F412043

General Info

Members Datasets Scaffolds Average Seq Length
334 171 305 272

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8057798959|8057805174
Length 297
Sequence RRHLAGNRWGCTHYLSSSLNFMNTISVTPIEGREAWQVPAMETLLWQGRQHPWCVVIPVINEGQRIKDLLKKMQSQKISEIADIIIVDGGSKDGSLELEALKQVGVSSLIEKKGPGKLSAQLRCAYAFALEQGYEGIVTIDGNNKDDPEAIPRFISALKDGVDFVQASRFISGGIAENTPKSRDFAIRFIHAPCLSLASGFKWTDTTQGFRAYSRKMLLDPKISIFRDIFSKYELLAYLSYRVPKLGYKCVELPAIRKYPIDEVPTKITAFRGNLDVLKTLFSSCLKKYNPEEKQLK

Samples

Sample ID Description Type Environment
1 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
2 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
3 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
4 2511231020 Pseudomonas sp. GM74 Isolate Nodule
5 2511231022 Pseudomonas sp. GM79 Isolate Nodule
6 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
7 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
8 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
9 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
10 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
11 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
12 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
13 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
14 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
15 2643221638 Duganella sp. Root336D2 Isolate Unclassified
16 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
17 2784132063 Pseudomonas sp. 424 Isolate Unclassified
18 2816332133 Acidovorax radicis 2721A Isolate Unclassified
19 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
20 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
21 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
22 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
23 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
24 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
25 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
26 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
27 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
28 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
29 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
35 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
36 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
37 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
38 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
43 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
44 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
47 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
59 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
60 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
61 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
62 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
63 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
64 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
65 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
66 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
67 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
68 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
69 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
70 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
71 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
72 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
73 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
74 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
75 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
76 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
77 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
78 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
79 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
83 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
84 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
85 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
86 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
87 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
88 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
89 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
90 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
91 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
92 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
93 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
94 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
95 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
96 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
97 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
98 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
99 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
100 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
101 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
106 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
107 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
108 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
116 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
117 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
118 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
119 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
120 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
121 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
122 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
123 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
124 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
125 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
126 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
127 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
128 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
129 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
130 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
131 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
132 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
135 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
138 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
139 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
140 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
141 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
142 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
143 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
144 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
145 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
146 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
147 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
148 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
165 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
166 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
167 639633007 Azoarcus olearius BH72 Isolate Unclassified
168 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
169 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
170 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
171 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.02
Metatranscriptomes 0.3
Isolates 8.68

