Bacteria 3102
210 Ga0495587_0031818 3300046536 Bacteria 3192
211 Ga0495635_0115381 3300046663 Bacteria 1833
212 Ga0495657_0064227 3300046675 Bacteria 2419
213 Ga0495657_0135697 3300046675 Bacteria 1537
214 Ga0495599_0062380 3300046678 Bacteria 2329
215 Ga0495646_0075672 3300046680 Bacteria 1973
216 Ga0495680_0042770 3300047322 Bacteria 3592
217 Ga0495680_0137942 3300047322 Bacteria 1787
218 Ga0495675_0133238 3300047444 Bacteria 1544
219 Ga0495684_0111385 3300047471 Bacteria 2065
220 Ga0495684_0147526 3300047471 Bacteria 1761
221 Ga0495602_0081428 3300048088 Bacteria 2722
222 Ga0496101_0279921 3300048904 Bacteria 1303
223 Ga0496102_0499088 3300048905 Bacteria 1139
224 Ga0496104_0058855 3300048907 Bacteria 3637
225 Ga0496104_0206715 3300048907 Bacteria 1875
226 Ga0496105_0172726 3300048908 Bacteria 1771
227 Ga0496105_0284910 3300048908 Bacteria 1331
228 Ga0496106_0038820 3300048909 Bacteria 3565
229 Ga0496108_0014615 3300048911 Bacteria 6408
230 Ga0496108_0209454 3300048911 Bacteria 1692
231 Ga0496110_0053876 3300048913 Bacteria 3537
232 Ga0496111_0108545 3300048914 Bacteria 2043
233 Ga0496112_0206127 3300048915 Bacteria 1924
234 Ga0496113_0410937 3300048916 Bacteria 1087
235 Ga0496113_0530064 3300048916 Bacteria 945
236 Ga0496114_0056933 3300048917 Bacteria 3263
237 Ga0496115_0042636 3300048918 Bacteria 3615
238 Ga0496115_0292023 3300048918 Bacteria 1337
239 Ga0496123_0167361 3300048926 Bacteria 1164
240 Ga0496126_0024870 3300048929 Bacteria 5774
241 Ga0501031_0029580 3300049568 Bacteria 3573
242 Ga0501033_0007438 3300049570 Bacteria 8531
243 Ga0501033_0009677 3300049570 Bacteria 7412
244 Ga0501033_0020978 3300049570 Bacteria 4933
245 Ga0501034_0050064 3300049571 Bacteria 4214
246 Ga0501034_0105866 3300049571 Bacteria 2805
247 Ga0501036_0051420 3300049572 Bacteria 3488
248 Ga0501038_0012844 3300049574 Bacteria 7644
249 Ga0501039_0005588 3300049575 Bacteria 9517
250 Ga0501042_0110295 3300049578 Bacteria 1981
251 Ga0501043_0013129 3300049579 Bacteria 6477
252 Ga0501046_0092978 3300049580 Bacteria 2318
253 Ga0501047_0005562 3300049581 Bacteria 11863
254 Ga0501047_0013551 3300049581 Bacteria 7731
255 Ga0501047_0054659 3300049581 Bacteria 3862
256 Ga0501048_0075036 3300049582 Bacteria 2385
257 Ga0501073_0085081 3300049589 Bacteria 2200
258 Ga0501080_0061869 3300049742 Bacteria 3484
259 Ga0501080_0663125 3300049742 Bacteria 922
260 Ga0501035_0006807 3300049822 Bacteria 10679
261 Ga0501035_0016292 3300049822 Bacteria 6856
262 Ga0501035_0020101 3300049822 Bacteria 6133
263 Ga0501035_0282552 3300049822 Bacteria 1402
264 Ga0501044_0027036 3300049823 Bacteria 6069
265 Ga0501044_0032328 3300049823 Bacteria 5501
266 nmdc:mga00v17_101411_c1 3300050491 Bacteria 1817
267 nmdc:mga0yw44_387_c1 3300050492 Bacteria 15325
268 nmdc:mga07m45_210228_c1 3300050496 Bacteria 1132
269 nmdc:mga05p37_377826_c1 3300050507 Bacteria 1661
270 nmdc:mga08y16_133190_c1 3300050511 Bacteria 2584
