F411923

General Info

Members Datasets Scaffolds Average Seq Length
334 179 333 319

Family's Representative Sequence

Representative Sequence 3300046459|Ga0495629_0021668|Ga0495629_0021668_365_1438
Length 357
Sequence MPELAKMRPRSLLSVMILRVLMRAGDLPGSKNVTLKRVKMKTLFVSILVTALASTVAAQDTKEFLGRWDITVTPATGKPYPQWMELTDNGGKIEGRVQPRGGAWHPITGAHMESGKLIVNVGEAGPGSAISWGLTSPSSGKLTGIEKRGDVAGPTLSGVKAPSLDRPMPKEWTRPKLLFNGKDLAGWEPIGNVDNNKWVARNGELVNDNPEVPGQRGHGAANIMTTEKFQDFKLHIEVNCPEGGNSGIYLRGRYELQVGTEGGKLPSHEMGAIYSYYPPPEGSEPGLGKWTTFDVTLVGRHVTVLRDGKMYHDNVELPGPTGGALDSNEAEPGPFYLQGDHHGVIAYRNITISVPKK

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
64 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
104 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
105 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
106 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
107 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
110 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
111 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
112 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
113 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
114 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
115 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
118 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
119 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
120 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
121 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
122 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
123 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
124 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
131 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
132 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
133 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
134 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
135 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
136 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
139 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
140 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
141 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
142 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
146 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
149 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
150 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
151 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
155 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
158 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
168 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
175 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
176 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
177 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
178 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
179 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0
Rhizoplane 0.6
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 2.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10089238 3300003316 Bacteria 3032
2 rootH2_10301638 3300003320 Bacteria 2063
3 Ga0070658_10000004 3300005327 Bacteria 402230
4 Ga0070658_10137432 3300005327 Bacteria 2040
5 Ga0070658_10262535 3300005327 Bacteria 1467
6 Ga0070683_100027570 3300005329 Bacteria 5124
7 Ga0070683_100068351 3300005329 Bacteria 3310
8 Ga0070683_100215450 3300005329 Bacteria 1824
9 Ga0070670_100086962 3300005331 Bacteria 2686
10 Ga0068869_100011044 3300005334 Bacteria 5915
11 Ga0070661_100008894 3300005344 Bacteria 6950
12 Ga0070661_100021864 3300005344 Bacteria 4575
13 Ga0070661_100023487 3300005344 Bacteria 4420
14 Ga0070671_100003934 3300005355 Bacteria 11686
15 Ga0070659_100026263 3300005366 Bacteria 4479
16 Ga0070667_100062258 3300005367 Bacteria 3160
17 Ga0070709_10034919 3300005434 Bacteria 3053
18 Ga0070663_100061591 3300005455 Bacteria 2702
19 Ga0070663_100350939 3300005455 Bacteria 1194
20 Ga0070681_10158130 3300005458 Bacteria 2190
21 Ga0070681_10426106 3300005458 Bacteria 1239
22 Ga0070706_100057870 3300005467 Bacteria 3577
23 Ga0070707_100380861 3300005468 Bacteria 1370
24 Ga0070698_100002026 3300005471 Bacteria 22531
25 Ga0070699_100075482 3300005518 Bacteria 2934
26 Ga0070679_100079466 3300005530 Bacteria 3269
27 Ga0070684_100001730 3300005535 Bacteria 15869
28 Ga0070684_100040266 3300005535 Bacteria 4023
29 Ga0070684_100183570 3300005535 Bacteria 1902
30 Ga0068853_100000312 3300005539 Bacteria 34246
31 Ga0068853_100206812 3300005539 Bacteria 1788
32 Ga0068853_100218064 3300005539 Bacteria 1741
33 Ga0070665_100075916 3300005548 Bacteria 3368
34 Ga0068855_100001672 3300005563 Bacteria 27748
35 Ga0068855_100001744 3300005563 Bacteria 27147
36 Ga0068855_100005084 3300005563 Bacteria 16037
37 Ga0068855_100012307 3300005563 Bacteria 10337
