F411948

General Info

Members Datasets Scaffolds Average Seq Length
334 182 668 401

Family's Representative Sequence

Representative Sequence 3300047317|Ga0495604_0084212|Ga0495604_0084212_448_1659
Length 403
Sequence LSGTSRPAVHQVLATLGYGDAIGHEVLGIQRVLRSAGYCSDIFVETVDPRLESLTRDYRELVDASLLDNLLLHHFSIGSKASRTAYALPDRMALIYHNITPPEYFAAVHRTLARQCFRGRREIHAYIDRCDLALGDSEFNRQDLESFGFPRTAVLPVVPDLSHLDDPADWFTARQFDDDWTNILFVGRVIGNKKIEDLIRMFHAYQLFNPRSRLLIVGVFSVFERYFAALTHLVQTLQLTNVHFVGHVSDAELVAYYEAADLFLCASEHEGFCVPLVEAFYKEIPVLAYAATAVPATMDGAGVLYDDKEPSQVAALMNAIVSNPDLQDEIVEGQLAAVDRLQARDFDGTLLGFVNQMLNAPRRGAPRVAFDFWHQFDASEELEEIRMYRPGAFKALPEQSAHE

Samples

Sample ID Description Type Environment
1 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
47 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
122 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
123 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
124 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
125 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
128 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
129 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
132 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
133 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
144 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
160 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
161 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
162 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
163 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
164 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
165 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
166 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
171 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
174 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
177 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
178 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
179 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
180 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
181 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
182 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.29
Nodule 0
Rhizoplane 3.29
Rhizosphere 93.11
Stem 0
Stem Tuber 0
Unclassified 11.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495604_0084212 3300047317 Bacteria 2375
2 JGI24751J29686_10001158 3300002459 Bacteria 5643
3 Ga0065712_10069564 3300005290 Bacteria 7049
4 Ga0065712_10112912 3300005290 Unclassified 1792
5 Ga0065715_10093452 3300005293 Bacteria 4668
6 Ga0070676_10003674 3300005328 Bacteria 8035
7 Ga0068869_100084744 3300005334 Unclassified 2373
8 Ga0068868_100268487 3300005338 Bacteria 1441
9 Ga0070691_10000294 3300005341 Bacteria 17412
10 Ga0070668_100065317 3300005347 Bacteria 2823
11 Ga0070669_100015230 3300005353 Bacteria 5477
12 Ga0070675_100001360 3300005354 Bacteria 17903
13 Ga0070675_100012972 3300005354 Bacteria 6542
14 Ga0070675_100038041 3300005354 Unclassified 3920
15 Ga0070675_100186786 3300005354 Bacteria 1794
16 Ga0070671_100088698 3300005355 Bacteria 2588
17 Ga0070674_100005846 3300005356 Bacteria 7151
18 Ga0070673_100005813 3300005364 Bacteria 7946
19 Ga0070673_100063434 3300005364 Bacteria 2940
20 Ga0070709_10091256 3300005434 Bacteria 2010
21 Ga0070714_100084970 3300005435 Bacteria 2763
22 Ga0070701_10000954 3300005438 Bacteria 10486
23 Ga0070705_100007126 3300005440 Bacteria 5501
24 Ga0070700_100032499 3300005441 Bacteria 3136
25 Ga0070694_100010847 3300005444 Bacteria 5637
26 Ga0070694_100016235 3300005444 Bacteria 4686
27 Ga0070694_100029734 3300005444 Bacteria 3568
28 Ga0070694_100065175 3300005444 Bacteria 2495
29 Ga0070708_100066959 3300005445 Bacteria 3224
30 Ga0070678_100010782 3300005456 Bacteria 5601
31 Ga0070681_10020649 3300005458 Bacteria 6599