271 nmdc:mga0n895_192851_c1 3300050512 Bacteria 2068
272 Ga0500608_033481 3300053122 Bacteria 2445
273 Ga0500559_0001185 3300053136 Bacteria 15537
274 Ga0500559_0001973 3300053136 Bacteria 11061
275 Ga0500559_0155624 3300053136 Bacteria 1073
276 Ga0500573_0000173 3300053140 Bacteria 26169
277 Ga0500573_0015628 3300053140 Bacteria 4305
278 Ga0500573_0069276 3300053140 Bacteria 2013
279 Ga0500573_0151910 3300053140 Bacteria 1267
280 Ga0500616_0015615 3300053153 Bacteria 4337
281 Ga0500616_0038276 3300053153 Bacteria 2591
282 Ga0587066_006490 3300059490 Bacteria 1547
283 Ga0587066_006947 3300059490 Bacteria 1515
284 Ga0587070_024302 3300059491 Bacteria 1047
285 Ga0587073_0006593 3300059492 Bacteria 1795
286 Ga0587073_0011195 3300059492 Bacteria 1526
287 Ga0587073_0030986 3300059492 Bacteria 1104
288 Ga0587077_026470 3300059493 Bacteria 1071
289 Ga0587082_004825 3300059504 Bacteria 1718
290 Ga0587083_0005870 3300059505 Bacteria 1799
291 Ga0587086_012547 3300059507 Bacteria 1055
292 Ga0587090_007287 3300059510 Bacteria 1449
293 Ga0587094_012256 3300059513 Bacteria 1142
294 Ga0587122_002309 3300059628 Bacteria 1362
295 Ga0587128_007145 3300059630 Bacteria 1400
296 Ga0587062_009607 3300059639 Bacteria 1182
297 Ga0587067_005914 3300059640 Bacteria 1681
298 Ga0587067_019586 3300059640 Bacteria 1148
299 Ga0587075_006770 3300059644 Bacteria 1418
300 Ga0587111_0011652 3300060346 Bacteria 1537
301 2586059731 2585427649 Bacteria 9053857
302 2586062667 2585427649 Bacteria 9053857
303 2623590289 2622736626 Bacteria 7181580
304 2729905137 2728369276 Bacteria 5610032
305 2729909721 2728369276 Bacteria 5610032
306 2760307679 2758568522 Bacteria 5953541
307 2809588153 2808606522 Bacteria 9488490
308 2809591245 2808606522 Bacteria 9488490
309 2816508340 2816332139 Bacteria 9138787
310 2829747828 2829745981 Bacteria 5406054
311 2844845039 2844841374 Bacteria 3917147
312 2844855005 2844852863 Bacteria 3849151
313 2855675719 2855670206 Bacteria 7120389
314 2855677405 2855676851 Bacteria 7063653
315 2857293011 2857288857 Bacteria 7189066
316 2857486029 2857481737 Bacteria 4761446
317 2857486141 2857481737 Bacteria 4761446
318 2858853246 2858848962 Bacteria 6963058
319 2858883114 2858882152 Bacteria 7230291
320 2858891530 2858888857 Bacteria 7060307
321 2858901632 2858895516 Bacteria 7378898
322 2862996649 2862993130 Bacteria 3860849
323 2867314778 2867312974 Bacteria 7058875
324 2867322209 2867319477 Bacteria 7069771
325 2869055133 2869048445 Bacteria 6875584
326 2869068433 2869061728 Bacteria 7112407
327 2869071978 2869068681 Bacteria 7205615
328 2915360246 2915358134 Bacteria 6050864
329 2915773676 2915768154 Bacteria 8424322
330 2929222615 2929219909 Bacteria 6984360
331 2956941459 2956939328 Bacteria 3474458
332 2966923031 2966921586 Bacteria 3092803
333 2966924769 2966924647 Bacteria 3268643
334 8003317903 8003314358 Bacteria 10575343
335 Ga0265323_10048565
336 rootH2_10184943
