F412248

General Info

Members Datasets Scaffolds Average Seq Length
335 194 670 156

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_11084883|Ga0163163_110848832
Length 192
Sequence MGEICNQVQRCVETSVASPGARGWLQRLASSARLGAMQGHPEIIEVLNDVLTAELTAINEYFVDAKMFQNWGYERLAKRFRDESIDEMKDADELIERILYLEGVPNLQRLGTVRVGETPVEKFHLALELEAAAIPRLNNGIAKCVELGDNGSRDMLEEILEGEEAHADWLEAQLELIRQIGDAAYLSQQIHA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
15 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
22 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
23 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
31 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
38 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
53 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
54 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
55 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
58 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
59 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
92 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
93 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
94 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
99 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
100 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
103 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
104 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
105 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
106 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
107 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
108 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
109 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
113 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
114 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
115 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
116 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
117 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
118 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
119 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
120 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
121 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
122 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
123 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
124 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
125 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
126 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
127 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
128 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
129 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
130 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
133 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
134 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
135 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
138 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
139 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
140 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
141 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
142 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
143 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
144 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
145 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
146 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
147 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
150 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
151 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
152 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
153 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
154 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
161 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
179 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
185 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
189 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
190 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
191 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
192 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
193 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.31
Nodule 0
Rhizoplane 14.03
Rhizosphere 67.16
Stem 0
Stem Tuber 0
Unclassified 1.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_11084883 3300014325 Bacteria 864
2 Ga0070683_101080213 3300005329 Bacteria 771
3 Ga0070670_100732555 3300005331 Bacteria 890
4 Ga0070682_100801460 3300005337 Bacteria 765
5 Ga0070689_101039607 3300005340 Bacteria 730
6 Ga0070668_101208776 3300005347 Bacteria 685
7 Ga0070669_100353629 3300005353 Bacteria 1193
8 Ga0070674_100015984 3300005356 Bacteria 4697
9 Ga0070674_102093760 3300005356 Bacteria 516
10 Ga0070673_100395030 3300005364 Bacteria 1235
11 Ga0070688_100271271 3300005365 Bacteria 1215
12 Ga0070713_100122897 3300005436 Bacteria 2279
13 Ga0070700_100023929 3300005441 Bacteria 3579
14 Ga0070708_100011129 3300005445 Bacteria 7314
15 Ga0070678_100276145 3300005456 Bacteria 1419
16 Ga0070678_100909341 3300005456 Bacteria 805
17 Ga0070681_10265289 3300005458 Bacteria 1629
18 Ga0070681_11096587 3300005458 Bacteria 717
19 Ga0068867_100051875 3300005459 Bacteria 3026
20 Ga0070685_10194889 3300005466 Bacteria 1313
21 Ga0070684_100300509 3300005535 Bacteria 1473
22 Ga0070672_100406976 3300005543 Bacteria 1167
23 Ga0070686_100077870 3300005544 Bacteria 2187
24 Ga0070702_100082583 3300005615 Bacteria 1928
25 Ga0068866_10004543 3300005718 Bacteria 5691
26 Ga0068866_11138447 3300005718 Bacteria 561
27 Ga0068863_100426866 3300005841 Bacteria 1299
28 Ga0068858_100016197 3300005842 Bacteria 7003
29 Ga0068860_100005095 3300005843 Bacteria 13366
30 Ga0068860_100733685 3300005843 Bacteria 999
31 Ga0081455_10117350 3300005937 Bacteria 2103
32 Ga0081455_10166564 3300005937 Bacteria 1683
33 Ga0081455_10189861 3300005937 Bacteria 1548
34 Ga0081540_1000892 3300005983 Bacteria 26990
35 Ga0081539_10029313 3300005985 Bacteria 3440
36 Ga0070717_10133778 3300006028 Bacteria 2134
37 Ga0075365_10000723 3300006038 Bacteria 13338
38 Ga0075365_10025172 3300006038 Bacteria 3765
39 Ga0075365_10446221 3300006038 Bacteria 914
40 Ga0075365_11094849 3300006038 Bacteria 561
41 Ga0075365_11100494 3300006038 Bacteria 559
42 Ga0075363_100001562 3300006048 Bacteria 8788
43 Ga0075363_100363840 3300006048 Bacteria 846
44 Ga0075363_100388415 3300006048 Bacteria 819
45 Ga0075364_10005613 3300006051 Bacteria 7315
46 Ga0075364_10023081 3300006051 Bacteria 3937
47 Ga0075364_10023159 3300006051 Bacteria 3930
48 Ga0075364_10039950 3300006051 Bacteria 3042
49 Ga0075364_10125342 3300006051 Bacteria 1721
50 Ga0075364_10127893 3300006051 Bacteria 1704
51 Ga0075364_10137218 3300006051 Bacteria 1644
52 Ga0075364_10764830 3300006051 Bacteria 659
53 Ga0070716_100341724 3300006173 Bacteria 1056
54 Ga0070712_100474573 3300006175 Bacteria 1045
55 Ga0075362_10006170 3300006177 Bacteria 4448
56 Ga0075362_10075285 3300006177 Bacteria 1548
57 Ga0075367_10011887 3300006178 Bacteria 4623
58 Ga0075367_10126892 3300006178 Unclassified 1575
59 Ga0075367_10148013 3300006178 Bacteria 1456
60 Ga0075367_10300363 3300006178 Bacteria 1010
61 Ga0075366_10571798 3300006195 Bacteria 700
62 Ga0097621_100108522 3300006237 Bacteria 2343
63 Ga0075370_10182399 3300006353 Bacteria 1236
64 Ga0075428_100205996 3300006844 Bacteria 2125
65 Ga0075428_100243343 3300006844 Bacteria 1941