38 Ga0068855_100158943 3300005563 Bacteria 2566
39 Ga0068857_100000158 3300005577 Bacteria 42040
40 Ga0068857_100001733 3300005577 Bacteria 17545
41 Ga0068857_100030851 3300005577 Bacteria 4735
42 Ga0068857_100067875 3300005577 Bacteria 3174
43 Ga0068857_100273614 3300005577 Bacteria 1552
44 Ga0068857_100276142 3300005577 Bacteria 1545
45 Ga0068854_100017502 3300005578 Bacteria 4796
46 Ga0068856_100003329 3300005614 Bacteria 16329
47 Ga0068856_100020835 3300005614 Bacteria 6372
48 Ga0068856_100125981 3300005614 Bacteria 2564
49 Ga0068856_100263238 3300005614 Bacteria 1740
50 Ga0068856_100412397 3300005614 Bacteria 1371
51 Ga0068852_100000023 3300005616 Bacteria 120576
52 Ga0068852_100000650 3300005616 Bacteria 22747
53 Ga0068852_100081607 3300005616 Bacteria 2871
54 Ga0068852_100084160 3300005616 Bacteria 2830
55 Ga0068859_100052544 3300005617 Bacteria 4097
56 Ga0068864_100001758 3300005618 Bacteria 17827
57 Ga0068864_100055186 3300005618 Bacteria 3430
58 Ga0068851_10020040 3300005834 Bacteria 3235
59 Ga0068851_10046332 3300005834 Bacteria 2199
60 Ga0068863_100001599 3300005841 Bacteria 22383
61 Ga0068863_100318468 3300005841 Bacteria 1510
62 Ga0068858_100007491 3300005842 Bacteria 10549
63 Ga0068860_100003998 3300005843 Bacteria 15131
64 Ga0081455_10337145 3300005937 Bacteria 1068
65 Ga0070717_10052635 3300006028 Bacteria 3355
66 Ga0070717_10142116 3300006028 Bacteria 2071
67 Ga0097621_100008515 3300006237 Bacteria 7387
68 Ga0097621_100153732 3300006237 Bacteria 1974
69 Ga0097621_100373692 3300006237 Bacteria 1272
70 Ga0075434_100537932 3300006871 Bacteria 1188
71 Ga0075429_100253611 3300006880 Bacteria 1541
72 Ga0075436_100144766 3300006914 Bacteria 1671
73 Ga0097620_100052543 3300006931 Bacteria 4097
74 Ga0105240_10000203 3300009093 Bacteria 120858
75 Ga0105240_10002319 3300009093 Bacteria 30800
76 Ga0105240_10002494 3300009093 Bacteria 29572
77 Ga0105240_10012923 3300009093 Bacteria 11499
78 Ga0105240_10026851 3300009093 Bacteria 7551
79 Ga0105240_10165706 3300009093 Bacteria 2621
80 Ga0105240_10254908 3300009093 Bacteria 2027
81 Ga0105240_10287954 3300009093 Bacteria 1884
82 Ga0105240_10495468 3300009093 Bacteria 1359
83 Ga0111539_10162424 3300009094 Unclassified 2612
84 Ga0105245_10020771 3300009098 Bacteria 5756
85 Ga0105245_10084680 3300009098 Bacteria 2905
86 Ga0105247_10003546 3300009101 Bacteria 10145
87 Ga0105241_10000809 3300009174 Bacteria 23781
88 Ga0105241_10002161 3300009174 Bacteria 14825
89 Ga0105241_10010721 3300009174 Bacteria 6727
90 Ga0105241_10051058 3300009174 Bacteria 3153
91 Ga0105241_10085410 3300009174 Bacteria 2480
92 Ga0105248_10004528 3300009177 Bacteria 15377
93 Ga0105248_10050966 3300009177 Bacteria 4644
94 Ga0105248_10253483 3300009177 Bacteria 1981
95 Ga0105248_10266003 3300009177 Bacteria 1930
96 Ga0105237_10004852 3300009545 Bacteria 15441
97 Ga0105237_10066593 3300009545 Bacteria 3597
98 Ga0105237_10070048 3300009545 Bacteria 3502
99 Ga0105237_10230220 3300009545 Bacteria 1854
100 Ga0105238_10000825 3300009551 Bacteria 32059
101 Ga0105238_10028897 3300009551 Bacteria 5648
102 Ga0105238_10030546 3300009551 Bacteria 5485
103 Ga0105238_10154379 3300009551 Bacteria 2270
104 Ga0105239_10002406 3300010375 Bacteria 23846
105 Ga0105239_10003825 3300010375 Bacteria 18285
106 Ga0105239_10171725 3300010375 Bacteria 2424
107 Ga0105239_10352672 3300010375 Bacteria 1661
108 Ga0105246_10000704 3300011119 Bacteria 18868
109 Ga0157373_10171180 3300013100 Bacteria 1528
110 Ga0157370_10000082 3300013104 Bacteria 104481
111 Ga0157370_10045820 3300013104 Bacteria 4195
112 Ga0157369_10000095 3300013105 Bacteria 121823
113 Ga0157369_10001173 3300013105 Bacteria 32652
114 Ga0157369_10007369 3300013105 Bacteria 12665
115 Ga0157369_10027482 3300013105 Bacteria 6306
116 Ga0157369_10053552 3300013105 Bacteria 4360
117 Ga0157369_10086142 3300013105 Bacteria 3356
118 Ga0157369_10149235 3300013105 Bacteria 2471
119 Ga0157369_10388825 3300013105 Bacteria 1448
120 Ga0157374_10018167 3300013296 Bacteria 6202
121 Ga0157374_10062143 3300013296 Bacteria 3499
122 Ga0157374_10077622 3300013296 Bacteria 3143
123 Ga0157374_10207051 3300013296 Bacteria 1922
124 Ga0157378_10001417 3300013297 Bacteria 21563
125 Ga0163162_10002719 3300013306 Bacteria 16779
126 Ga0163162_10006023 3300013306 Bacteria 11734
127 Ga0157372_10000102 3300013307 Bacteria 88856
128 Ga0157372_10011494 3300013307 Bacteria 9415
129 Ga0157372_10017770 3300013307 Bacteria 7635
130 Ga0157372_10034957 3300013307 Bacteria 5530
131 Ga0157372_10088892 3300013307 Bacteria 3508
132 Ga0157372_10132487 3300013307 Bacteria 2869
133 Ga0157372_10137776 3300013307 Bacteria 2811
134 Ga0157372_10363390 3300013307 Bacteria 1687
135 Ga0157375_10004059 3300013308 Bacteria 12692
136 Ga0163163_10011055 3300014325 Bacteria 8165
137 Ga0163163_10028308 3300014325 Bacteria 5378