337 Ga0055539_1004705
338 Ga0058862_10261107
339 Ga0070683_100032382
340 Ga0070683_100069947
341 Ga0068869_100281777
342 Ga0070680_100104985
343 Ga0070680_100136539
344 Ga0070682_100073068
345 Ga0070682_100120625
346 Ga0068868_100008574
347 Ga0068868_100032810
348 Ga0070660_100060345
349 Ga0070689_100085171
350 Ga0070668_100020728
351 Ga0070675_100013524
352 Ga0070673_100264609
353 Ga0070659_100004429
354 Ga0070659_100046349
355 Ga0070709_10008202
356 Ga0070709_10115617
357 Ga0070714_100006566
358 Ga0070714_100014942
359 Ga0070714_100057859
360 Ga0070714_100104774
361 Ga0070713_100027809
362 Ga0070711_100018798
363 Ga0070711_100104880
364 Ga0070700_100208276
365 Ga0070663_100111337
366 Ga0070678_100306986
367 Ga0070681_10105065
368 Ga0070681_10285215
369 Ga0068867_100481667
370 Ga0070679_100058727
371 Ga0070679_100066356
372 Ga0070679_100154431
373 Ga0070679_100165828
374 Ga0070679_100317681
375 Ga0070684_100101129
376 Ga0070684_100141876
377 Ga0070684_100449486
378 Ga0070693_100234358
379 Ga0068855_100190912
380 Ga0068855_100441769
381 Ga0070664_100014725
382 Ga0068857_100077893
383 Ga0068856_100286079
384 Ga0070702_100043002
385 Ga0068852_100035820
386 Ga0068861_100166702
387 Ga0068870_10034581
388 Ga0068863_100065714
389 Ga0070717_10006592
390 Ga0070717_10095839
391 Ga0075365_10004847
392 Ga0075363_100079845
393 Ga0070716_100011325
394 Ga0070716_100062687
395 Ga0070716_100262289
396 Ga0070712_100006798
397 Ga0070712_100199295
398 Ga0075370_10216033
399 Ga0068871_100104694
400 Ga0075428_100325314
401 Ga0075431_100430473
402 Ga0075436_100001371
403 Ga0075436_100399349
404 Ga0105240_10278000
405 Ga0105240_10305140
406 Ga0105245_10168973
407 Ga0105245_10295061
408 Ga0105243_10121079
409 Ga0157371_10049494
410 Ga0157371_10129472
411 Ga0157370_10033984
412 Ga0157370_10246680
413 Ga0157369_10297138
414 Ga0157374_10117869
415 Ga0157374_10329426
416 Ga0157372_10116591
417 Ga0157372_10438214
418 Ga0157372_10871591
419 Ga0163163_10128762
420 Ga0157379_10461471
421 Ga0197907_10017609
422 Ga0197907_11378359
423 Ga0206356_10053459
424 Ga0206356_10494914
425 Ga0206356_10988974
426 Ga0206349_1776383
427 Ga0206355_1246916
428 Ga0206351_10814592
429 Ga0206352_10146919
430 Ga0206352_10590381
431 Ga0206352_11222250
432 Ga0206350_10543205
433 Ga0206350_10622609
434 Ga0206350_11013778
435 Ga0206354_10185102
436 Ga0206354_10891497
437 Ga0206353_10427632
438 Ga0213876_10007406
439 Ga0224712_10008254
440 Ga0224712_10026039
441 Ga0224712_10039626
442 Ga0224712_10072972
443 Ga0224712_10134695
444 Ga0209677_100452
445 Ga0207688_10028528
446 Ga0207647_10099787
447 Ga0207647_10186370
448 Ga0207699_10010084
449 Ga0207699_10089628
450 Ga0207643_10000112
451 Ga0207705_10008296
452 Ga0207707_10011564
453 Ga0207707_10015538
454 Ga0207693_10016330
455 Ga0207663_10084699
456 Ga0207660_10096194
457 Ga0207657_10089019
458 Ga0207649_10348223
459 Ga0207652_10066917
460 Ga0207652_10079798
461 Ga0207650_10045825