32 Ga0068867_100003453 3300005459 Bacteria 11115
33 Ga0068867_100108634 3300005459 Bacteria 2128
34 Ga0070707_100066963 3300005468 Bacteria 3453
35 Ga0070698_100015389 3300005471 Bacteria 8083
36 Ga0070699_100000613 3300005518 Bacteria 33675
37 Ga0070699_100107378 3300005518 Unclassified 2449
38 Ga0070697_100186786 3300005536 Bacteria 1758
39 Ga0070697_100219548 3300005536 Bacteria 1620
40 Ga0070686_100070426 3300005544 Bacteria 2287
41 Ga0070695_100004151 3300005545 Bacteria 8466
42 Ga0070695_100007884 3300005545 Bacteria 6305
43 Ga0070695_100021445 3300005545 Unclassified 3954
44 Ga0070696_100006167 3300005546 Bacteria 8009
45 Ga0070665_100002176 3300005548 Bacteria 21848
46 Ga0070665_100022887 3300005548 Bacteria 6291
47 Ga0070665_100199286 3300005548 Bacteria 2003
48 Ga0070704_100004365 3300005549 Bacteria 8169
49 Ga0068855_100039380 3300005563 Bacteria 5611
50 Ga0070664_100293840 3300005564 Unclassified 1467
51 Ga0068856_100003319 3300005614 Bacteria 16347
52 Ga0068859_100002499 3300005617 Bacteria 18697
53 Ga0068859_100003307 3300005617 Bacteria 16387
54 Ga0068859_100038345 3300005617 Bacteria 4808
55 Ga0068859_100112737 3300005617 Unclassified 2783
56 Ga0068859_100243794 3300005617 Bacteria 1887
57 Ga0068864_100002493 3300005618 Bacteria 15218
58 Ga0068864_100021764 3300005618 Bacteria 5371
59 Ga0068864_100062607 3300005618 Archaea 3223
60 Ga0068864_100121722 3300005618 Bacteria 2334
61 Ga0068866_10023611 3300005718 Bacteria 2863
62 Ga0068861_100000413 3300005719 Bacteria 24723
63 Ga0068861_100056445 3300005719 Unclassified 2998
64 Ga0068870_10105379 3300005840 Unclassified 1601
65 Ga0068863_100004381 3300005841 Bacteria 13919
66 Ga0068863_100025405 3300005841 Bacteria 5648
67 Ga0068863_100131965 3300005841 Bacteria 2385
68 Ga0068858_100007374 3300005842 Bacteria 10643
69 Ga0068858_100021865 3300005842 Bacteria 5974
70 Ga0068858_100179686 3300005842 Bacteria 1997
71 Ga0068858_100185363 3300005842 Archaea 1966
72 Ga0068858_100244583 3300005842 Bacteria 1703
73 Ga0068860_100014358 3300005843 Bacteria 7763
74 Ga0081455_10034298 3300005937 Bacteria 4550
75 Ga0075364_10003347 3300006051 Bacteria 9094
76 Ga0075362_10000228 3300006177 Bacteria 15674
77 Ga0075367_10010726 3300006178 Bacteria 4825
78 Ga0075366_10014275 3300006195 Bacteria 4536
79 Ga0075366_10027810 3300006195 Bacteria 3319
80 Ga0097621_100000956 3300006237 Bacteria 20258
81 Ga0097621_100157051 3300006237 Bacteria 1953
82 Ga0068871_100018930 3300006358 Bacteria 5247
83 Ga0068871_100030964 3300006358 Bacteria 4216
84 Ga0075428_100054654 3300006844 Bacteria 4375
85 Ga0075430_100006000 3300006846 Bacteria 10256
86 Ga0075431_100010127 3300006847 Bacteria 9474
87 Ga0075431_100022064 3300006847 Bacteria 6511
88 Ga0075433_10029406 3300006852 Bacteria 4681
89 Ga0075433_10030578 3300006852 Bacteria 4596
90 Ga0075434_100000878 3300006871 Bacteria 24045
91 Ga0075434_100001123 3300006871 Bacteria 22004
92 Ga0075434_100042830 3300006871 Bacteria 4489
93 Ga0075434_100108704 3300006871 Bacteria 2783
94 Ga0075434_100184342 3300006871 Bacteria 2108
95 Ga0075429_100000822 3300006880 Bacteria 24352
96 Ga0075429_100288749 3300006880 Bacteria 1436
97 Ga0068865_100005783 3300006881 Bacteria 7515
98 Ga0075436_100005877 3300006914 Bacteria 8428
99 Ga0075436_100006788 3300006914 Bacteria 7833
100 Ga0075436_100023673 3300006914 Unclassified 4218
101 Ga0097620_100002499 3300006931 Bacteria 18697
102 Ga0097620_100003307 3300006931 Bacteria 16387
103 Ga0097620_100038345 3300006931 Bacteria 4808
104 Ga0097620_100112739 3300006931 Unclassified 2783
105 Ga0097620_100243787 3300006931 Bacteria 1887
106 Ga0075435_100000346 3300007076 Bacteria 28639
107 Ga0075435_100000679 3300007076 Bacteria 21089
108 Ga0075435_100001110 3300007076 Bacteria 17145
109 Ga0075435_100004536 3300007076 Bacteria 9548