Biome Distribution

Category Percentage (%)
Aerial Root 0.6
Bulb 0
Endosphere 7.49
Nodule 0.9
Rhizoplane 2.99
Rhizosphere 75.45
Stem 0
Stem Tuber 0
Unclassified 12.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10275864 3300003322 Bacteria 1989
2 Ga0055533_1000124 3300003756 Bacteria 87900
3 Ga0055525_1002684 3300003759 Bacteria 1731
4 Ga0055526_1002209 3300003771 Bacteria 13339
5 Ga0055537_1001860 3300003773 Bacteria 7614
6 Ga0055528_1012818 3300003790 Bacteria 3226
7 Ga0055530_10000283 3300003791 Bacteria 46150
8 Ga0070705_100068328 3300005440 Bacteria 2138
9 Ga0070686_100118088 3300005544 Bacteria 1817
10 Ga0105251_10004073 3300009011 Bacteria 10255
11 Ga0105251_10007045 3300009011 Bacteria 7012
12 Ga0105244_10029797 3300009036 Bacteria 2910
13 Ga0105250_10003450 3300009092 Bacteria 7488
14 Ga0105250_10034637 3300009092 Bacteria 2026
15 Ga0157373_10000759 3300013100 Bacteria 25031
16 Ga0157370_10002586 3300013104 Bacteria 21745
17 Ga0157369_10004895 3300013105 Bacteria 15706
18 Ga0157369_10216302 3300013105 Bacteria 2007
19 Ga0182008_10001249 3300014497 Bacteria 17458
20 Ga0182006_1000707 3300015261 Bacteria 23141
21 Ga0182005_1000014 3300015265 Bacteria 389763
22 Ga0182005_1000319 3300015265 Bacteria 28646
23 Ga0182005_1000325 3300015265 Bacteria 28280
24 Ga0182005_1000529 3300015265 Bacteria 19383
25 Ga0209566_110707 3300025225 Bacteria 918
26 Ga0209674_100005 3300025226 Bacteria 1708125
27 Ga0209563_100360 3300025230 Bacteria 16852
28 Ga0207427_100394 3300025231 Bacteria 25938
29 Ga0209233_1000016 3300025261 Bacteria 907830
30 Ga0209565_1000348 3300025263 Bacteria 40662
31 Ga0209565_1000439 3300025263 Bacteria 33341
32 Ga0209565_1001005 3300025263 Bacteria 14486
33 Ga0209673_1002992 3300025273 Bacteria 10520
34 Ga0209564_1001062 3300025295 Bacteria 33341
35 Ga0209050_1000271 3300025298 Bacteria 110802
36 Ga0209050_1000904 3300025298 Bacteria 39210
37 Ga0209256_1005349 3300025299 Bacteria 7437
38 Ga0209256_1037648 3300025299 Bacteria 1259
39 Ga0209051_1048449 3300025303 Bacteria 1441
40 Ga0207696_1005870 3300025711 Bacteria 5036
41 Ga0207655_1001579 3300025728 Bacteria 20452
42 Ga0207655_1006962 3300025728 Bacteria 7413
43 Ga0207655_1021551 3300025728 Bacteria 3266
44 Ga0207655_1053072 3300025728 Bacteria 1624
45 Ga0207713_1000001 3300025735 Bacteria 2295391
46 Ga0207713_1000073 3300025735 Bacteria 181519
47 Ga0207713_1000614 3300025735 Bacteria 35058
48 Ga0207713_1002635 3300025735 Bacteria 12899
49 Ga0209371_1002174 3300027312 Bacteria 11470
50 Ga0209371_1021180 3300027312 Bacteria 1582
51 Ga0307515_10089332 3300028794 Bacteria 3881
52 Ga0268256_1001911 3300030500 Bacteria 11470
53 Ga0268256_1025984 3300030500 Bacteria 1479
54 Ga0265325_10152689 3300031241 Unclassified 1091
55 Ga0307408_100002453 3300031548 Bacteria 13008
56 Ga0307412_10008850 3300031911 Bacteria 5764
57 Ga0307411_10010999 3300032005 Bacteria 4857
58 Ga0307411_10376706 3300032005 Bacteria 1166
59 Ga0439438_017264 3300041405 Bacteria 2081
60 Ga0439432_000099 3300042006 Bacteria 27419
61 Ga0450911_000103 3300042115 Bacteria 34739
62 Ga0451577_0000278 3300042876 Bacteria 99268
63 Ga0453684_0000273 3300044712 Bacteria 222658
64 Ga0453684_0000901 3300044712 Bacteria 99151
65 Ga0495617_000086 3300046452 Bacteria 67731
66 Ga0495617_017982 3300046452 Bacteria 2390
67 Ga0495627_004515 3300046453 Bacteria 5804
68 Ga0495603_0000188 3300046455 Bacteria 32204
69 Ga0495603_0000224 3300046455 Bacteria 29469
70 Ga0495590_0021055 3300046457 Bacteria 2314
71 Ga0495591_002361 3300046458 Bacteria 10614
72 Ga0495591_006365 3300046458 Bacteria 5235
73 Ga0495629_0009792 3300046459 Bacteria 6994
74 Ga0495629_0036244 3300046459 Bacteria 3483
75 Ga0495638_0000868 3300046460 Bacteria 31437
76 Ga0495651_0015145 3300046462 Bacteria 5959
77 Ga0495653_0007878 3300046463 Bacteria 8720
78 Ga0495653_0030966 3300046463 Bacteria 4255
79 Ga0495650_0000015 3300046471 Bacteria 557595
80 Ga0495650_0007680 3300046471 Bacteria 6429
81 Ga0495650_0007927 3300046471 Bacteria 6294
82 Ga0495580_0003355 3300046472 Bacteria 13684
83 Ga0495580_0006844 3300046472 Bacteria 9229
84 Ga0495580_0038922 3300046472 Bacteria 3403
85 Ga0495582_0026758 3300046473 Bacteria 3162
86 Ga0495582_0100230 3300046473 Bacteria 1621
87 Ga0495605_0000484 3300046474 Bacteria 34548
88 Ga0495605_0001027 3300046474 Bacteria 18778
89 Ga0495605_0053306 3300046474 Bacteria 1962
90 Ga0495605_0106166 3300046474 Bacteria 1286
91 Ga0495605_0139575 3300046474 Unclassified 1088
92 Ga0495662_0154061 3300046476 Bacteria 1132
93 Ga0495662_0196623 3300046476 Bacteria 994
94 Ga0495664_0018759 3300046477 Bacteria 3969
95 Ga0495584_0007196 3300046491 Bacteria 5811
96 Ga0495585_0000671 3300046492 Bacteria 31409
97 Ga0495585_0000992 3300046492 Bacteria 23785
98 Ga0495585_0001976 3300046492 Bacteria 15273
99 Ga0495585_0004263 3300046492 Bacteria 9314
100 Ga0495594_0046349 3300046499 Bacteria 2387
101 Ga0495596_0000283 3300046500 Bacteria 33843
102 Ga0495596_0000781 3300046500 Bacteria 19375
103 Ga0495596_0002336 3300046500 Bacteria 10283
104 Ga0495607_0000882 3300046501 Bacteria 27974
105 Ga0495607_0023687 3300046501 Bacteria 3839
106 Ga0495607_0181751 3300046501 Bacteria 1054
107 Ga0495583_0000867 3300046506 Bacteria 36740
108 Ga0495583_0001402 3300046506 Bacteria 24561
109 Ga0495583_0002001 3300046506 Bacteria 18656
110 Ga0495583_0106614 3300046506 Bacteria 1191
111 Ga0495606_0000722 3300046507 Bacteria 51115
112 Ga0495606_0002756 3300046507 Bacteria 19703
113 Ga0495610_0022145 3300046512 Bacteria 3480
114 Ga0495616_0022570 3300046513 Bacteria 3398
115 Ga0495616_0040686 3300046513 Bacteria 2373
116 Ga0495618_0004644 3300046514 Bacteria 8411
117 Ga0495618_0046130 3300046514 Bacteria 2750
118 Ga0495620_0000025 3300046515 Bacteria 125369
119 Ga0495620_0052334 3300046515 Bacteria 1734
120 Ga0495628_0002727 3300046516 Bacteria 15792
121 Ga0495628_0016797 3300046516 Bacteria 6097
122 Ga0495628_0203140 3300046516 Bacteria 1492
123 Ga0495630_0005244 3300046517 Bacteria 9138
124 Ga0495631_0000299 3300046518 Bacteria 34689
125 Ga0495631_0001870 3300046518 Bacteria 12427
126 Ga0495631_0003654 3300046518 Bacteria 8399
127 Ga0495631_0013984 3300046518 Bacteria 3881
128 Ga0495632_0003475 3300046519 Bacteria 11144
129 Ga0495632_0013362 3300046519 Bacteria 4688
130 Ga0495637_0000064 3300046520 Bacteria 92793
131 Ga0495637_0003599 3300046520 Bacteria 8206
132 Ga0495643_0000897 3300046522 Bacteria 31700
133 Ga0495643_0078204 3300046522 Bacteria 1727
134 Ga0495643_0083044 3300046522 Bacteria 1663
135 Ga0495644_0004951 3300046523 Bacteria 5227
136 Ga0495644_0039028 3300046523 Bacteria 1790
137 Ga0495648_0028142 3300046524 Bacteria 3747
138 Ga0495648_0035042 3300046524 Bacteria 3257
139 Ga0495666_0000650 3300046526 Bacteria 15630
140 Ga0495666_0010571 3300046526 Bacteria 4599
141 Ga0495666_0019879 3300046526 Bacteria 3331
142 Ga0495666_0127234 3300046526 Bacteria 1191
143 Ga0495652_0002143 3300046529 Bacteria 20798
144 Ga0495652_0019319 3300046529 Bacteria 6071
145 Ga0495654_0000487 3300046530 Bacteria 32718
146 Ga0495654_0001495 3300046530 Bacteria 15987
147 Ga0495654_0015556 3300046530 Bacteria 4037
148 Ga0495665_0001588 3300046531 Bacteria 12155
149 Ga0495665_0013629 3300046531 Bacteria 4394
150 Ga0495640_0030164 3300046533 Bacteria 3885
151 Ga0495586_0000504 3300046535 Bacteria 23022