138 Ga0157380_10270135 3300014326 Unclassified 1550
139 Ga0157379_10017150 3300014968 Bacteria 6377
140 Ga0157379_10026029 3300014968 Bacteria 5204
141 Ga0157376_10346084 3300014969 Bacteria 1421
142 Ga0209233_1001675 3300025261 Bacteria 8629
143 Ga0207656_10042742 3300025321 Bacteria 1930
144 Ga0207710_10000979 3300025900 Bacteria 15009
145 Ga0207680_10042316 3300025903 Bacteria 2663
146 Ga0207680_10225111 3300025903 Bacteria 1287
147 Ga0207647_10041147 3300025904 Bacteria 2908
148 Ga0207705_10000077 3300025909 Bacteria 122309
149 Ga0207705_10004984 3300025909 Bacteria 9963
150 Ga0207705_10062953 3300025909 Bacteria 2680
151 Ga0207705_10131624 3300025909 Bacteria 1862
152 Ga0207705_10353903 3300025909 Bacteria 1132
153 Ga0207654_10000154 3300025911 Bacteria 43613
154 Ga0207654_10000258 3300025911 Bacteria 32201
155 Ga0207654_10000622 3300025911 Bacteria 20023
156 Ga0207654_10057856 3300025911 Bacteria 2255
157 Ga0207707_10172090 3300025912 Bacteria 1892
158 Ga0207695_10000303 3300025913 Bacteria 120876
159 Ga0207695_10001979 3300025913 Bacteria 31652
160 Ga0207695_10003987 3300025913 Bacteria 20371
161 Ga0207695_10039359 3300025913 Bacteria 5082
162 Ga0207671_10000978 3300025914 Bacteria 35396
163 Ga0207671_10001283 3300025914 Bacteria 29524
164 Ga0207671_10173388 3300025914 Bacteria 1676
165 Ga0207657_10006300 3300025919 Bacteria 12329
166 Ga0207649_10011978 3300025920 Bacteria 4798
167 Ga0207649_10024501 3300025920 Bacteria 3508
168 Ga0207649_10033290 3300025920 Bacteria 3078
169 Ga0207652_10052148 3300025921 Bacteria 3509
170 Ga0207646_10046638 3300025922 Bacteria 3887
171 Ga0207646_10112914 3300025922 Bacteria 2439
172 Ga0207646_10268828 3300025922 Unclassified 1541
173 Ga0207694_10000184 3300025924 Bacteria 64536
174 Ga0207694_10000520 3300025924 Bacteria 34849
175 Ga0207694_10039198 3300025924 Bacteria 3645
176 Ga0207694_10188769 3300025924 Bacteria 1673
177 Ga0207650_10071933 3300025925 Bacteria 2603
178 Ga0207700_10016930 3300025928 Bacteria 4855
179 Ga0207690_10112517 3300025932 Bacteria 1963
180 Ga0207711_10059787 3300025941 Bacteria 3282
181 Ga0207711_10128176 3300025941 Bacteria 2272
182 Ga0207711_10311647 3300025941 Bacteria 1453
183 Ga0207689_10000659 3300025942 Bacteria 32897
184 Ga0207679_10069791 3300025945 Bacteria 2646
185 Ga0207667_10005492 3300025949 Bacteria 15457
186 Ga0207667_10016084 3300025949 Bacteria 8467
187 Ga0207667_10044293 3300025949 Bacteria 4716
188 Ga0207667_10052317 3300025949 Bacteria 4301
189 Ga0207667_10087371 3300025949 Bacteria 3225
190 Ga0207677_10001401 3300026023 Bacteria 12863
191 Ga0207703_10006718 3300026035 Bacteria 9178
192 Ga0207639_10000521 3300026041 Bacteria 26571
193 Ga0207639_10042029 3300026041 Bacteria 3425
194 Ga0207639_10149456 3300026041 Bacteria 1955
195 Ga0207678_10022405 3300026067 Bacteria 5532
196 Ga0207678_10035828 3300026067 Bacteria 4320
197 Ga0207702_10001533 3300026078 Bacteria 22850
198 Ga0207702_10004364 3300026078 Bacteria 12610
199 Ga0207702_10046964 3300026078 Bacteria 3637
200 Ga0207641_10002215 3300026088 Bacteria 18250
201 Ga0207641_10091007 3300026088 Bacteria 2669
202 Ga0207641_10332154 3300026088 Bacteria 1444
203 Ga0207648_10151972 3300026089 Bacteria 2043
204 Ga0207674_10000122 3300026116 Bacteria 90389
205 Ga0207674_10000433 3300026116 Bacteria 54513
206 Ga0207674_10010315 3300026116 Bacteria 10597
207 Ga0207674_10013961 3300026116 Bacteria 8884
208 Ga0207674_10282614 3300026116 Bacteria 1607
209 Ga0207698_10000026 3300026142 Bacteria 121055
210 Ga0207698_10000221 3300026142 Bacteria 35425
211 Ga0207698_10053464 3300026142 Bacteria 3100
212 Ga0207698_10134168 3300026142 Bacteria 2121
213 Ga0268266_10005253 3300028379 Bacteria 12161
214 Ga0268266_10005742 3300028379 Bacteria 11486
215 Ga0268266_10160243 3300028379 Bacteria 2035
216 Ga0268264_10000653 3300028381 Bacteria 40789
217 Ga0265316_10104025 3300031344 Unclassified 2155
218 Ga0307510_10014497 3300033180 Bacteria 9329
219 Ga0307510_10051993 3300033180 Bacteria 4326
220 Ga0373957_0051483 3300035120 Bacteria 1576
221 Ga0373937_0375036 3300036401 Bacteria 1349
222 Ga0373925_0128450 3300037068 Bacteria 1974
223 Ga0395899_0012317 3300037312 Bacteria 6552
224 Ga0395900_0260989 3300037418 Bacteria 1730
225 Ga0395905_0064093 3300037471 Bacteria 3438
226 Ga0395901_0003235 3300038443 Bacteria 16383
227 Ga0466961_0006150 3300044693 Bacteria 7619
228 Ga0466963_0026846 3300044694 Bacteria 3684
229 Ga0451576_0094963 3300045051 Bacteria 3102
230 Ga0451576_0671416 3300045051 Bacteria 1089
231 Ga0466967_0028078 3300045976 Bacteria 4692
232 Ga0495603_0000324 3300046455 Bacteria 25797
233 Ga0495629_0021668 3300046459 Bacteria 4586
234 Ga0495651_0166736 3300046462 Unclassified 1572
235 Ga0495650_0000006 3300046471 Bacteria 721347
236 Ga0495650_0003538 3300046471 Bacteria 11309
237 Ga0495580_0013143 3300046472 Bacteria 6338