110 Ga0075435_100005712 3300007076 Bacteria 8721
111 Ga0075435_100035804 3300007076 Bacteria 3941
112 Ga0105240_10023069 3300009093 Bacteria 8242
113 Ga0111539_10002441 3300009094 Bacteria 24713
114 Ga0111539_10004791 3300009094 Bacteria 17654
115 Ga0111539_10011360 3300009094 Bacteria 11179
116 Ga0111539_10026229 3300009094 Bacteria 7130
117 Ga0111539_10047542 3300009094 Bacteria 5128
118 Ga0111539_10087554 3300009094 Unclassified 3658
119 Ga0105245_10007142 3300009098 Bacteria 9796
120 Ga0105247_10024236 3300009101 Bacteria 3656
121 Ga0114129_10000162 3300009147 Bacteria 71781
122 Ga0114129_10001494 3300009147 Bacteria 31640
123 Ga0114129_10004232 3300009147 Bacteria 20267
124 Ga0114129_10006811 3300009147 Bacteria 16229
125 Ga0114129_10010441 3300009147 Bacteria 13244
126 Ga0114129_10013735 3300009147 Bacteria 11544
127 Ga0114129_10052227 3300009147 Bacteria 5736
128 Ga0114129_10052603 3300009147 Bacteria 5716
129 Ga0114129_10078021 3300009147 Bacteria 4607
130 Ga0114129_10132370 3300009147 Bacteria 3424
131 Ga0114129_10138217 3300009147 Bacteria 3342
132 Ga0114129_10274957 3300009147 Unclassified 2252
133 Ga0105243_10006372 3300009148 Bacteria 9117
134 Ga0105243_10095870 3300009148 Bacteria 2453
135 Ga0105243_10339273 3300009148 Bacteria 1376
136 Ga0105242_10004909 3300009176 Bacteria 10351
137 Ga0105242_10007638 3300009176 Bacteria 8321
138 Ga0105242_10153838 3300009176 Bacteria 2007
139 Ga0105242_10232547 3300009176 Unclassified 1653
140 Ga0105248_10025387 3300009177 Bacteria 6588
141 Ga0105248_10027721 3300009177 Bacteria 6307
142 Ga0105248_10036771 3300009177 Bacteria 5476
143 Ga0105248_10059582 3300009177 Unclassified 4289
144 Ga0105248_10060873 3300009177 Bacteria 4239
145 Ga0105248_10062083 3300009177 Bacteria 4197
146 Ga0105248_10240872 3300009177 Bacteria 2036
147 Ga0157370_10238492 3300013104 Bacteria 1683
148 Ga0157374_10019407 3300013296 Bacteria 6017
149 Ga0157378_10245529 3300013297 Unclassified 1712
150 Ga0163162_10116981 3300013306 Bacteria 2767
151 Ga0157375_10137267 3300013308 Bacteria 2571
152 Ga0157375_10265954 3300013308 Bacteria 1876
153 Ga0163163_10006204 3300014325 Bacteria 10426
154 Ga0163163_10072633 3300014325 Bacteria 3430
155 Ga0163163_10231038 3300014325 Bacteria 1899
156 Ga0157380_10012449 3300014326 Bacteria 6172
157 Ga0157380_10188984 3300014326 Bacteria 1816
158 Ga0157380_10250705 3300014326 Bacteria 1602
159 Ga0157379_10001584 3300014968 Bacteria 18746
160 Ga0157379_10015695 3300014968 Bacteria 6656
161 Ga0157379_10051496 3300014968 Bacteria 3678
162 Ga0157379_10137436 3300014968 Bacteria 2202
163 Ga0157376_10018716 3300014969 Bacteria 5319
164 Ga0157376_10078938 3300014969 Bacteria 2820
165 Ga0157376_10090201 3300014969 Bacteria 2652
166 Ga0207697_10050341 3300025315 Unclassified 1720
167 Ga0207642_10020551 3300025899 Bacteria 2580
168 Ga0207680_10046564 3300025903 Bacteria 2564
169 Ga0207645_10003173 3300025907 Bacteria 12589
170 Ga0207643_10118291 3300025908 Unclassified 1567
171 Ga0207684_10082070 3300025910 Unclassified 2745
172 Ga0207707_10021944 3300025912 Bacteria 5580
173 Ga0207695_10030585 3300025913 Bacteria 5924
174 Ga0207657_10011279 3300025919 Bacteria 8877
175 Ga0207681_10032437 3300025923 Bacteria 3419
176 Ga0207681_10178897 3300025923 Unclassified 1614
177 Ga0207659_10016642 3300025926 Bacteria 4790
178 Ga0207659_10031518 3300025926 Unclassified 3630
179 Ga0207659_10074595 3300025926 Unclassified 2486
180 Ga0207659_10145394 3300025926 Unclassified 1846
181 Ga0207687_10026213 3300025927 Bacteria 3901
182 Ga0207706_10051971 3300025933 Bacteria 3618
183 Ga0207686_10001273 3300025934 Bacteria 14490
184 Ga0207686_10002822 3300025934 Bacteria 9383
185 Ga0207709_10021363 3300025935 Bacteria 3663
186 Ga0207709_10053544 3300025935 Bacteria 2484
187 Ga0207670_10111153 3300025936 Bacteria 1975