152 Ga0495587_0000318 3300046536 Bacteria 34260
153 Ga0495609_0000073 3300046538 Bacteria 124227
154 Ga0495609_0000161 3300046538 Bacteria 69842
155 Ga0495609_0000262 3300046538 Bacteria 49441
156 Ga0495609_0005620 3300046538 Bacteria 6538
157 Ga0495597_0000305 3300046542 Bacteria 44060
158 Ga0495645_0022372 3300046543 Bacteria 4573
159 Ga0495622_0052398 3300046557 Bacteria 1893
160 Ga0495633_0000078 3300046558 Bacteria 128668
161 Ga0495633_0001202 3300046558 Bacteria 20822
162 Ga0495634_0028798 3300046642 Bacteria 3851
163 Ga0495611_0000395 3300046648 Bacteria 27443
164 Ga0495611_0029437 3300046648 Bacteria 2408
165 Ga0495625_0000194 3300046660 Bacteria 96964
166 Ga0495635_0000131 3300046663 Bacteria 45264
167 Ga0495635_0001553 3300046663 Bacteria 15411
168 Ga0495635_0077563 3300046663 Bacteria 2276
169 Ga0495661_0000087 3300046665 Bacteria 112658
170 Ga0495661_0000233 3300046665 Bacteria 64169
171 Ga0495661_0002189 3300046665 Bacteria 15270
172 Ga0495661_0002251 3300046665 Bacteria 14952
173 Ga0495661_0032908 3300046665 Bacteria 3274
174 Ga0495599_0023308 3300046678 Bacteria 3869
175 Ga0495599_0162617 3300046678 Bacteria 1379
176 Ga0495623_0001154 3300046679 Bacteria 17868
177 Ga0495623_0024707 3300046679 Bacteria 3869
178 Ga0495623_0200001 3300046679 Bacteria 1149
179 Ga0495646_0000526 3300046680 Bacteria 20513
180 Ga0495646_0002594 3300046680 Bacteria 11134
181 Ga0495646_0019612 3300046680 Bacteria 4277
182 Ga0495613_0003463 3300046689 Bacteria 11802
183 Ga0495613_0117480 3300046689 Bacteria 1912
184 Ga0495613_0203457 3300046689 Bacteria 1395
185 Ga0495624_0002978 3300046690 Bacteria 12664
186 Ga0495624_0004754 3300046690 Bacteria 9880
187 Ga0495624_0053544 3300046690 Bacteria 2547
188 Ga0495670_0000159 3300046691 Bacteria 29368
189 Ga0495670_0092863 3300046691 Unclassified 1546
190 Ga0495671_0001364 3300046692 Bacteria 16559
191 Ga0495671_0052792 3300046692 Bacteria 2019
192 Ga0495671_0079371 3300046692 Bacteria 1608
193 Ga0495671_0104552 3300046692 Bacteria 1383
194 Ga0495649_0006060 3300046694 Bacteria 7560
195 Ga0495649_0099044 3300046694 Bacteria 1550
196 Ga0495589_0000525 3300046794 Bacteria 26868
197 Ga0495589_0000809 3300046794 Bacteria 19813
198 Ga0495589_0034056 3300046794 Bacteria 2557
199 Ga0495600_0053002 3300046809 Bacteria 2649
200 Ga0495600_0054414 3300046809 Bacteria 2614
201 Ga0495600_0097465 3300046809 Bacteria 1917
202 Ga0495660_0027232 3300046810 Bacteria 3234
203 Ga0495660_0027233 3300046810 Bacteria 3234
204 Ga0495660_0036272 3300046810 Bacteria 2750
205 Ga0495660_0077652 3300046810 Unclassified 1747
206 Ga0495660_0086778 3300046810 Bacteria 1633
207 Ga0495581_0057555 3300047315 Bacteria 2243
208 Ga0495604_0000827 3300047317 Bacteria 25855
209 Ga0495604_0046214 3300047317 Bacteria 3395
210 Ga0495604_0065969 3300047317 Bacteria 2754
211 Ga0495674_0004354 3300047319 Bacteria 13608
212 Ga0495674_0013121 3300047319 Bacteria 7792
213 Ga0495674_0098156 3300047319 Bacteria 2494
214 Ga0495674_0402003 3300047319 Bacteria 1105
215 Ga0495672_0047521 3300047320 Bacteria 2551
216 Ga0495672_0052509 3300047320 Bacteria 2394
217 Ga0495676_0000052 3300047321 Bacteria 97049
218 Ga0495676_0041812 3300047321 Bacteria 3769
219 Ga0495676_0079878 3300047321 Bacteria 2485
220 Ga0495676_0111653 3300047321 Bacteria 2004
221 Ga0495680_0000664 3300047322 Bacteria 38534
222 Ga0495680_0003077 3300047322 Bacteria 16613
223 Ga0495680_0005574 3300047322 Bacteria 11816
224 Ga0495680_0017875 3300047322 Bacteria 6035
225 Ga0495683_0000619 3300047323 Bacteria 26557
226 Ga0495683_0000991 3300047323 Bacteria 19870
227 Ga0495683_0001295 3300047323 Bacteria 16901
228 Ga0495683_0001332 3300047323 Bacteria 16524
229 Ga0495683_0004148 3300047323 Bacteria 8290
230 Ga0495683_0038988 3300047323 Bacteria 2402
231 Ga0495687_010083 3300047443 Bacteria 5213
232 Ga0495675_0002573 3300047444 Bacteria 10869
233 Ga0495679_000136 3300047446 Bacteria 65848
234 Ga0495679_000326 3300047446 Bacteria 37937
235 Ga0495679_000812 3300047446 Bacteria 19836
236 Ga0495679_001561 3300047446 Bacteria 12929
237 Ga0495679_004275 3300047446 Bacteria 6630
238 Ga0495679_029204 3300047446 Bacteria 1800
239 Ga0495673_0000903 3300047469 Bacteria 27211
240 Ga0495673_0007363 3300047469 Bacteria 6342
241 Ga0495673_0007586 3300047469 Bacteria 6210
242 Ga0495673_0009998 3300047469 Bacteria 5195
243 Ga0495673_0026722 3300047469 Bacteria 2755
244 Ga0495673_0056966 3300047469 Unclassified 1688
245 Ga0495681_0004449 3300047470 Bacteria 9560
246 Ga0495681_0004815 3300047470 Bacteria 9144
247 Ga0495681_0016909 3300047470 Bacteria 4068
248 Ga0495684_0249667 3300047471 Bacteria 1291
249 Ga0495686_0019308 3300047472 Bacteria 4555
250 Ga0495593_0000168 3300047673 Bacteria 33647
251 Ga0495593_0014920 3300047673 Bacteria 4413
252 Ga0495593_0025267 3300047673 Bacteria 3287
253 Ga0495602_0002520 3300048088 Bacteria 18667
254 Ga0495602_0027973 3300048088 Bacteria 5407
255 Ga0495614_0004449 3300048089 Bacteria 6320
256 Ga0495614_0010303 3300048089 Bacteria 4122
257 Ga0495614_0022552 3300048089 Bacteria 2717
258 Ga0495626_0000126 3300048091 Bacteria 99054
259 Ga0495626_0000621 3300048091 Bacteria 34549
260 Ga0495626_0017704 3300048091 Bacteria 3593
261 Ga0496112_0361247 3300048915 Bacteria 1394
262 Ga0496116_0001011 3300048919 Bacteria 34292
263 Ga0496116_0004915 3300048919 Bacteria 12594
264 Ga0496116_0011933 3300048919 Bacteria 7139
265 Ga0496117_0000009 3300048920 Bacteria 613759
266 Ga0496117_0001649 3300048920 Bacteria 31378
267 Ga0496117_0001908 3300048920 Bacteria 27982
268 Ga0496118_0000017 3300048921 Bacteria 549445
269 Ga0496118_0001895 3300048921 Bacteria 29825
270 Ga0496118_0030613 3300048921 Bacteria 4486
271 Ga0496119_0001204 3300048922 Bacteria 32316
272 Ga0496120_0001293 3300048923 Bacteria 31131
273 Ga0496121_0001685 3300048924 Bacteria 36349
274 Ga0496121_0002045 3300048924 Bacteria 31934
275 Ga0496121_0004065 3300048924 Bacteria 20095
276 Ga0496121_0026500 3300048924 Bacteria 5460
277 Ga0496122_0000088 3300048925 Bacteria 207600
278 Ga0496122_0000434 3300048925 Bacteria 87536
279 Ga0496122_0000847 3300048925 Bacteria 57788
280 Ga0496122_0003083 3300048925 Bacteria 22432
281 Ga0496122_0040483 3300048925 Bacteria 3702
282 Ga0496122_0041179 3300048925 Bacteria 3657
283 Ga0496123_0000139 3300048926 Bacteria 151469
284 Ga0496123_0000318 3300048926 Bacteria 91911
285 Ga0496123_0000811 3300048926 Bacteria 50435
286 Ga0496123_0013321 3300048926 Bacteria 6918
287 Ga0496123_0016191 3300048926 Bacteria 6070
288 Ga0496123_0022133 3300048926 Bacteria 4910
289 Ga0496123_0033459 3300048926 Bacteria 3699
290 Ga0496124_0007001 3300048927 Bacteria 12086
291 Ga0496124_0011728 3300048927 Bacteria 8743
292 Ga0496124_0012068 3300048927 Bacteria 8576
293 Ga0496125_0006871 3300048928 Bacteria 12192
294 Ga0501310_005139 3300049130 Bacteria 1337
295 Ga0495678_000073 3300049459 Bacteria 126095
296 Ga0495678_026067 3300049459 Bacteria 2501
297 Ga0495682_0000080 3300049460 Bacteria 84736
298 Ga0495682_0000466 3300049460 Bacteria 27939
299 Ga0495682_0000723 3300049460 Bacteria 21436
300 Ga0495682_0112238 3300049460 Bacteria 977
301 Ga0501249_000818 3300049679 Bacteria 6926
302 Ga0500618_002755 3300053125 Bacteria 6391
303 Ga0500618_002927 3300053125 Bacteria 6110
304 Ga0500621_000036 3300053126 Bacteria 25015
305 Ga0500636_0001254 3300053177 Bacteria 13752