238 Ga0495580_0023634 3300046472 Bacteria 4510
239 Ga0495580_0040206 3300046472 Unclassified 3343
240 Ga0495664_0055906 3300046477 Bacteria 2347
241 Ga0495664_0131696 3300046477 Unclassified 1514
242 Ga0495664_0190984 3300046477 Bacteria 1241
243 Ga0495585_0008911 3300046492 Bacteria 6050
244 Ga0495594_0000060 3300046499 Bacteria 47170
245 Ga0495594_0000794 3300046499 Bacteria 16298
246 Ga0495594_0016846 3300046499 Bacteria 3855
247 Ga0495594_0226100 3300046499 Bacteria 1067
248 Ga0495606_0081864 3300046507 Bacteria 2006
249 Ga0495628_0141177 3300046516 Unclassified 1838
250 Ga0495630_0108352 3300046517 Unclassified 2104
251 Ga0495632_0088679 3300046519 Bacteria 1469
252 Ga0495644_0000069 3300046523 Bacteria 50727
253 Ga0495648_0149448 3300046524 Bacteria 1220
254 Ga0495642_0041484 3300046528 Bacteria 1872
255 Ga0495642_0056279 3300046528 Bacteria 1624
256 Ga0495665_0007655 3300046531 Bacteria 5847
257 Ga0495640_0180236 3300046533 Bacteria 1346
258 Ga0495640_0218188 3300046533 Bacteria 1204
259 Ga0495609_0044472 3300046538 Bacteria 1991
260 Ga0495645_0075253 3300046543 Bacteria 2430
261 Ga0495633_0028339 3300046558 Bacteria 2730
262 Ga0495667_0207283 3300046559 Bacteria 1253
263 Ga0495668_0014882 3300046616 Bacteria 4553
264 Ga0495634_0062049 3300046642 Unclassified 2483
265 Ga0495611_0012493 3300046648 Bacteria 3610
266 Ga0495625_0000216 3300046660 Bacteria 90850
267 Ga0495625_0006673 3300046660 Bacteria 10237
268 Ga0495625_0019187 3300046660 Bacteria 5313
269 Ga0495625_0025107 3300046660 Bacteria 4524
270 Ga0495625_0232168 3300046660 Bacteria 1204
271 Ga0495635_0338277 3300046663 Bacteria 1005
272 Ga0495661_0004217 3300046665 Bacteria 10443
273 Ga0495588_0169293 3300046674 Bacteria 1155
274 Ga0495599_0043416 3300046678 Bacteria 2821
275 Ga0495599_0088398 3300046678 Unclassified 1934
276 Ga0495669_0010503 3300046684 Bacteria 3914
277 Ga0495613_0006966 3300046689 Bacteria 8429
278 Ga0495613_0050962 3300046689 Bacteria 3052
279 Ga0495670_0040055 3300046691 Bacteria 2337
280 Ga0495649_0030985 3300046694 Bacteria 2951
281 Ga0495649_0089028 3300046694 Bacteria 1646
282 Ga0495589_0155444 3300046794 Bacteria 1091
283 Ga0495604_0036920 3300047317 Bacteria 3850
284 Ga0495674_0210259 3300047319 Unclassified 1612
285 Ga0495674_0415433 3300047319 Bacteria 1084
286 Ga0495672_0000608 3300047320 Bacteria 40179
287 Ga0495675_0077648 3300047444 Unclassified 2092
288 Ga0495684_0003377 3300047471 Bacteria 12533
289 Ga0495684_0036137 3300047471 Bacteria 3788
290 Ga0495684_0120337 3300047471 Bacteria 1978
291 Ga0495684_0249286 3300047471 Unclassified 1292
292 Ga0495686_0000035 3300047472 Bacteria 314930
293 Ga0495686_0005096 3300047472 Bacteria 10509
294 Ga0495686_0008691 3300047472 Bacteria 7415
295 Ga0495602_0006533 3300048088 Bacteria 12225
296 Ga0495602_0148884 3300048088 Bacteria 1843
297 Ga0495614_0077848 3300048089 Bacteria 1434
298 Ga0496104_0000049 3300048907 Bacteria 144754
299 Ga0496108_0235959 3300048911 Bacteria 1591
300 Ga0496126_0000004 3300048929 Bacteria 925026
301 Ga0496126_0000085 3300048929 Bacteria 216528
302 Ga0496126_0001429 3300048929 Bacteria 37548
303 Ga0495682_0086688 3300049460 Bacteria 1125
304 Ga0501033_0072927 3300049570 Bacteria 2520
305 Ga0501034_0020997 3300049571 Bacteria 6665
306 Ga0501036_0003420 3300049572 Bacteria 12683
307 Ga0501037_0010512 3300049573 Bacteria 6797
308 Ga0501037_0143869 3300049573 Bacteria 1706
309 Ga0501038_0015443 3300049574 Bacteria 6941
310 Ga0501038_0118517 3300049574 Bacteria 2186
311 Ga0501039_0070298 3300049575 Bacteria 2720
312 Ga0501042_0020932 3300049578 Bacteria 4555
313 Ga0501043_0005142 3300049579 Bacteria 10587
314 Ga0501046_0000168 3300049580 Bacteria 67061
315 Ga0501047_0001047 3300049581 Bacteria 27588
316 Ga0501048_0066903 3300049582 Bacteria 2540
317 Ga0501068_0117223 3300049584 Bacteria 1659
318 Ga0501070_0105728 3300049586 Bacteria 2327
319 Ga0501071_0349452 3300049587 Bacteria 1125
320 Ga0501073_0012518 3300049589 Bacteria 6192
321 Ga0501073_0129433 3300049589 Bacteria 1749
322 Ga0501074_0033489 3300049590 Bacteria 3724
323 Ga0501080_0113566 3300049742 Bacteria 2511
324 Ga0501080_0412816 3300049742 Bacteria 1214
325 Ga0501035_0144388 3300049822 Bacteria 2067
326 Ga0501035_0419873 3300049822 Bacteria 1110
327 Ga0501044_0060485 3300049823 Bacteria 3878
328 nmdc:mga06r32_117065_c1 3300050510 Bacteria 2626
329 nmdc:mga0n895_533406_c1 3300050512 Bacteria 1180
330 Ga0500643_048932 3300053087 Bacteria 1214
331 Ga0500651_0000023 3300053093 Bacteria 129532
332 Ga0500595_000026 3300053119 Bacteria 140376
333 Ga0501084_0303219 3300054114 Bacteria 1349

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10162424 Ga0111539_101624242 280
2 3300005563 Ga0068855_100005084 Ga0068855_1000050844 283
3 3300025949 Ga0207667_10016084 Ga0207667_100160844 283
4 3300046660 Ga0495625_0232168 Ga0495625_0232168_299_1174 283