188 Ga0207669_10004136 3300025937 Bacteria 6360
189 Ga0207704_10002599 3300025938 Bacteria 8145
190 Ga0207691_10083490 3300025940 Bacteria 2868
191 Ga0207711_10009041 3300025941 Bacteria 8326
192 Ga0207661_10052665 3300025944 Bacteria 3253
193 Ga0207661_10136840 3300025944 Bacteria 2105
194 Ga0207651_10011390 3300025960 Bacteria 4979
195 Ga0207712_10095132 3300025961 Unclassified 2202
196 Ga0207668_10138605 3300025972 Bacteria 1867
197 Ga0207658_10032995 3300025986 Bacteria 3690
198 Ga0207703_10004455 3300026035 Bacteria 11505
199 Ga0207703_10004637 3300026035 Bacteria 11231
200 Ga0207703_10050728 3300026035 Unclassified 3360
201 Ga0207703_10073080 3300026035 Bacteria 2836
202 Ga0207708_10004571 3300026075 Bacteria 10190
203 Ga0207708_10088750 3300026075 Bacteria 2382
204 Ga0207702_10029439 3300026078 Bacteria 4569
205 Ga0207641_10002396 3300026088 Bacteria 17302
206 Ga0207648_10008956 3300026089 Bacteria 9627
207 Ga0207648_10040959 3300026089 Unclassified 4068
208 Ga0207648_10060083 3300026089 Bacteria 3315
209 Ga0207676_10006659 3300026095 Bacteria 8169
210 Ga0207676_10008855 3300026095 Bacteria 7162
211 Ga0207676_10062264 3300026095 Bacteria 2959
212 Ga0207676_10156178 3300026095 Archaea 1971
213 Ga0207674_10193069 3300026116 Bacteria 1986
214 Ga0207675_100000511 3300026118 Bacteria 37642
215 Ga0207675_100156781 3300026118 Bacteria 2170
216 Ga0207675_100220873 3300026118 Unclassified 1826
217 Ga0207428_10001623 3300027907 Bacteria 23347
218 Ga0207428_10027933 3300027907 Bacteria 4692
219 Ga0207428_10055815 3300027907 Bacteria 3139
220 Ga0268266_10002791 3300028379 Bacteria 18207
221 Ga0268266_10002943 3300028379 Bacteria 17587
222 Ga0268265_10269456 3300028380 Bacteria 1518
223 Ga0268264_10058341 3300028381 Bacteria 3232
224 Ga0307408_100003522 3300031548 Bacteria 10656
225 Ga0307405_10137007 3300031731 Unclassified 1701
226 Ga0307412_10039028 3300031911 Bacteria 3062
227 Ga0307416_100123411 3300032002 Bacteria 2315
228 Ga0307411_10016203 3300032005 Bacteria 4215
229 Ga0307411_10025916 3300032005 Bacteria 3521
230 Ga0373938_0000317 3300034957 Bacteria 7696
231 Ga0373940_0000040 3300035088 Bacteria 13934
232 Ga0373949_0000792 3300035090 Bacteria 10126
233 Ga0373949_0006688 3300035090 Bacteria 2532
234 Ga0373951_0001247 3300035091 Bacteria 6746
235 Ga0373952_0001510 3300035092 Bacteria 4235
236 Ga0373932_0000338 3300035112 Bacteria 14295
237 Ga0373939_0013148 3300035114 Bacteria 2123
238 Ga0373941_0005442 3300035115 Bacteria 2997
239 Ga0373941_0036202 3300035115 Bacteria 1500
240 Ga0373945_0011291 3300035116 Unclassified 2954
241 Ga0373960_0000070 3300035121 Bacteria 14646
242 Ga0373943_0078057 3300035170 Bacteria 1692
243 Ga0373942_0000050 3300035207 Bacteria 23361
244 Ga0373961_0000288 3300035241 Bacteria 22649
245 Ga0373931_0159801 3300035691 Bacteria 1320
246 Ga0373947_0097687 3300035725 Unclassified 1841
247 Ga0373937_0135330 3300036401 Unclassified 2304
248 Ga0373937_0139406 3300036401 Bacteria 2268
249 Ga0373925_0008342 3300037068 Bacteria 7543
250 Ga0436365_1921911 3300039437 Bacteria 4634
251 Ga0439464_0000358 3300042439 Bacteria 8850
252 Ga0453684_0017361 3300044712 Bacteria 11153
253 Ga0451576_0029209 3300045051 Bacteria 5900
254 Ga0495645_0117857 3300046543 Bacteria 1873
255 Ga0495647_0002504 3300046681 Bacteria 5823
256 Ga0495658_0136215 3300046683 Bacteria 1498
257 Ga0495674_0054907 3300047319 Bacteria 3496
258 Ga0496102_0046289 3300048905 Bacteria 3951
259 Ga0496104_0011320 3300048907 Bacteria 7986
260 Ga0496106_0067634 3300048909 Bacteria 2724
261 Ga0496106_0148564 3300048909 Unclassified 1847
262 Ga0496108_0019676 3300048911 Bacteria 5545
263 Ga0496109_0259521 3300048912 Bacteria 1637
264 Ga0496111_0113236 3300048914 Bacteria 1999
265 Ga0496112_0025191 3300048915 Bacteria 5709