66 Ga0075434_100624740 3300006871 Bacteria 1096
67 Ga0075435_101153595 3300007076 Bacteria 678
68 Ga0075435_101945930 3300007076 Bacteria 516
69 Ga0111539_10314198 3300009094 Bacteria 1823
70 Ga0105245_10100899 3300009098 Bacteria 2671
71 Ga0105245_10142156 3300009098 Bacteria 2261
72 Ga0105245_10479596 3300009098 Bacteria 1257
73 Ga0105245_12063356 3300009098 Bacteria 624
74 Ga0105247_10192954 3300009101 Bacteria 1364
75 Ga0105247_10292641 3300009101 Bacteria 1127
76 Ga0105247_10344421 3300009101 Bacteria 1046
77 Ga0105247_10754754 3300009101 Bacteria 738
78 Ga0105243_10006280 3300009148 Bacteria 9183
79 Ga0105242_10000674 3300009176 Bacteria 26770
80 Ga0105248_10280911 3300009177 Bacteria 1874
81 Ga0105248_11082565 3300009177 Bacteria 906
82 Ga0105237_11454088 3300009545 Unclassified 692
83 Ga0105249_10089140 3300009553 Bacteria 2882
84 Ga0105249_10327582 3300009553 Bacteria 1544
85 Ga0105239_11123212 3300010375 Bacteria 905
86 Ga0105239_12954965 3300010375 Bacteria 554
87 Ga0105246_11261769 3300011119 Bacteria 683
88 Ga0157378_10014994 3300013297 Bacteria 6786
89 Ga0157378_10469984 3300013297 Bacteria 1251
90 Ga0157375_10064138 3300013308 Bacteria 3657
91 Ga0163163_10002476 3300014325 Bacteria 15619
92 Ga0157380_10365787 3300014326 Unclassified 1355
93 Ga0157380_10770500 3300014326 Bacteria 976
94 Ga0157379_10023712 3300014968 Bacteria 5447
95 Ga0157376_10417956 3300014969 Bacteria 1300
96 Ga0206355_1675375 3300020076 Bacteria 879
97 Ga0207642_10030300 3300025899 Bacteria 2252
98 Ga0207642_10494895 3300025899 Bacteria 748
99 Ga0207710_10290396 3300025900 Bacteria 824
100 Ga0207688_10039830 3300025901 Bacteria 2610
101 Ga0207699_10032340 3300025906 Bacteria 2947
102 Ga0207705_10372747 3300025909 Bacteria 1102
103 Ga0207693_10401703 3300025915 Bacteria 1071
104 Ga0207662_10011484 3300025918 Bacteria 4915
105 Ga0207681_10685762 3300025923 Bacteria 851
106 Ga0207687_10087519 3300025927 Bacteria 2264
107 Ga0207687_10224089 3300025927 Bacteria 1482
108 Ga0207700_10861397 3300025928 Bacteria 811
109 Ga0207690_10507152 3300025932 Bacteria 976
110 Ga0207686_10042312 3300025934 Bacteria 2784
111 Ga0207709_10751700 3300025935 Bacteria 784
112 Ga0207670_10061964 3300025936 Bacteria 2554
113 Ga0207669_10254707 3300025937 Bacteria 1309
114 Ga0207704_10222576 3300025938 Bacteria 1397
115 Ga0207665_10433818 3300025939 Bacteria 1006
116 Ga0207711_10322859 3300025941 Bacteria 1427
117 Ga0207712_10063721 3300025961 Bacteria 2625
118 Ga0207712_10203956 3300025961 Bacteria 1570
119 Ga0207668_12007136 3300025972 Unclassified 521
120 Ga0207658_11346577 3300025986 Bacteria 653
121 Ga0207677_10962774 3300026023 Bacteria 772
122 Ga0207703_10071991 3300026035 Bacteria 2857
123 Ga0207703_11404401 3300026035 Bacteria 672
124 Ga0207678_10262622 3300026067 Bacteria 1480
125 Ga0207708_10064852 3300026075 Bacteria 2791
126 Ga0207641_10027881 3300026088 Bacteria 4665
127 Ga0207641_10827318 3300026088 Bacteria 917
128 Ga0207648_10003008 3300026089 Bacteria 17805
129 Ga0207648_11228018 3300026089 Bacteria 704
130 Ga0207683_11145193 3300026121 Bacteria 721
131 Ga0209813_10190803 3300027866 Bacteria 754
132 Ga0268266_10085781 3300028379 Bacteria 2752
133 Ga0268266_11417685 3300028379 Bacteria 670
134 Ga0268265_10171909 3300028380 Bacteria 1853
135 Ga0268264_10008963 3300028381 Bacteria 8303
136 Ga0307517_10131740 3300028786 Bacteria 1797
137 Ga0265327_10006006 3300031251 Bacteria 9876
138 Ga0307513_10500134 3300031456 Bacteria 933
139 Ga0316579_10036818 3300031691 Bacteria 2258
140 Ga0316576_10032255 3300031727 Bacteria 3721
141 Ga0316578_10290867 3300031728 Bacteria 977
142 Ga0307405_11480446 3300031731 Bacteria 596
143 Ga0316577_10029368 3300031733 Bacteria 3069