5 3300048929 Ga0496126_0001429 Ga0496126_0001429_27961_28827 283
6 3300046477 Ga0495664_0190984 Ga0495664_0190984_307_1197 289
7 3300005535 Ga0070684_100001730 Ga0070684_1000017304 290
8 3300025920 Ga0207649_10024501 Ga0207649_100245013 290
9 3300049574 Ga0501038_0118517 Ga0501038_0118517_670_1620 291
10 3300049575 Ga0501039_0070298 Ga0501039_0070298_137_1087 291
11 3300049578 Ga0501042_0020932 Ga0501042_0020932_3016_3966 291
12 3300049582 Ga0501048_0066903 Ga0501048_0066903_1447_2397 291
13 3300049587 Ga0501071_0349452 Ga0501071_0349452_143_1075 291
14 3300049590 Ga0501074_0033489 Ga0501074_0033489_2348_3298 291
15 3300054114 Ga0501084_0303219 Ga0501084_0303219_86_1036 291
16 3300005327 Ga0070658_10137432 Ga0070658_101374322 292
17 3300005467 Ga0070706_100057870 Ga0070706_1000578702 292
18 3300005471 Ga0070698_100002026 Ga0070698_10000202618 292
19 3300005518 Ga0070699_100075482 Ga0070699_1000754824 292
20 3300006914 Ga0075436_100144766 Ga0075436_1001447663 292
21 3300025922 Ga0207646_10046638 Ga0207646_100466383 292
22 3300025922 Ga0207646_10112914 Ga0207646_101129143 292
23 3300025928 Ga0207700_10016930 Ga0207700_100169306 292
24 3300014326 Ga0157380_10270135 Ga0157380_102701351 293
25 3300037312 Ga0395899_0012317 Ga0395899_0012317_5186_6127 293
26 3300037418 Ga0395900_0260989 Ga0395900_0260989_582_1523 293
27 3300037471 Ga0395905_0064093 Ga0395905_0064093_1612_2553 293
28 3300038443 Ga0395901_0003235 Ga0395901_0003235_10729_11670 293
29 3300005434 Ga0070709_10034919 Ga0070709_100349191 294
30 3300005614 Ga0068856_100263238 Ga0068856_1002632382 294
31 3300006880 Ga0075429_100253611 Ga0075429_1002536112 294
32 3300026088 Ga0207641_10091007 Ga0207641_100910072 294
33 3300046663 Ga0495635_0338277 Ga0495635_0338277_79_987 294
34 3300005468 Ga0070707_100380861 Ga0070707_1003808611 295
35 3300025922 Ga0207646_10268828 Ga0207646_102688281 295
36 3300025900 Ga0207710_10000979 Ga0207710_100009793 296
37 3300047319 Ga0495674_0210259 Ga0495674_0210259_686_1600 297
38 3300005355 Ga0070671_100003934 Ga0070671_1000039347 299
39 3300005548 Ga0070665_100075916 Ga0070665_1000759162 299
40 3300005618 Ga0068864_100055186 Ga0068864_1000551862 299
41 3300005841 Ga0068863_100318468 Ga0068863_1003184682 299
42 3300013296 Ga0157374_10077622 Ga0157374_100776223 299
43 3300025903 Ga0207680_10042316 Ga0207680_100423162 299
44 3300026088 Ga0207641_10332154 Ga0207641_103321542 299
45 3300031344 Ga0265316_10104025 Ga0265316_101040251 299
46 3300005329 Ga0070683_100027570 Ga0070683_1000275702 300
47 3300005331 Ga0070670_100086962 Ga0070670_1000869621 300
48 3300005334 Ga0068869_100011044 Ga0068869_1000110443 300
49 3300005367 Ga0070667_100062258 Ga0070667_1000622582 300
50 3300005577 Ga0068857_100001733 Ga0068857_10000173311 300
51 3300005614 Ga0068856_100003329 Ga0068856_10000332915 300
52 3300005618 Ga0068864_100001758 Ga0068864_10000175821 300
53 3300005841 Ga0068863_100001599 Ga0068863_10000159918 300
54 3300005842 Ga0068858_100007491 Ga0068858_1000074913 300
55 3300005843 Ga0068860_100003998 Ga0068860_10000399815 300
56 3300006237 Ga0097621_100008515 Ga0097621_1000085153 300
57 3300009093 Ga0105240_10002494 Ga0105240_100024942 300
58 3300009098 Ga0105245_10084680 Ga0105245_100846803 300
59 3300009101 Ga0105247_10003546 Ga0105247_100035463 300
60 3300009174 Ga0105241_10010721 Ga0105241_100107213 300
61 3300009177 Ga0105248_10004528 Ga0105248_1000452810 300
62 3300009551 Ga0105238_10154379 Ga0105238_101543792 300
63 3300010375 Ga0105239_10171725 Ga0105239_101717252 300
64 3300011119 Ga0105246_10000704 Ga0105246_100007043 300
65 3300013105 Ga0157369_10149235 Ga0157369_101492352 300
66 3300013306 Ga0163162_10002719 Ga0163162_100027194 300
67 3300013307 Ga0157372_10088892 Ga0157372_100888923 300
68 3300013308 Ga0157375_10004059 Ga0157375_100040593 300
69 3300014325 Ga0163163_10011055 Ga0163163_100110553 300
70 3300014968 Ga0157379_10026029 Ga0157379_100260294 300
71 3300025911 Ga0207654_10000622 Ga0207654_100006225 300
72 3300025913 Ga0207695_10039359 Ga0207695_100393594 300
73 3300025914 Ga0207671_10001283 Ga0207671_100012832 300
74 3300025924 Ga0207694_10000520 Ga0207694_1000052035 300
75 3300025941 Ga0207711_10059787 Ga0207711_100597872 300
76 3300025942 Ga0207689_10000659 Ga0207689_1000065929 300
77 3300026023 Ga0207677_10001401 Ga0207677_1000140112 300
78 3300026035 Ga0207703_10006718 Ga0207703_100067187 300
79 3300026078 Ga0207702_10004364 Ga0207702_100043642 300
80 3300026088 Ga0207641_10002215 Ga0207641_100022153 300
81 3300026116 Ga0207674_10000433 Ga0207674_1000043315 300
82 3300026142 Ga0207698_10053464 Ga0207698_100534642 300
83 3300028381 Ga0268264_10000653 Ga0268264_1000065335 300
84 3300006028 Ga0070717_10052635 Ga0070717_100526352 301
85 3300006871 Ga0075434_100537932 Ga0075434_1005379322 301
86 3300033180 Ga0307510_10051993 Ga0307510_100519932 301