266 Ga0496113_0028840 3300048916 Bacteria 3997
267 Ga0496113_0073022 3300048916 Unclassified 2613
268 Ga0496115_0263395 3300048918 Unclassified 1417
269 Ga0501291_009926 3300049514 Bacteria 1344
270 Ga0501034_0021267 3300049571 Bacteria 6615
271 Ga0501034_0054871 3300049571 Bacteria 4011
272 Ga0501034_0317079 3300049571 Unclassified 1492
273 Ga0501042_0094611 3300049578 Bacteria 2146
274 Ga0501047_0042062 3300049581 Bacteria 4416
275 Ga0501070_0278266 3300049586 Bacteria 1366
276 Ga0501071_0148980 3300049587 Bacteria 1745
277 Ga0501072_0001720 3300049588 Bacteria 16307
278 Ga0501073_0003695 3300049589 Bacteria 11493
279 Ga0501076_0094299 3300049592 Bacteria 2410
280 Ga0501076_0140422 3300049592 Bacteria 1962
281 Ga0501081_0030001 3300049743 Bacteria 3678
282 Ga0501044_0006469 3300049823 Bacteria 12941
283 nmdc:mga0k408_23614_c1 3300050493 Bacteria 3471
284 nmdc:mga0k408_4829_c2 3300050493 Bacteria 3087
285 nmdc:mga0k408_54210_c1 3300050493 Bacteria 2324
286 nmdc:mga05p37_100703_c1 3300050507 Bacteria 3559
287 nmdc:mga05p37_10810_c1 3300050507 Bacteria 10836
288 nmdc:mga05p37_11594_c1 3300050507 Bacteria 10504
289 nmdc:mga05p37_17045_c1 3300050507 Bacteria 8761
290 nmdc:mga05p37_25261_c1 3300050507 Bacteria 7225
291 nmdc:mga05p37_26005_c1 3300050507 Bacteria 7116
292 nmdc:mga05p37_3259_c1 3300050507 Bacteria 18905
293 nmdc:mga05p37_369002_c1 3300050507 Bacteria 1685
294 nmdc:mga05p37_38670_c1 3300050507 Bacteria 5063
295 nmdc:mga05p37_41318_c1 3300050507 Bacteria 5661
296 nmdc:mga05p37_4435_c1 3300050507 Bacteria 16400
297 nmdc:mga05p37_53213_c1 3300050507 Unclassified 4978
298 nmdc:mga05p37_53_c1 3300050507 Bacteria 102685
299 nmdc:mga05p37_67575_c1 3300050507 Bacteria 4397
300 nmdc:mga05p37_86438_c1 3300050507 Bacteria 3865
301 nmdc:mga09592_2041_c1 3300050508 Bacteria 16282
302 nmdc:mga09592_257076_c1 3300050508 Bacteria 1514
303 nmdc:mga0qj67_2885_c1 3300050509 Bacteria 12341
304 nmdc:mga06r32_4790_c1 3300050510 Bacteria 12175
305 nmdc:mga08y16_110170_c1 3300050511 Bacteria 2867
306 nmdc:mga08y16_12198_c1 3300050511 Bacteria 9034
307 nmdc:mga08y16_354068_c1 3300050511 Unclassified 1508
308 nmdc:mga08y16_44836_c1 3300050511 Bacteria 4635
309 nmdc:mga0n895_111376_c1 3300050512 Bacteria 2754
310 nmdc:mga0n895_26771_c1 3300050512 Bacteria 5468
311 nmdc:mga0n895_35_c1 3300050512 Bacteria 79696
312 nmdc:mga0n895_47326_c1 3300050512 Bacteria 4205
313 nmdc:mga0rr50_1059_c1 3300050513 Bacteria 14964
314 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
315 nmdc:mga0rr50_236837_c1 3300050513 Bacteria 1512
316 nmdc:mga0rr50_26143_c1 3300050513 Unclassified 4067
317 nmdc:mga0rr50_3418_c1 3300050513 Bacteria 9132
318 nmdc:mga0rr50_6467_c1 3300050513 Bacteria 4933
319 nmdc:mga08x19_27089_c1 3300050514 Bacteria 3583
320 nmdc:mga08x19_4860_c1 3300050514 Bacteria 7946
321 nmdc:mga0a205_12944_c1 3300050515 Bacteria 7741
322 nmdc:mga0a205_166781_c2 3300050515 Bacteria 1758
323 nmdc:mga0a205_174938_c1 3300050515 Bacteria 2042
324 nmdc:mga0a205_17656_c1 3300050515 Bacteria 6697
325 nmdc:mga0a205_226003_c1 3300050515 Unclassified 1756
326 nmdc:mga0a205_23179_c1 3300050515 Bacteria 5887
327 Ga0495619_0052427 3300053085 Unclassified 2697
328 Ga0500556_0006957 3300053104 Bacteria 3225
329 Ga0500568_0002144 3300053139 Bacteria 11906
330 Ga0500645_002654 3300053730 Bacteria 7804
331 Ga0501084_0051204 3300054114 Bacteria 3456
332 Ga0501084_0066551 3300054114 Bacteria 3015
333 Ga0501082_0112701 3300060353 Bacteria 2355
334 Ga0530510_0108745 3300061734 Bacteria 2030
335 Ga0495604_0084212
336 JGI24751J29686_10001158
337 Ga0065712_10069564
338 Ga0065712_10112912
339 Ga0065715_10093452
340 Ga0070676_10003674
341 Ga0068869_100084744
342 Ga0068868_100268487
343 Ga0070691_10000294
344 Ga0070668_100065317
345 Ga0070669_100015230
346 Ga0070675_100001360
347 Ga0070675_100012972