144 Ga0307415_101930906 3300032126 Bacteria 574
145 Ga0373930_0004337 3300034816 Bacteria 2304
146 Ga0316574_0004957 3300035398 Bacteria 7052
147 Ga0373931_0000049 3300035691 Bacteria 63064
148 Ga0373931_0025420 3300035691 Bacteria 3008
149 Ga0373937_0335731 3300036401 Bacteria 1431
150 Ga0316582_0052802 3300036647 Bacteria 2584
151 Ga0316584_0027685 3300036712 Bacteria 4173
152 Ga0316584_0149790 3300036712 Bacteria 1737
153 Ga0373925_0404607 3300037068 Bacteria 1114
154 Ga0451797_0635636 3300041453 Bacteria 627
155 Ga0451837_0196324 3300041494 Bacteria 722
156 Ga0451837_1604693 3300041494 Bacteria 1435
157 Ga0451843_1004110 3300041509 Bacteria 1673
158 Ga0495592_0071029 3300046454 Bacteria 2535
159 Ga0495603_0705280 3300046455 Bacteria 577
160 Ga0495629_0128164 3300046459 Bacteria 1768
161 Ga0495629_0215593 3300046459 Bacteria 1325
162 Ga0495629_0731394 3300046459 Bacteria 656
163 Ga0495641_0040259 3300046461 Bacteria 2174
164 Ga0495651_0180131 3300046462 Bacteria 1496
165 Ga0495651_0439875 3300046462 Bacteria 844
166 Ga0495653_0298554 3300046463 Bacteria 1051
167 Ga0495653_0300639 3300046463 Bacteria 1047
168 Ga0495582_0239847 3300046473 Bacteria 1039
169 Ga0495594_0181567 3300046499 Bacteria 1198
170 Ga0495608_0016759 3300046511 Bacteria 5070
171 Ga0495608_0186703 3300046511 Bacteria 1310
172 Ga0495608_0197355 3300046511 Bacteria 1269
173 Ga0495618_0067088 3300046514 Bacteria 2281
174 Ga0495618_0194852 3300046514 Bacteria 1284
175 Ga0495628_0007984 3300046516 Bacteria 9119
176 Ga0495628_0043161 3300046516 Bacteria 3593
177 Ga0495628_0275105 3300046516 Bacteria 1252
178 Ga0495628_0801475 3300046516 Bacteria 659
179 Ga0495630_0020137 3300046517 Bacteria 4915
180 Ga0495630_0037394 3300046517 Bacteria 3629
181 Ga0495630_0046436 3300046517 Bacteria 3247
182 Ga0495630_0524922 3300046517 Bacteria 908
183 Ga0495666_0105174 3300046526 Bacteria 1328
184 Ga0495666_0546326 3300046526 Bacteria 517
185 Ga0495652_1018482 3300046529 Bacteria 541
186 Ga0495640_0047189 3300046533 Bacteria 2981
187 Ga0495640_0153107 3300046533 Bacteria 1481
188 Ga0495640_0632248 3300046533 Bacteria 645
189 Ga0495586_0125873 3300046535 Bacteria 1433
190 Ga0495645_0208360 3300046543 Bacteria 1322
191 Ga0495622_0048807 3300046557 Bacteria 1966
192 Ga0495667_0201060 3300046559 Bacteria 1275
193 Ga0495667_0550968 3300046559 Bacteria 720
194 Ga0495668_0523870 3300046616 Bacteria 654
195 Ga0495634_0128145 3300046642 Bacteria 1620
196 Ga0495634_0138369 3300046642 Bacteria 1548
197 Ga0495634_0317589 3300046642 Bacteria 938
198 Ga0495634_0380311 3300046642 Bacteria 841
199 Ga0495611_0438268 3300046648 Bacteria 596
200 Ga0495635_0479627 3300046663 Bacteria 820
201 Ga0495657_0273742 3300046675 Bacteria 1012
202 Ga0495599_0298016 3300046678 Bacteria 974
203 Ga0495658_0149019 3300046683 Bacteria 1436
204 Ga0495658_0236110 3300046683 Bacteria 1147
205 Ga0495658_0801344 3300046683 Bacteria 603
206 Ga0495669_0562032 3300046684 Bacteria 555
207 Ga0495613_0001294 3300046689 Bacteria 19113
208 Ga0495671_0597760 3300046692 Bacteria 525
209 Ga0495649_0416579 3300046694 Bacteria 673
210 Ga0495600_0445993 3300046809 Bacteria 801
211 Ga0495600_0451435 3300046809 Bacteria 795
212 Ga0495674_0021242 3300047319 Bacteria 6006
213 Ga0495674_0311008 3300047319 Bacteria 1285
214 Ga0495680_0282978 3300047322 Bacteria 1168
215 Ga0495680_0478171 3300047322 Bacteria 848
216 Ga0495675_0207260 3300047444 Bacteria 1191
217 Ga0495684_0169430 3300047471 Bacteria 1625
218 Ga0495602_0439450 3300048088 Bacteria 923
219 Ga0495602_0491767 3300048088 Bacteria 859
220 Ga0496100_0018908 3300048903 Bacteria 4100
221 Ga0496100_0211423 3300048903 Bacteria 1419
222 Ga0496101_0095062 3300048904 Bacteria 2222
223 Ga0496101_0117342 3300048904 Bacteria 2009