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046476 Ga0495662_0154061 Ga0495662_0154061_41_757 238
2 3300046689 Ga0495613_0003463 Ga0495613_0003463_11058_11774 238
3 3300046690 Ga0495624_0053544 Ga0495624_0053544_71_787 238
4 iso_pu_bacteria 2885080285 2885083337 248
5 3300048919 Ga0496116_0004915 Ga0496116_0004915_3665_4459 259
6 iso_pu_bacteria 2609459761 2609909859 259
7 3300046810 Ga0495660_0077652 Ga0495660_0077652_937_1734 263
8 3300005440 Ga0070705_100068328 Ga0070705_1000683282 264
9 3300005544 Ga0070686_100118088 Ga0070686_1001180882 264
10 3300047446 Ga0495679_000812 Ga0495679_000812_13333_14130 265
11 iso_pu_bacteria 2510065053 2510281213 265
12 iso_pu_bacteria 2510065055 2510294507 265
13 iso_pu_bacteria 2510065058 2510309361 265
14 iso_pu_bacteria 2511231022 2511362940 265
15 iso_pu_bacteria 2599185292 2599904360 265
16 iso_pu_bacteria 2773857672 2774131768 265
17 iso_pu_bacteria 2917832318 2917834784 265
18 iso_pu_bacteria 2919125081 2919128909 265
19 iso_pu_bacteria 2974298342 2974300881 265
20 iso_pu_bacteria 2984499530 2984503353 265
21 iso_pu_bacteria 2984504281 2984508170 265
22 iso_pu_bacteria 8016728285 8016729633 265
23 iso_pu_bacteria 8055266321 8055266556 265
24 3300046474 Ga0495605_0139575 Ga0495605_0139575_235_1044 266
25 3300028794 Ga0307515_10089332 Ga0307515_100893324 267
26 3300048925 Ga0496122_0000088 Ga0496122_0000088_16038_16850 267
27 3300048926 Ga0496123_0000139 Ga0496123_0000139_134621_135433 267
28 iso_pu_bacteria 2599185160 2599358269 267
29 iso_pu_bacteria 2599185164 2599383434 267
30 iso_pu_bacteria 2599185165 2599389881 267
31 iso_pu_bacteria 2599185181 2599465084 267
32 iso_pu_bacteria 2599185186 2599494001 267
33 iso_pu_bacteria 2599185356 2600217817 267
34 iso_pu_bacteria 2600255313 2601777984 267
35 iso_pu_bacteria 2816332133 2816475877 267
36 iso_pu_bacteria 639633007 639788755 267
37 3300025728 Ga0207655_1006962 Ga0207655_10069627 268
38 3300025728 Ga0207655_1053072 Ga0207655_10530723 268
39 3300025735 Ga0207713_1000001 Ga0207713_10000011675 268
40 3300027312 Ga0209371_1002174 Ga0209371_10021747 268
41 3300030500 Ga0268256_1001911 Ga0268256_10019116 268
42 3300046471 Ga0495650_0000015 Ga0495650_0000015_492627_493436 268
43 3300003756 Ga0055533_1000124 Ga0055533_100012432 269
44 3300003759 Ga0055525_1002684 Ga0055525_10026842 269
45 3300009092 Ga0105250_10003450 Ga0105250_100034503 269
46 3300013105 Ga0157369_10004895 Ga0157369_1000489515 269
47 3300015265 Ga0182005_1000319 Ga0182005_100031913 269
48 3300015265 Ga0182005_1000529 Ga0182005_10005293 269
49 3300025225 Ga0209566_110707 Ga0209566_1107072 269
50 3300025226 Ga0209674_100005 Ga0209674_1000051224 269
51 3300025230 Ga0209563_100360 Ga0209563_1003604 269
52 3300025231 Ga0207427_100394 Ga0207427_1003943 269
53 3300025261 Ga0209233_1000016 Ga0209233_1000016586 269
54 3300025298 Ga0209050_1000904 Ga0209050_100090428 269
55 3300025303 Ga0209051_1048449 Ga0209051_10484492 269
56 3300025711 Ga0207696_1005870 Ga0207696_10058702 269
57 3300025728 Ga0207655_1021551 Ga0207655_10215513 269
58 3300027312 Ga0209371_1021180 Ga0209371_10211802 269
59 3300030500 Ga0268256_1025984 Ga0268256_10259842 269
60 3300031241 Ga0265325_10152689 Ga0265325_101526891 269
61 3300042876 Ga0451577_0000278 Ga0451577_0000278_43169_43981 269
62 3300044712 Ga0453684_0000273 Ga0453684_0000273_36524_37366 269
63 3300044712 Ga0453684_0000901 Ga0453684_0000901_43052_43864 269
64 3300046452 Ga0495617_000086 Ga0495617_000086_56794_57612 269
65 3300046455 Ga0495603_0000224 Ga0495603_0000224_7166_7975 269
66 3300046459 Ga0495629_0009792 Ga0495629_0009792_1895_2704 269
67 3300046459 Ga0495629_0036244 Ga0495629_0036244_1523_2332 269
68 3300046462 Ga0495651_0015145 Ga0495651_0015145_952_1761 269
69 3300046463 Ga0495653_0007878 Ga0495653_0007878_5776_6585 269
70 3300046463 Ga0495653_0030966 Ga0495653_0030966_251_1060 269
71 3300046471 Ga0495650_0007680 Ga0495650_0007680_3444_4253 269
72 3300046472 Ga0495580_0003355 Ga0495580_0003355_4927_5736 269
73 3300046472 Ga0495580_0006844 Ga0495580_0006844_727_1536 269
74 3300046473 Ga0495582_0026758 Ga0495582_0026758_1848_2657 269
75 3300046473 Ga0495582_0100230 Ga0495582_0100230_681_1490 269
76 3300046474 Ga0495605_0106166 Ga0495605_0106166_348_1157 269
77 3300046476 Ga0495662_0196623 Ga0495662_0196623_153_962 269
78 3300046477 Ga0495664_0018759 Ga0495664_0018759_2167_2976 269
79 3300046492 Ga0495585_0000671 Ga0495585_0000671_15606_16415 269
80 3300046492 Ga0495585_0000992 Ga0495585_0000992_17358_18176 269
81 3300046500 Ga0495596_0002336 Ga0495596_0002336_4814_5623 269
82 3300046501 Ga0495607_0181751 Ga0495607_0181751_45_854 269
83 3300046514 Ga0495618_0004644 Ga0495618_0004644_5457_6266 269
84 3300046514 Ga0495618_0046130 Ga0495618_0046130_642_1451 269
85 3300046516 Ga0495628_0002727 Ga0495628_0002727_7946_8755 269
86 3300046516 Ga0495628_0016797 Ga0495628_0016797_1693_2502 269
87 3300046517 Ga0495630_0005244 Ga0495630_0005244_5632_6441 269
88 3300046518 Ga0495631_0000299 Ga0495631_0000299_19548_20375 269
89 3300046524 Ga0495648_0028142 Ga0495648_0028142_790_1599 269
90 3300046526 Ga0495666_0000650 Ga0495666_0000650_12779_13588 269