87 3300046462 Ga0495651_0166736 Ga0495651_0166736_566_1510 301
88 3300046477 Ga0495664_0131696 Ga0495664_0131696_552_1496 301
89 3300046516 Ga0495628_0141177 Ga0495628_0141177_519_1463 301
90 3300046517 Ga0495630_0108352 Ga0495630_0108352_703_1647 301
91 3300046533 Ga0495640_0218188 Ga0495640_0218188_250_1194 301
92 3300046543 Ga0495645_0075253 Ga0495645_0075253_1475_2419 301
93 3300046559 Ga0495667_0207283 Ga0495667_0207283_234_1178 301
94 3300046642 Ga0495634_0062049 Ga0495634_0062049_64_1008 301
95 3300046678 Ga0495599_0088398 Ga0495599_0088398_969_1913 301
96 3300047444 Ga0495675_0077648 Ga0495675_0077648_1074_2018 301
97 3300047471 Ga0495684_0036137 Ga0495684_0036137_1769_2713 301
98 3300047471 Ga0495684_0249286 Ga0495684_0249286_200_1144 301
99 3300049822 Ga0501035_0419873 Ga0501035_0419873_52_1023 301
100 3300050512 nmdc:mga0n895_533406_c1 nmdc:mga0n895_533406_c1_149_1093 301
101 3300047471 Ga0495684_0003377 Ga0495684_0003377_151_1185 302
102 3300048088 Ga0495602_0006533 Ga0495602_0006533_10663_11697 302
103 3300048929 Ga0496126_0000085 Ga0496126_0000085_89114_90079 304
104 3300005937 Ga0081455_10337145 Ga0081455_103371451 305
105 3300014325 Ga0163163_10028308 Ga0163163_100283085 305
106 3300014968 Ga0157379_10017150 Ga0157379_100171504 305
107 3300025903 Ga0207680_10225111 Ga0207680_102251112 305
108 3300049573 Ga0501037_0143869 Ga0501037_0143869_483_1457 305
109 3300005458 Ga0070681_10426106 Ga0070681_104261061 306
110 3300005577 Ga0068857_100276142 Ga0068857_1002761421 306
111 3300013307 Ga0157372_10363390 Ga0157372_103633901 306
112 3300025909 Ga0207705_10062953 Ga0207705_100629533 306
113 3300006237 Ga0097621_100153732 Ga0097621_1001537322 307
114 3300035120 Ga0373957_0051483 Ga0373957_0051483_547_1500 307
115 3300036401 Ga0373937_0375036 Ga0373937_0375036_155_1108 307
116 3300037068 Ga0373925_0128450 Ga0373925_0128450_158_1111 307
117 3300045051 Ga0451576_0671416 Ga0451576_0671416_71_1027 307
118 3300046472 Ga0495580_0040206 Ga0495580_0040206_32_985 307
119 3300046499 Ga0495594_0226100 Ga0495594_0226100_97_1050 307
120 3300048088 Ga0495602_0148884 Ga0495602_0148884_69_1022 307
121 3300025909 Ga0207705_10131624 Ga0207705_101316241 308
122 3300005327 Ga0070658_10000004 Ga0070658_10000004310 310
123 3300005327 Ga0070658_10262535 Ga0070658_102625352 310
124 3300005344 Ga0070661_100008894 Ga0070661_1000088942 310
125 3300005539 Ga0068853_100000312 Ga0068853_10000031212 310
126 3300005539 Ga0068853_100218064 Ga0068853_1002180642 310
127 3300005563 Ga0068855_100001672 Ga0068855_10000167220 310
128 3300005577 Ga0068857_100000158 Ga0068857_10000015815 310
129 3300005614 Ga0068856_100020835 Ga0068856_1000208353 310
130 3300005614 Ga0068856_100125981 Ga0068856_1001259812 310
131 3300005616 Ga0068852_100000650 Ga0068852_10000065024 310
132 3300005616 Ga0068852_100084160 Ga0068852_1000841602 310
133 3300005834 Ga0068851_10020040 Ga0068851_100200402 310
134 3300005834 Ga0068851_10046332 Ga0068851_100463322 310
135 3300009093 Ga0105240_10012923 Ga0105240_100129232 310
136 3300009093 Ga0105240_10254908 Ga0105240_102549082 310
137 3300009093 Ga0105240_10287954 Ga0105240_102879542 310
138 3300009098 Ga0105245_10020771 Ga0105245_100207713 310
139 3300009174 Ga0105241_10002161 Ga0105241_100021618 310
140 3300009174 Ga0105241_10051058 Ga0105241_100510582 310
141 3300009177 Ga0105248_10253483 Ga0105248_102534832 310
142 3300009545 Ga0105237_10004852 Ga0105237_100048528 310
143 3300009551 Ga0105238_10000825 Ga0105238_1000082519 310
144 3300009551 Ga0105238_10028897 Ga0105238_100288973 310
145 3300010375 Ga0105239_10002406 Ga0105239_100024064 310
146 3300010375 Ga0105239_10003825 Ga0105239_100038252 310
147 3300013105 Ga0157369_10001173 Ga0157369_1000117312 310
148 3300013105 Ga0157369_10027482 Ga0157369_100274824 310
149 3300013296 Ga0157374_10018167 Ga0157374_100181674 310
150 3300013296 Ga0157374_10062143 Ga0157374_100621432 310
151 3300013307 Ga0157372_10011494 Ga0157372_100114943 310
152 3300013307 Ga0157372_10017770 Ga0157372_100177702 310
153 3300025321 Ga0207656_10042742 Ga0207656_100427422 310
154 3300025909 Ga0207705_10000077 Ga0207705_1000007758 310
155 3300025911 Ga0207654_10000258 Ga0207654_1000025819 310
156 3300025913 Ga0207695_10001979 Ga0207695_1000197920 310
157 3300025914 Ga0207671_10000978 Ga0207671_1000097819 310
158 3300025920 Ga0207649_10011978 Ga0207649_100119782 310
159 3300025924 Ga0207694_10000184 Ga0207694_1000018446 310
160 3300025924 Ga0207694_10039198 Ga0207694_100391982 310
161 3300025925 Ga0207650_10071933 Ga0207650_100719332 310
162 3300025941 Ga0207711_10128176 Ga0207711_101281762 310
163 3300025949 Ga0207667_10005492 Ga0207667_100054929 310
164 3300026041 Ga0207639_10000521 Ga0207639_100005217 310
165 3300026041 Ga0207639_10042029 Ga0207639_100420292 310
166 3300026078 Ga0207702_10001533 Ga0207702_100015337 310