224 Ga0496101_0225741 3300048904 Bacteria 1455
225 Ga0496101_1028177 3300048904 Bacteria 648
226 Ga0496102_0022770 3300048905 Bacteria 5553
227 Ga0496102_0023489 3300048905 Bacteria 5478
228 Ga0496102_1690974 3300048905 Bacteria 551
229 Ga0496103_0128002 3300048906 Bacteria 1620
230 Ga0496104_0035699 3300048907 Bacteria 4643
231 Ga0496104_0167877 3300048907 Bacteria 2104
232 Ga0496104_0220517 3300048907 Bacteria 1809
233 Ga0496104_1227728 3300048907 Bacteria 653
234 Ga0496105_0003668 3300048908 Bacteria 11418
235 Ga0496105_0006674 3300048908 Bacteria 8885
236 Ga0496105_0140240 3300048908 Bacteria 1990
237 Ga0496105_0272645 3300048908 Bacteria 1366
238 Ga0496105_0357818 3300048908 Bacteria 1165
239 Ga0496106_0128453 3300048909 Bacteria 1986
240 Ga0496106_0181254 3300048909 Bacteria 1672
241 Ga0496107_0005615 3300048910 Bacteria 8592
242 Ga0496107_0364591 3300048910 Bacteria 1075
243 Ga0496108_0052411 3300048911 Bacteria 3419
244 Ga0496108_0631446 3300048911 Bacteria 932
245 Ga0496108_0812475 3300048911 Bacteria 806
246 Ga0496108_0859597 3300048911 Bacteria 780
247 Ga0496109_0136631 3300048912 Bacteria 2291
248 Ga0496109_0227468 3300048912 Bacteria 1754
249 Ga0496109_0792513 3300048912 Bacteria 886
250 Ga0496109_1033363 3300048912 Bacteria 759
251 Ga0496110_0001270 3300048913 Bacteria 18051
252 Ga0496110_0088474 3300048913 Bacteria 2766
253 Ga0496110_0211577 3300048913 Bacteria 1763
254 Ga0496111_0024457 3300048914 Bacteria 4253
255 Ga0496111_0047641 3300048914 Bacteria 3087
256 Ga0496112_0855890 3300048915 Bacteria 832
257 Ga0496113_0128477 3300048916 Bacteria 1987
258 Ga0496114_0001767 3300048917 Bacteria 16414
259 Ga0496114_0024944 3300048917 Bacteria 4882
260 Ga0496114_0588564 3300048917 Bacteria 981
261 Ga0496114_1244690 3300048917 Bacteria 631
262 Ga0496114_1475040 3300048917 Bacteria 568
263 Ga0496115_0011900 3300048918 Bacteria 6534
264 Ga0496115_0114088 3300048918 Bacteria 2221
265 Ga0496115_0330119 3300048918 Bacteria 1246
266 Ga0501034_0001086 3300049571 Bacteria 38379
267 Ga0501034_0011237 3300049571 Bacteria 9296
268 Ga0501034_0136361 3300049571 Bacteria 2435
269 Ga0501034_0358385 3300049571 Bacteria 1386
270 Ga0501034_0362653 3300049571 Bacteria 1376
271 Ga0501036_0075210 3300049572 Bacteria 2857
272 Ga0501036_0387784 3300049572 Bacteria 1166
273 Ga0501047_0285389 3300049581 Bacteria 1495
274 Ga0501047_0496371 3300049581 Bacteria 1047
275 Ga0501047_0607293 3300049581 Bacteria 915
276 Ga0501048_0819905 3300049582 Bacteria 669
277 Ga0501068_0491052 3300049584 Bacteria 796
278 Ga0501069_0039354 3300049585 Bacteria 2612
279 Ga0501070_0027952 3300049586 Bacteria 4731
280 Ga0501070_1173807 3300049586 Bacteria 590
281 Ga0501070_1437124 3300049586 Bacteria 523
282 Ga0501073_0247338 3300049589 Bacteria 1231
283 Ga0501074_0182484 3300049590 Bacteria 1497
284 Ga0501080_0036229 3300049742 Bacteria 4606
285 Ga0501081_0634132 3300049743 Bacteria 801
286 Ga0501044_0007361 3300049823 Bacteria 12104
287 Ga0501044_0673249 3300049823 Bacteria 922
288 nmdc:mga03683_6534_c1 3300050489 Bacteria 3998
289 nmdc:mga03683_81564_c1 3300050489 Bacteria 1397
290 nmdc:mga03n38_120489_c1 3300050490 Bacteria 1289
291 nmdc:mga03n38_377815_c1 3300050490 Bacteria 776
292 nmdc:mga03n38_496143_c1 3300050490 Bacteria 685
293 nmdc:mga03n38_547410_c1 3300050490 Bacteria 654
294 nmdc:mga03n38_641332_c1 3300050490 Bacteria 608
295 nmdc:mga00v17_11341_c1 3300050491 Bacteria 3713
296 nmdc:mga00v17_156759_c1 3300050491 Bacteria 1464
297 nmdc:mga00v17_323520_c1 3300050491 Bacteria 1002
298 nmdc:mga00v17_51624_c1 3300050491 Bacteria 2500
299 nmdc:mga00v17_545883_c1 3300050491 Bacteria 750
300 nmdc:mga00v17_63624_c1 3300050491 Bacteria 2272
301 nmdc:mga00v17_9486_c1 3300050491 Bacteria 5271