348 Ga0070675_100038041
349 Ga0070675_100186786
350 Ga0070671_100088698
351 Ga0070674_100005846
352 Ga0070673_100005813
353 Ga0070673_100063434
354 Ga0070709_10091256
355 Ga0070714_100084970
356 Ga0070701_10000954
357 Ga0070705_100007126
358 Ga0070700_100032499
359 Ga0070694_100010847
360 Ga0070694_100016235
361 Ga0070694_100029734
362 Ga0070694_100065175
363 Ga0070708_100066959
364 Ga0070678_100010782
365 Ga0070681_10020649
366 Ga0068867_100003453
367 Ga0068867_100108634
368 Ga0070707_100066963
369 Ga0070698_100015389
370 Ga0070699_100000613
371 Ga0070699_100107378
372 Ga0070697_100186786
373 Ga0070697_100219548
374 Ga0070686_100070426
375 Ga0070695_100004151
376 Ga0070695_100007884
377 Ga0070695_100021445
378 Ga0070696_100006167
379 Ga0070665_100002176
380 Ga0070665_100022887
381 Ga0070665_100199286
382 Ga0070704_100004365
383 Ga0068855_100039380
384 Ga0070664_100293840
385 Ga0068856_100003319
386 Ga0068859_100002499
387 Ga0068859_100003307
388 Ga0068859_100038345
389 Ga0068859_100112737
390 Ga0068859_100243794
391 Ga0068864_100002493
392 Ga0068864_100021764
393 Ga0068864_100062607
394 Ga0068864_100121722
395 Ga0068866_10023611
396 Ga0068861_100000413
397 Ga0068861_100056445
398 Ga0068870_10105379
399 Ga0068863_100004381
400 Ga0068863_100025405
401 Ga0068863_100131965
402 Ga0068858_100007374
403 Ga0068858_100021865
404 Ga0068858_100179686
405 Ga0068858_100185363
406 Ga0068858_100244583
407 Ga0068860_100014358
408 Ga0081455_10034298
409 Ga0075364_10003347
410 Ga0075362_10000228
411 Ga0075367_10010726
412 Ga0075366_10014275
413 Ga0075366_10027810
414 Ga0097621_100000956
415 Ga0097621_100157051
416 Ga0068871_100018930
417 Ga0068871_100030964
418 Ga0075428_100054654
419 Ga0075430_100006000
420 Ga0075431_100010127
421 Ga0075431_100022064
422 Ga0075433_10029406
423 Ga0075433_10030578
424 Ga0075434_100000878
425 Ga0075434_100001123
426 Ga0075434_100042830
427 Ga0075434_100108704
428 Ga0075434_100184342
429 Ga0075429_100000822
430 Ga0075429_100288749
431 Ga0068865_100005783
432 Ga0075436_100005877
433 Ga0075436_100006788
434 Ga0075436_100023673
435 Ga0097620_100002499
436 Ga0097620_100003307
437 Ga0097620_100038345
438 Ga0097620_100112739
439 Ga0097620_100243787
440 Ga0075435_100000346
441 Ga0075435_100000679
442 Ga0075435_100001110
443 Ga0075435_100004536
444 Ga0075435_100005712
445 Ga0075435_100035804
446 Ga0105240_10023069
447 Ga0111539_10002441
448 Ga0111539_10004791
449 Ga0111539_10011360
450 Ga0111539_10026229
451 Ga0111539_10047542
452 Ga0111539_10087554
453 Ga0105245_10007142
454 Ga0105247_10024236
455 Ga0114129_10000162
456 Ga0114129_10001494
457 Ga0114129_10004232
458 Ga0114129_10006811
459 Ga0114129_10010441
460 Ga0114129_10013735
461 Ga0114129_10052227
462 Ga0114129_10052603
463 Ga0114129_10078021
464 Ga0114129_10132370
465 Ga0114129_10138217
466 Ga0114129_10274957
467 Ga0105243_10006372
468 Ga0105243_10095870
469 Ga0105243_10339273
470 Ga0105242_10004909
471 Ga0105242_10007638
472 Ga0105242_10153838
473 Ga0105242_10232547
474 Ga0105248_10025387
475 Ga0105248_10027721
476 Ga0105248_10036771
477 Ga0105248_10059582
478 Ga0105248_10060873
479 Ga0105248_10062083
480 Ga0105248_10240872
481 Ga0157370_10238492
482 Ga0157374_10019407
483 Ga0157378_10245529
484 Ga0163162_10116981
485 Ga0157375_10137267
486 Ga0157375_10265954
487 Ga0163163_10006204
488 Ga0163163_10072633
489 Ga0163163_10231038
490 Ga0157380_10012449
491 Ga0157380_10188984
492 Ga0157380_10250705
493 Ga0157379_10001584
494 Ga0157379_10015695
495 Ga0157379_10051496
496 Ga0157379_10137436
497 Ga0157376_10018716
498 Ga0157376_10078938
499 Ga0157376_10090201
500 Ga0207697_10050341
501 Ga0207642_10020551
502 Ga0207680_10046564
503 Ga0207645_10003173
504 Ga0207643_10118291
505 Ga0207684_10082070
506 Ga0207707_10021944
507 Ga0207695_10030585
508 Ga0207657_10011279