167 3300026078 Ga0207702_10046964 Ga0207702_100469642 310
168 3300026089 Ga0207648_10151972 Ga0207648_101519722 310
169 3300026116 Ga0207674_10000122 Ga0207674_1000012242 310
170 3300026142 Ga0207698_10000221 Ga0207698_1000022112 310
171 3300026142 Ga0207698_10134168 Ga0207698_101341682 310
172 3300044694 Ga0466963_0026846 Ga0466963_0026846_1210_2154 310
173 3300045976 Ga0466967_0028078 Ga0466967_0028078_2649_3593 310
174 3300047472 Ga0495686_0008691 Ga0495686_0008691_138_1100 310
175 3300048929 Ga0496126_0000004 Ga0496126_0000004_41134_42093 310
176 3300049586 Ga0501070_0105728 Ga0501070_0105728_511_1485 310
177 iso_pu_bacteria 2884215851 2884219556 310
178 3300003316 rootH1_10089238 rootH1_100892381 311
179 3300003320 rootH2_10301638 rootH2_103016382 311
180 3300005329 Ga0070683_100068351 Ga0070683_1000683514 311
181 3300005329 Ga0070683_100215450 Ga0070683_1002154501 311
182 3300005344 Ga0070661_100021864 Ga0070661_1000218645 311
183 3300005344 Ga0070661_100023487 Ga0070661_1000234873 311
184 3300005366 Ga0070659_100026263 Ga0070659_1000262633 311
185 3300005455 Ga0070663_100061591 Ga0070663_1000615913 311
186 3300005455 Ga0070663_100350939 Ga0070663_1003509391 311
187 3300005458 Ga0070681_10158130 Ga0070681_101581303 311
188 3300005530 Ga0070679_100079466 Ga0070679_1000794661 311
189 3300005535 Ga0070684_100040266 Ga0070684_1000402664 311
190 3300005535 Ga0070684_100183570 Ga0070684_1001835702 311
191 3300005539 Ga0068853_100206812 Ga0068853_1002068122 311
192 3300005563 Ga0068855_100001744 Ga0068855_10000174412 311
193 3300005563 Ga0068855_100012307 Ga0068855_1000123079 311
194 3300005563 Ga0068855_100158943 Ga0068855_1001589433 311
195 3300005577 Ga0068857_100030851 Ga0068857_1000308512 311
196 3300005577 Ga0068857_100067875 Ga0068857_1000678753 311
197 3300005577 Ga0068857_100273614 Ga0068857_1002736142 311
198 3300005578 Ga0068854_100017502 Ga0068854_1000175023 311
199 3300005614 Ga0068856_100412397 Ga0068856_1004123972 311
200 3300005616 Ga0068852_100000023 Ga0068852_10000002352 311
201 3300005616 Ga0068852_100081607 Ga0068852_1000816073 311
202 3300005617 Ga0068859_100052544 Ga0068859_1000525444 311
203 3300006028 Ga0070717_10142116 Ga0070717_101421163 311
204 3300006237 Ga0097621_100373692 Ga0097621_1003736922 311
205 3300006931 Ga0097620_100052543 Ga0097620_1000525432 311
206 3300009093 Ga0105240_10000203 Ga0105240_1000020352 311
207 3300009093 Ga0105240_10002319 Ga0105240_1000231913 311
208 3300009093 Ga0105240_10026851 Ga0105240_100268515 311
209 3300009093 Ga0105240_10165706 Ga0105240_101657062 311
210 3300009093 Ga0105240_10495468 Ga0105240_104954682 311
211 3300009174 Ga0105241_10000809 Ga0105241_1000080914 311
212 3300009174 Ga0105241_10085410 Ga0105241_100854102 311
213 3300009177 Ga0105248_10050966 Ga0105248_100509663 311
214 3300009177 Ga0105248_10266003 Ga0105248_102660031 311
215 3300009545 Ga0105237_10066593 Ga0105237_100665933 311
216 3300009545 Ga0105237_10070048 Ga0105237_100700482 311
217 3300009545 Ga0105237_10230220 Ga0105237_102302202 311
218 3300009551 Ga0105238_10030546 Ga0105238_100305463 311
219 3300010375 Ga0105239_10352672 Ga0105239_103526722 311
220 3300013100 Ga0157373_10171180 Ga0157373_101711801 311
221 3300013104 Ga0157370_10000082 Ga0157370_1000008251 311
222 3300013104 Ga0157370_10045820 Ga0157370_100458203 311
223 3300013105 Ga0157369_10000095 Ga0157369_1000009553 311
224 3300013105 Ga0157369_10007369 Ga0157369_100073693 311
225 3300013105 Ga0157369_10053552 Ga0157369_100535523 311
226 3300013105 Ga0157369_10086142 Ga0157369_100861422 311
227 3300013105 Ga0157369_10388825 Ga0157369_103888252 311
228 3300013296 Ga0157374_10207051 Ga0157374_102070512 311
229 3300013297 Ga0157378_10001417 Ga0157378_100014174 311
230 3300013306 Ga0163162_10006023 Ga0163162_100060238 311
231 3300013307 Ga0157372_10000102 Ga0157372_1000010238 311
232 3300013307 Ga0157372_10034957 Ga0157372_100349574 311
233 3300013307 Ga0157372_10132487 Ga0157372_101324872 311
234 3300013307 Ga0157372_10137776 Ga0157372_101377763 311
235 3300014969 Ga0157376_10346084 Ga0157376_103460841 311
236 3300025261 Ga0209233_1001675 Ga0209233_10016753 311
237 3300025904 Ga0207647_10041147 Ga0207647_100411473 311
238 3300025909 Ga0207705_10004984 Ga0207705_100049842 311
239 3300025909 Ga0207705_10353903 Ga0207705_103539032 311
240 3300025911 Ga0207654_10000154 Ga0207654_1000015435 311
241 3300025911 Ga0207654_10057856 Ga0207654_100578562 311
242 3300025912 Ga0207707_10172090 Ga0207707_101720903 311
243 3300025913 Ga0207695_10000303 Ga0207695_1000030352 311
244 3300025913 Ga0207695_10003987 Ga0207695_1000398712 311
245 3300025914 Ga0207671_10173388 Ga0207671_101733882 311
246 3300025919 Ga0207657_10006300 Ga0207657_100063004 311
247 3300025920 Ga0207649_10033290 Ga0207649_100332902 311
248 3300025921 Ga0207652_10052148 Ga0207652_100521483 311