91 3300046526 Ga0495666_0019879 Ga0495666_0019879_535_1344 269
92 3300046526 Ga0495666_0127234 Ga0495666_0127234_152_961 269
93 3300046529 Ga0495652_0002143 Ga0495652_0002143_7818_8627 269
94 3300046529 Ga0495652_0019319 Ga0495652_0019319_2614_3429 269
95 3300046531 Ga0495665_0001588 Ga0495665_0001588_10089_10898 269
96 3300046531 Ga0495665_0013629 Ga0495665_0013629_1191_2000 269
97 3300046533 Ga0495640_0030164 Ga0495640_0030164_513_1322 269
98 3300046535 Ga0495586_0000504 Ga0495586_0000504_12697_13506 269
99 3300046538 Ga0495609_0000262 Ga0495609_0000262_1251_2069 269
100 3300046543 Ga0495645_0022372 Ga0495645_0022372_2325_3134 269
101 3300046558 Ga0495633_0001202 Ga0495633_0001202_6143_6961 269
102 3300046642 Ga0495634_0028798 Ga0495634_0028798_2571_3380 269
103 3300046663 Ga0495635_0001553 Ga0495635_0001553_966_1775 269
104 3300046663 Ga0495635_0077563 Ga0495635_0077563_626_1435 269
105 3300046665 Ga0495661_0002251 Ga0495661_0002251_12921_13730 269
106 3300046665 Ga0495661_0032908 Ga0495661_0032908_32_841 269
107 3300046678 Ga0495599_0023308 Ga0495599_0023308_1800_2609 269
108 3300046678 Ga0495599_0162617 Ga0495599_0162617_77_886 269
109 3300046679 Ga0495623_0024707 Ga0495623_0024707_34_843 269
110 3300046679 Ga0495623_0200001 Ga0495623_0200001_209_1018 269
111 3300046680 Ga0495646_0000526 Ga0495646_0000526_12617_13426 269
112 3300046680 Ga0495646_0002594 Ga0495646_0002594_3212_4021 269
113 3300046689 Ga0495613_0117480 Ga0495613_0117480_77_886 269
114 3300046690 Ga0495624_0002978 Ga0495624_0002978_2665_3474 269
115 3300046690 Ga0495624_0004754 Ga0495624_0004754_2639_3448 269
116 3300046691 Ga0495670_0092863 Ga0495670_0092863_531_1340 269
117 3300046692 Ga0495671_0001364 Ga0495671_0001364_9930_10748 269
118 3300046692 Ga0495671_0104552 Ga0495671_0104552_195_1004 269
119 3300046694 Ga0495649_0006060 Ga0495649_0006060_4722_5531 269
120 3300046794 Ga0495589_0034056 Ga0495589_0034056_953_1762 269
121 3300046809 Ga0495600_0053002 Ga0495600_0053002_673_1482 269
122 3300046809 Ga0495600_0097465 Ga0495600_0097465_265_1074 269
123 3300046810 Ga0495660_0086778 Ga0495660_0086778_33_842 269
124 3300047315 Ga0495581_0057555 Ga0495581_0057555_201_1010 269
125 3300047317 Ga0495604_0000827 Ga0495604_0000827_17052_17861 269
126 3300047317 Ga0495604_0046214 Ga0495604_0046214_1997_2806 269
127 3300047319 Ga0495674_0013121 Ga0495674_0013121_5086_5895 269
128 3300047319 Ga0495674_0098156 Ga0495674_0098156_463_1272 269
129 3300047319 Ga0495674_0402003 Ga0495674_0402003_174_983 269
130 3300047321 Ga0495676_0041812 Ga0495676_0041812_2291_3100 269
131 3300047321 Ga0495676_0079878 Ga0495676_0079878_1135_1944 269
132 3300047321 Ga0495676_0111653 Ga0495676_0111653_515_1324 269
133 3300047322 Ga0495680_0003077 Ga0495680_0003077_14442_15251 269
134 3300047322 Ga0495680_0005574 Ga0495680_0005574_4338_5147 269
135 3300047322 Ga0495680_0017875 Ga0495680_0017875_3424_4233 269
136 3300047323 Ga0495683_0000991 Ga0495683_0000991_3486_4295 269
137 3300047323 Ga0495683_0004148 Ga0495683_0004148_6330_7139 269
138 3300047443 Ga0495687_010083 Ga0495687_010083_1556_2365 269
139 3300047444 Ga0495675_0002573 Ga0495675_0002573_8030_8839 269
140 3300047446 Ga0495679_000326 Ga0495679_000326_19589_20398 269
141 3300047446 Ga0495679_004275 Ga0495679_004275_4831_5640 269
142 3300047469 Ga0495673_0009998 Ga0495673_0009998_1892_2701 269
143 3300047471 Ga0495684_0249667 Ga0495684_0249667_15_824 269
144 3300047673 Ga0495593_0014920 Ga0495593_0014920_2711_3520 269
145 3300047673 Ga0495593_0025267 Ga0495593_0025267_1335_2144 269
146 3300048088 Ga0495602_0002520 Ga0495602_0002520_5581_6390 269
147 3300048088 Ga0495602_0027973 Ga0495602_0027973_3730_4539 269
148 3300048089 Ga0495614_0004449 Ga0495614_0004449_2205_3014 269
149 3300048089 Ga0495614_0010303 Ga0495614_0010303_2020_2829 269
150 3300048089 Ga0495614_0022552 Ga0495614_0022552_1819_2628 269
151 3300048920 Ga0496117_0001908 Ga0496117_0001908_22687_23505 269
152 3300048924 Ga0496121_0026500 Ga0496121_0026500_1375_2193 269
153 3300049460 Ga0495682_0000080 Ga0495682_0000080_74652_75470 269
154 3300049460 Ga0495682_0112238 Ga0495682_0112238_14_823 269
155 3300025263 Ga0209565_1000348 Ga0209565_100034822 270
156 3300025299 Ga0209256_1037648 Ga0209256_10376482 270
157 3300032005 Ga0307411_10376706 Ga0307411_103767062 270
158 3300048091 Ga0495626_0017704 Ga0495626_0017704_1819_2631 270
159 3300049130 Ga0501310_005139 Ga0501310_005139_318_1130 270
160 3300049460 Ga0495682_0000723 Ga0495682_0000723_19486_20298 270
161 3300049679 Ga0501249_000818 Ga0501249_000818_3447_4259 270
162 iso_pu_bacteria 2511231020 2511349715 270
163 iso_pu_bacteria 2643221638 2644216681 270
164 iso_pu_bacteria 2784132063 2784263274 270
165 iso_pu_bacteria 8056155041 8056155069 270
166 3300046472 Ga0495580_0038922 Ga0495580_0038922_1167_1982 271
167 3300046522 Ga0495643_0000897 Ga0495643_0000897_22209_23030 271
168 3300047469 Ga0495673_0000903 Ga0495673_0000903_9115_9930 271
169 3300048928 Ga0496125_0006871 Ga0496125_0006871_3566_4387 271
170 3300053177 Ga0500636_0001254 Ga0500636_0001254_8342_9160 271
171 3300009011 Ga0105251_10007045 Ga0105251_100070452 272
172 3300009036 Ga0105244_10029797 Ga0105244_100297973 272