509 Ga0207681_10032437
510 Ga0207681_10178897
511 Ga0207659_10016642
512 Ga0207659_10031518
513 Ga0207659_10074595
514 Ga0207659_10145394
515 Ga0207687_10026213
516 Ga0207706_10051971
517 Ga0207686_10001273
518 Ga0207686_10002822
519 Ga0207709_10021363
520 Ga0207709_10053544
521 Ga0207670_10111153
522 Ga0207669_10004136
523 Ga0207704_10002599
524 Ga0207691_10083490
525 Ga0207711_10009041
526 Ga0207661_10052665
527 Ga0207661_10136840
528 Ga0207651_10011390
529 Ga0207712_10095132
530 Ga0207668_10138605
531 Ga0207658_10032995
532 Ga0207703_10004455
533 Ga0207703_10004637
534 Ga0207703_10050728
535 Ga0207703_10073080
536 Ga0207708_10004571
537 Ga0207708_10088750
538 Ga0207702_10029439
539 Ga0207641_10002396
540 Ga0207648_10008956
541 Ga0207648_10040959
542 Ga0207648_10060083
543 Ga0207676_10006659
544 Ga0207676_10008855
545 Ga0207676_10062264
546 Ga0207676_10156178
547 Ga0207674_10193069
548 Ga0207675_100000511
549 Ga0207675_100156781
550 Ga0207675_100220873
551 Ga0207428_10001623
552 Ga0207428_10027933
553 Ga0207428_10055815
554 Ga0268266_10002791
555 Ga0268266_10002943
556 Ga0268265_10269456
557 Ga0268264_10058341
558 Ga0307408_100003522
559 Ga0307405_10137007
560 Ga0307412_10039028
561 Ga0307416_100123411
562 Ga0307411_10016203
563 Ga0307411_10025916
564 Ga0373938_0000317
565 Ga0373940_0000040
566 Ga0373949_0000792
567 Ga0373949_0006688
568 Ga0373951_0001247
569 Ga0373952_0001510
570 Ga0373932_0000338
571 Ga0373939_0013148
572 Ga0373941_0005442
573 Ga0373941_0036202
574 Ga0373945_0011291
575 Ga0373960_0000070
576 Ga0373943_0078057
577 Ga0373942_0000050
578 Ga0373961_0000288
579 Ga0373931_0159801
580 Ga0373947_0097687
581 Ga0373937_0135330
582 Ga0373937_0139406
583 Ga0373925_0008342
584 Ga0436365_1921911
585 Ga0439464_0000358
586 Ga0453684_0017361
587 Ga0451576_0029209
588 Ga0495645_0117857
589 Ga0495647_0002504
590 Ga0495658_0136215
591 Ga0495674_0054907
592 Ga0496102_0046289
593 Ga0496104_0011320
594 Ga0496106_0067634
595 Ga0496106_0148564
596 Ga0496108_0019676
597 Ga0496109_0259521
598 Ga0496111_0113236
599 Ga0496112_0025191
600 Ga0496113_0028840
601 Ga0496113_0073022
602 Ga0496115_0263395
603 Ga0501291_009926
604 Ga0501034_0021267
605 Ga0501034_0054871
606 Ga0501034_0317079
607 Ga0501042_0094611
608 Ga0501047_0042062
609 Ga0501070_0278266
610 Ga0501071_0148980
611 Ga0501072_0001720
612 Ga0501073_0003695
613 Ga0501076_0094299
614 Ga0501076_0140422
615 Ga0501081_0030001
616 Ga0501044_0006469
617 nmdc:mga0k408_23614_c1
618 nmdc:mga0k408_4829_c2
619 nmdc:mga0k408_54210_c1
620 nmdc:mga05p37_100703_c1
621 nmdc:mga05p37_10810_c1
622 nmdc:mga05p37_11594_c1
623 nmdc:mga05p37_17045_c1
624 nmdc:mga05p37_25261_c1
625 nmdc:mga05p37_26005_c1
626 nmdc:mga05p37_3259_c1
627 nmdc:mga05p37_369002_c1
628 nmdc:mga05p37_38670_c1
629 nmdc:mga05p37_41318_c1
630 nmdc:mga05p37_4435_c1
631 nmdc:mga05p37_53213_c1
632 nmdc:mga05p37_53_c1
633 nmdc:mga05p37_67575_c1
634 nmdc:mga05p37_86438_c1
635 nmdc:mga09592_2041_c1
636 nmdc:mga09592_257076_c1
637 nmdc:mga0qj67_2885_c1
638 nmdc:mga06r32_4790_c1
639 nmdc:mga08y16_110170_c1
640 nmdc:mga08y16_12198_c1
641 nmdc:mga08y16_354068_c1
642 nmdc:mga08y16_44836_c1
643 nmdc:mga0n895_111376_c1
644 nmdc:mga0n895_26771_c1
645 nmdc:mga0n895_35_c1
646 nmdc:mga0n895_47326_c1
647 nmdc:mga0rr50_1059_c1
648 nmdc:mga0rr50_1_c1
649 nmdc:mga0rr50_236837_c1
650 nmdc:mga0rr50_26143_c1
651 nmdc:mga0rr50_3418_c1
652 nmdc:mga0rr50_6467_c1
653 nmdc:mga08x19_27089_c1
654 nmdc:mga08x19_4860_c1
655 nmdc:mga0a205_12944_c1
656 nmdc:mga0a205_166781_c2
657 nmdc:mga0a205_174938_c1
658 nmdc:mga0a205_17656_c1
659 nmdc:mga0a205_226003_c1
660 nmdc:mga0a205_23179_c1
661 Ga0495619_0052427
662 Ga0500556_0006957
663 Ga0500568_0002144
664 Ga0500645_002654
665 Ga0501084_0051204
666 Ga0501084_0066551
667 Ga0501082_0112701
668 Ga0530510_0108745