302 nmdc:mga0yw44_15719_c1 3300050492 Bacteria 4065
303 nmdc:mga0yw44_559170_c1 3300050492 Bacteria 777
304 nmdc:mga0yw44_589967_c1 3300050492 Bacteria 755
305 nmdc:mga0yw44_627325_c1 3300050492 Bacteria 730
306 nmdc:mga0yw44_90329_c1 3300050492 Bacteria 1935
307 nmdc:mga0yw44_969586_c1 3300050492 Bacteria 576
308 nmdc:mga06z11_180811_c1 3300050494 Bacteria 1216
309 nmdc:mga06z11_29399_c1 3300050494 Bacteria 2647
310 nmdc:mga06z11_656358_c1 3300050494 Bacteria 639
311 nmdc:mga06z11_86597_c1 3300050494 Bacteria 1692
312 nmdc:mga04h51_225533_c1 3300050495 Bacteria 744
313 nmdc:mga07m45_155543_c1 3300050496 Bacteria 1326
314 nmdc:mga08y16_375302_c1 3300050511 Bacteria 1458
315 nmdc:mga0n895_702547_c1 3300050512 Bacteria 1007
316 nmdc:mga0rr50_1745558_c1 3300050513 Bacteria 524
317 nmdc:mga0rr50_618177_c1 3300050513 Bacteria 924
318 nmdc:mga0sz30_190056_c1 3300050516 Bacteria 911
319 Ga0495601_0088435 3300053077 Bacteria 1992
320 Ga0495601_0308508 3300053077 Bacteria 1031
321 Ga0500635_0074624 3300053080 Bacteria 1208
322 Ga0495595_0009280 3300053084 Bacteria 4063
323 Ga0495595_0669305 3300053084 Bacteria 532
324 Ga0495619_0004443 3300053085 Bacteria 8945
325 Ga0495619_0035688 3300053085 Bacteria 3235
326 Ga0495619_0038846 3300053085 Bacteria 3106
327 Ga0495619_0291528 3300053085 Bacteria 1130
328 Ga0495619_0345808 3300053085 Bacteria 1029
329 Ga0500583_0254737 3300053092 Bacteria 866
330 Ga0500566_0000478 3300053094 Bacteria 22275
331 Ga0500566_0052088 3300053094 Bacteria 2340
332 Ga0500650_0434892 3300053098 Bacteria 564
333 Ga0500628_124931 3300053129 Bacteria 702
334 Ga0587101_094663 3300059623 Bacteria 585
335 Ga0530510_0022484 3300061734 Bacteria 4492
336 Ga0163163_11084883
337 Ga0070683_101080213
338 Ga0070670_100732555
339 Ga0070682_100801460
340 Ga0070689_101039607
341 Ga0070668_101208776
342 Ga0070669_100353629
343 Ga0070674_100015984
344 Ga0070674_102093760
345 Ga0070673_100395030
346 Ga0070688_100271271
347 Ga0070713_100122897
348 Ga0070700_100023929
349 Ga0070708_100011129
350 Ga0070678_100276145
351 Ga0070678_100909341
352 Ga0070681_10265289
353 Ga0070681_11096587
354 Ga0068867_100051875
355 Ga0070685_10194889
356 Ga0070684_100300509
357 Ga0070672_100406976
358 Ga0070686_100077870
359 Ga0070702_100082583
360 Ga0068866_10004543
361 Ga0068866_11138447
362 Ga0068863_100426866
363 Ga0068858_100016197
364 Ga0068860_100005095
365 Ga0068860_100733685
366 Ga0081455_10117350
367 Ga0081455_10166564
368 Ga0081455_10189861
369 Ga0081540_1000892
370 Ga0081539_10029313
371 Ga0070717_10133778
372 Ga0075365_10000723
373 Ga0075365_10025172
374 Ga0075365_10446221
375 Ga0075365_11094849
376 Ga0075365_11100494
377 Ga0075363_100001562
378 Ga0075363_100363840
379 Ga0075363_100388415
380 Ga0075364_10005613
381 Ga0075364_10023081
382 Ga0075364_10023159
383 Ga0075364_10039950
384 Ga0075364_10125342
385 Ga0075364_10127893
386 Ga0075364_10137218
387 Ga0075364_10764830
388 Ga0070716_100341724
389 Ga0070712_100474573
390 Ga0075362_10006170
391 Ga0075362_10075285
392 Ga0075367_10011887
393 Ga0075367_10126892
394 Ga0075367_10148013
395 Ga0075367_10300363
396 Ga0075366_10571798
397 Ga0097621_100108522
398 Ga0075370_10182399
399 Ga0075428_100205996
400 Ga0075428_100243343
401 Ga0075434_100624740
402 Ga0075435_101153595
403 Ga0075435_101945930
404 Ga0111539_10314198
405 Ga0105245_10100899
406 Ga0105245_10142156
407 Ga0105245_10479596
408 Ga0105245_12063356
409 Ga0105247_10192954
410 Ga0105247_10292641
411 Ga0105247_10344421
412 Ga0105247_10754754
413 Ga0105243_10006280
414 Ga0105242_10000674
415 Ga0105248_10280911
416 Ga0105248_11082565
417 Ga0105237_11454088
418 Ga0105249_10089140
419 Ga0105249_10327582
420 Ga0105239_11123212
421 Ga0105239_12954965
422 Ga0105246_11261769