462 Ga0207659_10116238
463 Ga0207687_10101030
464 Ga0207687_10190139
465 Ga0207700_10017876
466 Ga0207700_10034360
467 Ga0207700_10129746
468 Ga0207664_10005161
469 Ga0207664_10013338
470 Ga0207664_10317339
471 Ga0207664_10469517
472 Ga0207644_10020698
473 Ga0207690_10254013
474 Ga0207665_10016049
475 Ga0207665_10023096
476 Ga0207665_10202865
477 Ga0207689_10007730
478 Ga0207661_10104948
479 Ga0207661_10284514
480 Ga0207679_10211069
481 Ga0207679_10501385
482 Ga0207667_10045381
483 Ga0207667_10388781
484 Ga0207668_10037759
485 Ga0207677_10012220
486 Ga0207703_10572364
487 Ga0207678_10000340
488 Ga0207678_10004165
489 Ga0207678_10078734
490 Ga0207678_10081613
491 Ga0207708_10013723
492 Ga0207702_10014884
493 Ga0207702_10119640
494 Ga0207702_10236628
495 Ga0207641_10015653
496 Ga0207648_10515753
497 Ga0207674_10139848
498 Ga0207674_10150877
499 Ga0268264_10626893
500 Ga0265326_10003756
501 Ga0307515_10013728
502 Ga0265338_10007189
503 Ga0307509_10216110
504 Ga0307518_10002271
505 Ga0307507_10029407
506 Ga0307507_10102961
507 Ga0373933_0430903
508 Ga0373937_0268165
509 Ga0395900_0009425
510 Ga0395900_0290708
511 Ga0395898_0083756
512 Ga0436364_0103531
513 Ga0436364_0183141
514 Ga0395901_0388879
515 Ga0436365_0887380
516 Ga0439448_0012463
517 Ga0439463_070483
518 Ga0439458_0037474
519 Ga0466972_0008064
520 Ga0466966_0166814
521 Ga0466963_0093120
522 Ga0466970_0223626
523 Ga0466970_0270845
524 Ga0466967_0023417
525 Ga0466967_0321351
526 Ga0466967_0418306
527 Ga0495629_0034479
528 Ga0495638_0028828
529 Ga0495641_0018260
530 Ga0495653_0019905
531 Ga0495653_0059028
532 Ga0495653_0070842
533 Ga0495653_0126292
534 Ga0495650_0033623
535 Ga0495639_0120762
536 Ga0495664_0114519
537 Ga0495664_0203592
538 Ga0495628_0077007
539 Ga0495628_0116509
540 Ga0495630_0209640
541 Ga0495652_0020940
542 Ga0495665_0084518
543 Ga0495640_0044112
544 Ga0495587_0031818
545 Ga0495635_0115381
546 Ga0495657_0064227
547 Ga0495657_0135697
548 Ga0495599_0062380
549 Ga0495646_0075672
550 Ga0495680_0042770
551 Ga0495680_0137942
552 Ga0495675_0133238
553 Ga0495684_0111385
554 Ga0495684_0147526
555 Ga0495602_0081428
556 Ga0496101_0279921
557 Ga0496102_0499088
558 Ga0496104_0058855
559 Ga0496104_0206715
560 Ga0496105_0172726
561 Ga0496105_0284910
562 Ga0496106_0038820
563 Ga0496108_0014615
564 Ga0496108_0209454
565 Ga0496110_0053876
566 Ga0496111_0108545
567 Ga0496112_0206127
568 Ga0496113_0410937
569 Ga0496113_0530064
570 Ga0496114_0056933
571 Ga0496115_0042636
572 Ga0496115_0292023
573 Ga0496123_0167361
574 Ga0496126_0024870
575 Ga0501031_0029580
576 Ga0501033_0007438
577 Ga0501033_0009677
578 Ga0501033_0020978
579 Ga0501034_0050064
580 Ga0501034_0105866
581 Ga0501036_0051420
582 Ga0501038_0012844
583 Ga0501039_0005588
584 Ga0501042_0110295
585 Ga0501043_0013129
586 Ga0501046_0092978
587 Ga0501047_0005562
588 Ga0501047_0013551
589 Ga0501047_0054659
590 Ga0501048_0075036
591 Ga0501073_0085081