173 3300009092 Ga0105250_10034637 Ga0105250_100346372 272
174 3300015265 Ga0182005_1000014 Ga0182005_100001446 272
175 3300048919 Ga0496116_0011933 Ga0496116_0011933_3350_4168 272
176 3300048920 Ga0496117_0000009 Ga0496117_0000009_282962_283780 272
177 3300048921 Ga0496118_0000017 Ga0496118_0000017_218648_219466 272
178 3300048925 Ga0496122_0000847 Ga0496122_0000847_23081_23905 272
179 3300048925 Ga0496122_0003083 Ga0496122_0003083_1334_2152 272
180 3300048926 Ga0496123_0000811 Ga0496123_0000811_42913_43731 272
181 3300048926 Ga0496123_0022133 Ga0496123_0022133_3621_4445 272
182 3300048927 Ga0496124_0012068 Ga0496124_0012068_3213_4031 272
183 3300003773 Ga0055537_1001860 Ga0055537_10018602 273
184 3300003791 Ga0055530_10000283 Ga0055530_1000028342 273
185 3300013100 Ga0157373_10000759 Ga0157373_1000075916 273
186 3300025263 Ga0209565_1001005 Ga0209565_100100511 273
187 3300025298 Ga0209050_1000271 Ga0209050_100027179 273
188 3300025299 Ga0209256_1005349 Ga0209256_10053491 273
189 3300025735 Ga0207713_1002635 Ga0207713_10026359 273
190 3300046452 Ga0495617_017982 Ga0495617_017982_1395_2216 273
191 3300046457 Ga0495590_0021055 Ga0495590_0021055_803_1624 273
192 3300046458 Ga0495591_006365 Ga0495591_006365_2795_3616 273
193 3300046460 Ga0495638_0000868 Ga0495638_0000868_23230_24051 273
194 3300046471 Ga0495650_0007927 Ga0495650_0007927_4564_5385 273
195 3300046474 Ga0495605_0001027 Ga0495605_0001027_12185_13006 273
196 3300046499 Ga0495594_0046349 Ga0495594_0046349_161_982 273
197 3300046506 Ga0495583_0002001 Ga0495583_0002001_12268_13089 273
198 3300046512 Ga0495610_0022145 Ga0495610_0022145_2465_3286 273
199 3300046513 Ga0495616_0040686 Ga0495616_0040686_426_1247 273
200 3300046515 Ga0495620_0000025 Ga0495620_0000025_119110_119931 273
201 3300046518 Ga0495631_0001870 Ga0495631_0001870_9436_10257 273
202 3300046520 Ga0495637_0003599 Ga0495637_0003599_2319_3140 273
203 3300046524 Ga0495648_0035042 Ga0495648_0035042_2033_2854 273
204 3300046530 Ga0495654_0001495 Ga0495654_0001495_4879_5700 273
205 3300046538 Ga0495609_0000073 Ga0495609_0000073_102013_102834 273
206 3300046542 Ga0495597_0000305 Ga0495597_0000305_5568_6389 273
207 3300046558 Ga0495633_0000078 Ga0495633_0000078_89156_89977 273
208 3300046665 Ga0495661_0000087 Ga0495661_0000087_78195_79016 273
209 3300046794 Ga0495589_0000525 Ga0495589_0000525_5275_6096 273
210 3300046810 Ga0495660_0036272 Ga0495660_0036272_296_1117 273
211 3300047323 Ga0495683_0001332 Ga0495683_0001332_10310_11131 273
212 3300047446 Ga0495679_001561 Ga0495679_001561_4930_5751 273
213 3300047470 Ga0495681_0004815 Ga0495681_0004815_3188_4009 273
214 3300048926 Ga0496123_0016191 Ga0496123_0016191_4344_5165 273
215 3300049459 Ga0495678_000073 Ga0495678_000073_118933_119754 273
216 3300053125 Ga0500618_002755 Ga0500618_002755_185_1006 273
217 3300003771 Ga0055526_1002209 Ga0055526_10022099 274
218 3300003790 Ga0055528_1012818 Ga0055528_10128184 274
219 3300009011 Ga0105251_10004073 Ga0105251_100040734 274
220 3300013104 Ga0157370_10002586 Ga0157370_1000258612 274
221 3300013105 Ga0157369_10216302 Ga0157369_102163022 274
222 3300014497 Ga0182008_10001249 Ga0182008_1000124912 274
223 3300015261 Ga0182006_1000707 Ga0182006_100070714 274
224 3300015265 Ga0182005_1000325 Ga0182005_10003255 274
225 3300025263 Ga0209565_1000439 Ga0209565_10004399 274
226 3300025273 Ga0209673_1002992 Ga0209673_10029928 274
227 3300025295 Ga0209564_1001062 Ga0209564_10010629 274
228 3300025728 Ga0207655_1001579 Ga0207655_10015795 274
229 3300025735 Ga0207713_1000073 Ga0207713_1000073112 274
230 3300025735 Ga0207713_1000614 Ga0207713_100061416 274
231 3300031548 Ga0307408_100002453 Ga0307408_10000245310 274
232 3300031911 Ga0307412_10008850 Ga0307412_100088502 274
233 3300032005 Ga0307411_10010999 Ga0307411_100109995 274
234 3300041405 Ga0439438_017264 Ga0439438_017264_1227_2066 274
235 3300042006 Ga0439432_000099 Ga0439432_000099_17516_18340 274
236 3300042115 Ga0450911_000103 Ga0450911_000103_22023_22847 274
237 3300046453 Ga0495627_004515 Ga0495627_004515_3656_4480 274
238 3300046455 Ga0495603_0000188 Ga0495603_0000188_5078_5908 274
239 3300046458 Ga0495591_002361 Ga0495591_002361_6313_7137 274
240 3300046474 Ga0495605_0000484 Ga0495605_0000484_18866_19690 274
241 3300046474 Ga0495605_0053306 Ga0495605_0053306_404_1228 274
242 3300046492 Ga0495585_0001976 Ga0495585_0001976_2246_3088 274
243 3300046492 Ga0495585_0004263 Ga0495585_0004263_6667_7491 274
244 3300046500 Ga0495596_0000283 Ga0495596_0000283_27078_27902 274
245 3300046501 Ga0495607_0000882 Ga0495607_0000882_7097_7936 274
246 3300046501 Ga0495607_0023687 Ga0495607_0023687_1824_2648 274
247 3300046506 Ga0495583_0000867 Ga0495583_0000867_19776_20600 274
248 3300046506 Ga0495583_0001402 Ga0495583_0001402_12625_13449 274
249 3300046507 Ga0495606_0000722 Ga0495606_0000722_13770_14594 274
250 3300046507 Ga0495606_0002756 Ga0495606_0002756_10518_11342 274
251 3300046513 Ga0495616_0022570 Ga0495616_0022570_1789_2613 274
252 3300046515 Ga0495620_0052334 Ga0495620_0052334_162_986 274
253 3300046516 Ga0495628_0203140 Ga0495628_0203140_119_958 274
254 3300046518 Ga0495631_0013984 Ga0495631_0013984_1579_2403 274