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00534

Glycos_transf_1

Glycosyl transferases group 1

168

334

0.92

PF13692

Glyco_trans_1_4

Glycosyl transferases group 1

181

323

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8p1x-assembly1.cif.gz_AAA tarm(se)_g117r-udp-glucose 0.8214 47 348
5i45-assembly1.cif.gz_A 1.35 angstrom crystal structure of c-terminal domain of glycosyl transferase group 1 family protein (lpcc) from francisella tularensis. 0.8139 149 329
7qnt-assembly1.cif.gz_AAA tarm(se) native 0.792 47 348
7ec6-assembly1.cif.gz_A crystal structure of sdgb (complexed with peptides) 0.785 78 347
4xsu-assembly1.cif.gz_B crystal structure of anabaena alr3699/hepe in complex with udp and glucose 0.78 2 345
ID Description Score Start End Superfamily
5d00A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.9152 168 328 3.40.50.2000
af_G5ECB6_188_358_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8844 167 315 3.40.50.2000
af_Q96WW6_207_411_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8832 164 329 3.40.50.2000
af_Q2G0L3_321_481_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8787 174 332 3.40.50.2000
4x6lA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8776 169 329 3.40.50.2000
ID Description Score Start End GO Terms
AF-A0A7C4S2K9-F1-model_v4 Glycosyltransferase 0.9752 136 347 GO:0009103
GO:0016757
GO:0045226
AF-A0A7C1AUD8-F1-model_v4 Glycosyltransferase 0.9674 2 349 GO:0009103
GO:0016757
GO:0045226
AF-A0A7C4S2K9-F1-model_v4 Glycosyltransferase 0.9489 136 347 GO:0009103
GO:0016757
GO:0045226
AF-A0A3A9HR47-F1-model_v4 deleted 0.9457 2 347
AF-W2EBD5-F1-model_v4 deleted 0.9455 2 346

Map