592 Ga0501080_0061869
593 Ga0501080_0663125
594 Ga0501035_0006807
595 Ga0501035_0016292
596 Ga0501035_0020101
597 Ga0501035_0282552
598 Ga0501044_0027036
599 Ga0501044_0032328
600 nmdc:mga00v17_101411_c1
601 nmdc:mga0yw44_387_c1
602 nmdc:mga07m45_210228_c1
603 nmdc:mga05p37_377826_c1
604 nmdc:mga08y16_133190_c1
605 nmdc:mga0n895_192851_c1
606 Ga0500608_033481
607 Ga0500559_0001185
608 Ga0500559_0001973
609 Ga0500559_0155624
610 Ga0500573_0000173
611 Ga0500573_0015628
612 Ga0500573_0069276
613 Ga0500573_0151910
614 Ga0500616_0015615
615 Ga0500616_0038276
616 Ga0587066_006490
617 Ga0587066_006947
618 Ga0587070_024302
619 Ga0587073_0006593
620 Ga0587073_0011195
621 Ga0587073_0030986
622 Ga0587077_026470
623 Ga0587082_004825
624 Ga0587083_0005870
625 Ga0587086_012547
626 Ga0587090_007287
627 Ga0587094_012256
628 Ga0587122_002309
629 Ga0587128_007145
630 Ga0587062_009607
631 Ga0587067_005914
632 Ga0587067_019586
633 Ga0587075_006770
634 Ga0587111_0011652
635 2586059731
636 2586062667
637 2623590289
638 2729905137
639 2729909721
640 2760307679
641 2809588153
642 2809591245
643 2816508340
644 2829747828
645 2844845039
646 2844855005
647 2855675719
648 2855677405
649 2857293011
650 2857486029
651 2857486141
652 2858853246
653 2858883114
654 2858891530
655 2858901632
656 2862996649
657 2867314778
658 2867322209
659 2869055133
660 2869068433
661 2869071978
662 2915360246
663 2915773676
664 2929222615
665 2956941459
666 2966923031
667 2966924769
668 8003317903

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13668

Ferritin_2

Ferritin-like domain

85

254

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.8228 50 228
2ib0-assembly1.cif.gz_B crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.7885 50 228
2ib0-assembly1.cif.gz_A crystal structure of a conserved hypothetical protein, rv2844, from mycobacterium tuberculosis 0.7849 50 228
7xa0-assembly1.cif.gz_A-2 thermotoga maritima ferritin variant-tm-e(s111f) 0.7556 43 228
8pv9-assembly1.cif.gz_A structure of dps determined by cryoem at 100 kev 0.7534 50 227
ID Description Score Start End Superfamily
af_A0A0R0I378_34_190_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8544 48 228 1.20.1260.10
af_A0A0R0I378_34_190_1.20.1260.10 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8342 48 228 1.20.1260.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.8228 50 228 1.20.1260.10
2ib0B00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7885 50 228 1.20.1260.10
2ib0A01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.7776 50 232 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A351AAG2-F1-model_v4 Ferritin-like domain-containing protein 0.9656 94 320
AF-A0A351AAG2-F1-model_v4 Ferritin-like domain-containing protein 0.9565 94 320
AF-A0A2Z3G4T5-F1-model_v4 deleted 0.9403 48 320
AF-A0A2Z3G4T5-F1-model_v4 deleted 0.9366 48 320
AF-A0A1G8L2S6-F1-model_v4 Ferritin-like domain-containing protein 0.9342 114 320

Map