255 3300046519 Ga0495632_0003475 Ga0495632_0003475_9382_10206 274
256 3300046519 Ga0495632_0013362 Ga0495632_0013362_737_1561 274
257 3300046520 Ga0495637_0000064 Ga0495637_0000064_43490_44314 274
258 3300046522 Ga0495643_0083044 Ga0495643_0083044_706_1530 274
259 3300046523 Ga0495644_0004951 Ga0495644_0004951_2532_3356 274
260 3300046526 Ga0495666_0010571 Ga0495666_0010571_3139_3978 274
261 3300046530 Ga0495654_0000487 Ga0495654_0000487_9404_10237 274
262 3300046530 Ga0495654_0015556 Ga0495654_0015556_2165_2989 274
263 3300046536 Ga0495587_0000318 Ga0495587_0000318_23879_24718 274
264 3300046538 Ga0495609_0000161 Ga0495609_0000161_50249_51073 274
265 3300046648 Ga0495611_0000395 Ga0495611_0000395_2257_3081 274
266 3300046660 Ga0495625_0000194 Ga0495625_0000194_45887_46711 274
267 3300046663 Ga0495635_0000131 Ga0495635_0000131_14641_15480 274
268 3300046665 Ga0495661_0000233 Ga0495661_0000233_51967_52791 274
269 3300046665 Ga0495661_0002189 Ga0495661_0002189_1823_2647 274
270 3300046679 Ga0495623_0001154 Ga0495623_0001154_729_1568 274
271 3300046680 Ga0495646_0019612 Ga0495646_0019612_1109_1948 274
272 3300046689 Ga0495613_0203457 Ga0495613_0203457_313_1152 274
273 3300046691 Ga0495670_0000159 Ga0495670_0000159_17668_18510 274
274 3300046692 Ga0495671_0052792 Ga0495671_0052792_71_895 274
275 3300046692 Ga0495671_0079371 Ga0495671_0079371_737_1561 274
276 3300046694 Ga0495649_0099044 Ga0495649_0099044_577_1401 274
277 3300046794 Ga0495589_0000809 Ga0495589_0000809_3868_4707 274
278 3300046809 Ga0495600_0054414 Ga0495600_0054414_1676_2515 274
279 3300046810 Ga0495660_0027232 Ga0495660_0027232_1722_2546 274
280 3300046810 Ga0495660_0027233 Ga0495660_0027233_689_1513 274
281 3300047317 Ga0495604_0065969 Ga0495604_0065969_1102_1941 274
282 3300047319 Ga0495674_0004354 Ga0495674_0004354_12094_12933 274
283 3300047320 Ga0495672_0047521 Ga0495672_0047521_635_1459 274
284 3300047320 Ga0495672_0052509 Ga0495672_0052509_1345_2169 274
285 3300047321 Ga0495676_0000052 Ga0495676_0000052_50324_51148 274
286 3300047322 Ga0495680_0000664 Ga0495680_0000664_2920_3759 274
287 3300047323 Ga0495683_0000619 Ga0495683_0000619_3144_3983 274
288 3300047323 Ga0495683_0001295 Ga0495683_0001295_9363_10202 274
289 3300047323 Ga0495683_0038988 Ga0495683_0038988_502_1326 274
290 3300047446 Ga0495679_000136 Ga0495679_000136_26268_27092 274
291 3300047446 Ga0495679_029204 Ga0495679_029204_802_1626 274
292 3300047469 Ga0495673_0007363 Ga0495673_0007363_396_1220 274
293 3300047469 Ga0495673_0007586 Ga0495673_0007586_3587_4411 274
294 3300047469 Ga0495673_0026722 Ga0495673_0026722_1415_2239 274
295 3300047470 Ga0495681_0004449 Ga0495681_0004449_2080_2904 274
296 3300047470 Ga0495681_0016909 Ga0495681_0016909_1699_2523 274
297 3300047472 Ga0495686_0019308 Ga0495686_0019308_701_1525 274
298 3300047673 Ga0495593_0000168 Ga0495593_0000168_12690_13529 274
299 3300048091 Ga0495626_0000126 Ga0495626_0000126_50286_51110 274
300 3300048091 Ga0495626_0000621 Ga0495626_0000621_24315_25148 274
301 3300048915 Ga0496112_0361247 Ga0496112_0361247_452_1276 274
302 3300048919 Ga0496116_0001011 Ga0496116_0001011_11985_12809 274
303 3300048920 Ga0496117_0001649 Ga0496117_0001649_18887_19711 274
304 3300048921 Ga0496118_0001895 Ga0496118_0001895_17334_18158 274
305 3300048921 Ga0496118_0030613 Ga0496118_0030613_3580_4404 274
306 3300048922 Ga0496119_0001204 Ga0496119_0001204_10270_11094 274
307 3300048923 Ga0496120_0001293 Ga0496120_0001293_20197_21021 274
308 3300048924 Ga0496121_0001685 Ga0496121_0001685_21163_22002 274
309 3300048924 Ga0496121_0002045 Ga0496121_0002045_16438_17262 274
310 3300048924 Ga0496121_0004065 Ga0496121_0004065_2628_3452 274
311 3300048925 Ga0496122_0000434 Ga0496122_0000434_37033_37857 274
312 3300048925 Ga0496122_0040483 Ga0496122_0040483_2759_3583 274
313 3300048925 Ga0496122_0041179 Ga0496122_0041179_606_1445 274
314 3300048926 Ga0496123_0000318 Ga0496123_0000318_49680_50504 274
315 3300048926 Ga0496123_0013321 Ga0496123_0013321_2495_3334 274
316 3300048926 Ga0496123_0033459 Ga0496123_0033459_2829_3653 274
317 3300048927 Ga0496124_0007001 Ga0496124_0007001_11194_12018 274
318 3300048927 Ga0496124_0011728 Ga0496124_0011728_2630_3469 274
319 3300049459 Ga0495678_026067 Ga0495678_026067_123_947 274
320 3300049460 Ga0495682_0000466 Ga0495682_0000466_16151_16996 274
321 3300053125 Ga0500618_002927 Ga0500618_002927_1135_1977 274
322 3300053126 Ga0500621_000036 Ga0500621_000036_15822_16655 274
323 3300003322 rootL2_10275864 rootL2_102758642 276
324 3300046491 Ga0495584_0007196 Ga0495584_0007196_1750_2586 276
325 3300046500 Ga0495596_0000781 Ga0495596_0000781_12329_13165 276
326 3300046506 Ga0495583_0106614 Ga0495583_0106614_135_971 276
327 3300046518 Ga0495631_0003654 Ga0495631_0003654_822_1658 276
328 3300046522 Ga0495643_0078204 Ga0495643_0078204_833_1669 276
329 3300046523 Ga0495644_0039028 Ga0495644_0039028_178_1014 276
330 3300046538 Ga0495609_0005620 Ga0495609_0005620_5469_6305 276
331 3300046557 Ga0495622_0052398 Ga0495622_0052398_577_1413 276
332 3300046648 Ga0495611_0029437 Ga0495611_0029437_902_1738 276
333 3300047469 Ga0495673_0056966 Ga0495673_0056966_448_1284 276
334 iso_pu_bacteria 8057798959 8057805174 276