423 Ga0157378_10014994
424 Ga0157378_10469984
425 Ga0157375_10064138
426 Ga0163163_10002476
427 Ga0157380_10365787
428 Ga0157380_10770500
429 Ga0157379_10023712
430 Ga0157376_10417956
431 Ga0206355_1675375
432 Ga0207642_10030300
433 Ga0207642_10494895
434 Ga0207710_10290396
435 Ga0207688_10039830
436 Ga0207699_10032340
437 Ga0207705_10372747
438 Ga0207693_10401703
439 Ga0207662_10011484
440 Ga0207681_10685762
441 Ga0207687_10087519
442 Ga0207687_10224089
443 Ga0207700_10861397
444 Ga0207690_10507152
445 Ga0207686_10042312
446 Ga0207709_10751700
447 Ga0207670_10061964
448 Ga0207669_10254707
449 Ga0207704_10222576
450 Ga0207665_10433818
451 Ga0207711_10322859
452 Ga0207712_10063721
453 Ga0207712_10203956
454 Ga0207668_12007136
455 Ga0207658_11346577
456 Ga0207677_10962774
457 Ga0207703_10071991
458 Ga0207703_11404401
459 Ga0207678_10262622
460 Ga0207708_10064852
461 Ga0207641_10027881
462 Ga0207641_10827318
463 Ga0207648_10003008
464 Ga0207648_11228018
465 Ga0207683_11145193
466 Ga0209813_10190803
467 Ga0268266_10085781
468 Ga0268266_11417685
469 Ga0268265_10171909
470 Ga0268264_10008963
471 Ga0307517_10131740
472 Ga0265327_10006006
473 Ga0307513_10500134
474 Ga0316579_10036818
475 Ga0316576_10032255
476 Ga0316578_10290867
477 Ga0307405_11480446
478 Ga0316577_10029368
479 Ga0307415_101930906
480 Ga0373930_0004337
481 Ga0316574_0004957
482 Ga0373931_0000049
483 Ga0373931_0025420
484 Ga0373937_0335731
485 Ga0316582_0052802
486 Ga0316584_0027685
487 Ga0316584_0149790
488 Ga0373925_0404607
489 Ga0451797_0635636
490 Ga0451837_0196324
491 Ga0451837_1604693
492 Ga0451843_1004110
493 Ga0495592_0071029
494 Ga0495603_0705280
495 Ga0495629_0128164
496 Ga0495629_0215593
497 Ga0495629_0731394
498 Ga0495641_0040259
499 Ga0495651_0180131
500 Ga0495651_0439875
501 Ga0495653_0298554
502 Ga0495653_0300639
503 Ga0495582_0239847
504 Ga0495594_0181567
505 Ga0495608_0016759
506 Ga0495608_0186703
507 Ga0495608_0197355
508 Ga0495618_0067088
509 Ga0495618_0194852
510 Ga0495628_0007984
511 Ga0495628_0043161
512 Ga0495628_0275105
513 Ga0495628_0801475
514 Ga0495630_0020137
515 Ga0495630_0037394
516 Ga0495630_0046436
517 Ga0495630_0524922
518 Ga0495666_0105174
519 Ga0495666_0546326
520 Ga0495652_1018482
521 Ga0495640_0047189
522 Ga0495640_0153107
523 Ga0495640_0632248
524 Ga0495586_0125873
525 Ga0495645_0208360
526 Ga0495622_0048807
527 Ga0495667_0201060
528 Ga0495667_0550968
529 Ga0495668_0523870
530 Ga0495634_0128145
531 Ga0495634_0138369
532 Ga0495634_0317589
533 Ga0495634_0380311
534 Ga0495611_0438268
535 Ga0495635_0479627
536 Ga0495657_0273742
537 Ga0495599_0298016
538 Ga0495658_0149019
539 Ga0495658_0236110
540 Ga0495658_0801344
541 Ga0495669_0562032
542 Ga0495613_0001294
543 Ga0495671_0597760
544 Ga0495649_0416579
545 Ga0495600_0445993
546 Ga0495600_0451435
547 Ga0495674_0021242
548 Ga0495674_0311008
549 Ga0495680_0282978
550 Ga0495680_0478171
551 Ga0495675_0207260
552 Ga0495684_0169430
553 Ga0495602_0439450
554 Ga0495602_0491767
555 Ga0496100_0018908
556 Ga0496100_0211423
557 Ga0496101_0095062
558 Ga0496101_0117342
559 Ga0496101_0225741
560 Ga0496101_1028177
561 Ga0496102_0022770
562 Ga0496102_0023489
563 Ga0496102_1690974
564 Ga0496103_0128002
565 Ga0496104_0035699
566 Ga0496104_0167877
567 Ga0496104_0220517
568 Ga0496104_1227728
569 Ga0496105_0003668
570 Ga0496105_0006674
571 Ga0496105_0140240
572 Ga0496105_0272645
573 Ga0496105_0357818
574 Ga0496106_0128453
575 Ga0496106_0181254
576 Ga0496107_0005615
577 Ga0496107_0364591
578 Ga0496108_0052411
579 Ga0496108_0631446
580 Ga0496108_0812475
581 Ga0496108_0859597
582 Ga0496109_0136631
583 Ga0496109_0227468
584 Ga0496109_0792513
585 Ga0496109_1033363
586 Ga0496110_0001270
587 Ga0496110_0088474
588 Ga0496110_0211577
589 Ga0496111_0024457
590 Ga0496111_0047641
591 Ga0496112_0855890
592 Ga0496113_0128477
593 Ga0496114_0001767
594 Ga0496114_0024944
595 Ga0496114_0588564
596 Ga0496114_1244690
597 Ga0496114_1475040
598 Ga0496115_0011900
599 Ga0496115_0114088
600 Ga0496115_0330119
601 Ga0501034_0001086
602 Ga0501034_0011237
603 Ga0501034_0136361
604 Ga0501034_0358385
605 Ga0501034_0362653
606 Ga0501036_0075210
607 Ga0501036_0387784
608 Ga0501047_0285389
609 Ga0501047_0496371
610 Ga0501047_0607293
611 Ga0501048_0819905
612 Ga0501068_0491052
613 Ga0501069_0039354
614 Ga0501070_0027952
615 Ga0501070_1173807
616 Ga0501070_1437124
617 Ga0501073_0247338
618 Ga0501074_0182484
619 Ga0501080_0036229
620 Ga0501081_0634132
621 Ga0501044_0007361
622 Ga0501044_0673249
623 nmdc:mga03683_6534_c1
624 nmdc:mga03683_81564_c1
625 nmdc:mga03n38_120489_c1
626 nmdc:mga03n38_377815_c1
627 nmdc:mga03n38_496143_c1
628 nmdc:mga03n38_547410_c1
629 nmdc:mga03n38_641332_c1
630 nmdc:mga00v17_11341_c1
631 nmdc:mga00v17_156759_c1
632 nmdc:mga00v17_323520_c1
633 nmdc:mga00v17_51624_c1
634 nmdc:mga00v17_545883_c1
635 nmdc:mga00v17_63624_c1
636 nmdc:mga00v17_9486_c1
637 nmdc:mga0yw44_15719_c1
638 nmdc:mga0yw44_559170_c1
639 nmdc:mga0yw44_589967_c1
640 nmdc:mga0yw44_627325_c1
641 nmdc:mga0yw44_90329_c1
642 nmdc:mga0yw44_969586_c1
643 nmdc:mga06z11_180811_c1
644 nmdc:mga06z11_29399_c1
645 nmdc:mga06z11_656358_c1
646 nmdc:mga06z11_86597_c1
647 nmdc:mga04h51_225533_c1
648 nmdc:mga07m45_155543_c1
649 nmdc:mga08y16_375302_c1
650 nmdc:mga0n895_702547_c1
651 nmdc:mga0rr50_1745558_c1
652 nmdc:mga0rr50_618177_c1
653 nmdc:mga0sz30_190056_c1
654 Ga0495601_0088435
655 Ga0495601_0308508
656 Ga0500635_0074624
657 Ga0495595_0009280
658 Ga0495595_0669305
659 Ga0495619_0004443
660 Ga0495619_0035688
661 Ga0495619_0038846
662 Ga0495619_0291528
663 Ga0495619_0345808
664 Ga0500583_0254737
665 Ga0500566_0000478
666 Ga0500566_0052088
667 Ga0500650_0434892
668 Ga0500628_124931
669 Ga0587101_094663
670 Ga0530510_0022484

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00210

Ferritin

Ferritin-like domain

44

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4toc-assembly1.cif.gz_A 2.25a resolution structure of iron bound bfrb (q151l) from pseudomonas aeruginosa 0.9959 4 156
4tob-assembly1.cif.gz_L 1.95a resolution structure of bfrb (q151l) from pseudomonas aeruginosa 0.9948 4 156
4tod-assembly1.cif.gz_S 2.05a resolution structure of bfrb (d34f) from pseudomonas aeruginosa 0.9939 4 156
4tod-assembly1.cif.gz_N 2.05a resolution structure of bfrb (d34f) from pseudomonas aeruginosa 0.9938 4 156
4tod-assembly1.cif.gz_A 2.05a resolution structure of bfrb (d34f) from pseudomonas aeruginosa 0.9938 4 156
ID Description Score Start End Superfamily
4todN00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9938 4 156 1.20.1260.10
3iseA00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9937 4 156 1.20.1260.10
3is7J00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9934 4 156 1.20.1260.10
3iseD00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9932 4 156 1.20.1260.10
3iseC00 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9931 4 156 1.20.1260.10
ID Description Score Start End GO Terms
AF-A0A291PZZ8-F1-model_v4 ferroxidase (EC 1.16.3.1) 0.9996 19 156 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0015093
GO:0020037
AF-A0A2E8TNZ5-F1-model_v4 ferroxidase (EC 1.16.3.1) 0.9984 22 153 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-Q091J6-F1-model_v4 Bacterioferritin 0.9978 4 156 GO:0004322
GO:0005829
GO:0006826
GO:0006880
GO:0008199
GO:0020037
AF-A0A2E2TYR5-F1-model_v4 Bacterioferritin (EC 1.16.3.1) 0.9973 1 154 GO:0004322
GO:0005829
GO:0006880
GO:0008199
GO:0015093
GO:0020037
AF-A0A1V5FGR5-F1-model_v4 deleted 0.9972 4 155

Map