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00535

Glycos_transf_2

Glycosyl transferase family 2

54

220

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
5mm0-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp-mannose and mn2+ (donor complex) 0.7177 37 267
7pdo-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp 0.7174 15 276
5mm1-assembly1.cif.gz_A dolichyl phosphate mannose synthase in complex with gdp and dolichyl phosphate mannose 0.7151 37 263
5eke-assembly1.cif.gz_D structure of the polyisoprenyl-phosphate glycosyltransferase gtrb (f215a mutant) 0.7144 37 270
7pe4-assembly1.cif.gz_A-2 crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 5.5 in complex with udp-glucose 0.7114 15 276
ID Description Score Start End Superfamily
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8518 36 265 3.90.550.10
af_O53493_586_855_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8484 33 272 3.90.550.10
af_P9WMY1_2_214_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8336 36 265 3.90.550.10
af_Q58619_2_238_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.816 36 268 3.90.550.10
af_Q57964_2_229_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8035 39 270 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4D6U7H3-F1-model_v4 Glycosyltransferase family 2 protein 0.9931 10 276 GO:0004582
GO:0009247
GO:0016020
AF-A0A263NYG1-F1-model_v4 Glycosyl transferase family 2 0.9862 24 276 GO:0004582
GO:0009247
GO:0016020
AF-A0A1I7Z4H5-F1-model_v4 Glyco_trans_2-like domain-containing protein 0.9834 57 275 GO:0016020
AF-A0A839B8H7-F1-model_v4 deleted 0.9829 8 276
AF-A0A828R855-F1-model_v4 deleted 0.9826 57 274

Feature Viewer

pLDDT pTM Quality
91.62 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map