249 3300025924 Ga0207694_10188769 Ga0207694_101887692 311
250 3300025932 Ga0207690_10112517 Ga0207690_101125171 311
251 3300025941 Ga0207711_10311647 Ga0207711_103116471 311
252 3300025945 Ga0207679_10069791 Ga0207679_100697911 311
253 3300025949 Ga0207667_10044293 Ga0207667_100442932 311
254 3300025949 Ga0207667_10052317 Ga0207667_100523173 311
255 3300025949 Ga0207667_10087371 Ga0207667_100873713 311
256 3300026041 Ga0207639_10149456 Ga0207639_101494563 311
257 3300026067 Ga0207678_10022405 Ga0207678_100224053 311
258 3300026067 Ga0207678_10035828 Ga0207678_100358283 311
259 3300026116 Ga0207674_10010315 Ga0207674_100103153 311
260 3300026116 Ga0207674_10013961 Ga0207674_100139612 311
261 3300026116 Ga0207674_10282614 Ga0207674_102826142 311
262 3300026142 Ga0207698_10000026 Ga0207698_1000002664 311
263 3300028379 Ga0268266_10005253 Ga0268266_100052536 311
264 3300028379 Ga0268266_10005742 Ga0268266_100057426 311
265 3300028379 Ga0268266_10160243 Ga0268266_101602432 311
266 3300033180 Ga0307510_10014497 Ga0307510_100144974 311
267 3300044693 Ga0466961_0006150 Ga0466961_0006150_3749_4705 311
268 3300045051 Ga0451576_0094963 Ga0451576_0094963_332_1324 311
269 3300046455 Ga0495603_0000324 Ga0495603_0000324_7651_8607 311
270 3300046459 Ga0495629_0021668 Ga0495629_0021668_365_1438 311
271 3300046471 Ga0495650_0000006 Ga0495650_0000006_206362_207321 311
272 3300046471 Ga0495650_0003538 Ga0495650_0003538_2610_3569 311
273 3300046472 Ga0495580_0013143 Ga0495580_0013143_3004_3960 311
274 3300046472 Ga0495580_0023634 Ga0495580_0023634_2695_3660 311
275 3300046477 Ga0495664_0055906 Ga0495664_0055906_933_1898 311
276 3300046492 Ga0495585_0008911 Ga0495585_0008911_2385_3341 311
277 3300046499 Ga0495594_0000060 Ga0495594_0000060_30544_31500 311
278 3300046499 Ga0495594_0000794 Ga0495594_0000794_2687_3652 311
279 3300046499 Ga0495594_0016846 Ga0495594_0016846_1690_2646 311
280 3300046507 Ga0495606_0081864 Ga0495606_0081864_473_1438 311
281 3300046519 Ga0495632_0088679 Ga0495632_0088679_448_1413 311
282 3300046523 Ga0495644_0000069 Ga0495644_0000069_24244_25200 311
283 3300046524 Ga0495648_0149448 Ga0495648_0149448_177_1139 311
284 3300046528 Ga0495642_0041484 Ga0495642_0041484_57_1022 311
285 3300046528 Ga0495642_0056279 Ga0495642_0056279_31_987 311
286 3300046531 Ga0495665_0007655 Ga0495665_0007655_2941_3906 311
287 3300046533 Ga0495640_0180236 Ga0495640_0180236_73_1038 311
288 3300046538 Ga0495609_0044472 Ga0495609_0044472_967_1923 311
289 3300046558 Ga0495633_0028339 Ga0495633_0028339_820_1776 311
290 3300046616 Ga0495668_0014882 Ga0495668_0014882_2834_3790 311
291 3300046648 Ga0495611_0012493 Ga0495611_0012493_264_1220 311
292 3300046660 Ga0495625_0000216 Ga0495625_0000216_11899_12858 311
293 3300046660 Ga0495625_0006673 Ga0495625_0006673_1603_2553 311
294 3300046660 Ga0495625_0019187 Ga0495625_0019187_1663_2619 311
295 3300046660 Ga0495625_0025107 Ga0495625_0025107_1912_2952 311
296 3300046665 Ga0495661_0004217 Ga0495661_0004217_7039_7995 311
297 3300046674 Ga0495588_0169293 Ga0495588_0169293_113_1069 311
298 3300046678 Ga0495599_0043416 Ga0495599_0043416_461_1417 311
299 3300046684 Ga0495669_0010503 Ga0495669_0010503_1319_2275 311
300 3300046689 Ga0495613_0006966 Ga0495613_0006966_3714_4670 311
301 3300046689 Ga0495613_0050962 Ga0495613_0050962_1798_2763 311
302 3300046691 Ga0495670_0040055 Ga0495670_0040055_750_1706 311
303 3300046694 Ga0495649_0030985 Ga0495649_0030985_333_1313 311
304 3300046694 Ga0495649_0089028 Ga0495649_0089028_224_1189 311
305 3300046794 Ga0495589_0155444 Ga0495589_0155444_52_1008 311
306 3300047317 Ga0495604_0036920 Ga0495604_0036920_813_1778 311
307 3300047319 Ga0495674_0415433 Ga0495674_0415433_21_986 311
308 3300047320 Ga0495672_0000608 Ga0495672_0000608_30503_31459 311
309 3300047471 Ga0495684_0120337 Ga0495684_0120337_907_1872 311
310 3300047472 Ga0495686_0000035 Ga0495686_0000035_265706_266668 311
311 3300047472 Ga0495686_0005096 Ga0495686_0005096_1903_2862 311
312 3300048089 Ga0495614_0077848 Ga0495614_0077848_95_1060 311
313 3300048907 Ga0496104_0000049 Ga0496104_0000049_131487_132443 311
314 3300048911 Ga0496108_0235959 Ga0496108_0235959_325_1293 311
315 3300049460 Ga0495682_0086688 Ga0495682_0086688_91_1041 311
316 3300049570 Ga0501033_0072927 Ga0501033_0072927_1126_2097 311
317 3300049571 Ga0501034_0020997 Ga0501034_0020997_138_1109 311
318 3300049572 Ga0501036_0003420 Ga0501036_0003420_435_1406 311
319 3300049573 Ga0501037_0010512 Ga0501037_0010512_1563_2534 311
320 3300049574 Ga0501038_0015443 Ga0501038_0015443_1753_2724 311
321 3300049579 Ga0501043_0005142 Ga0501043_0005142_8627_9598 311
322 3300049580 Ga0501046_0000168 Ga0501046_0000168_39581_40552 311
323 3300049581 Ga0501047_0001047 Ga0501047_0001047_22600_23571 311
324 3300049584 Ga0501068_0117223 Ga0501068_0117223_317_1288 311
325 3300049589 Ga0501073_0012518 Ga0501073_0012518_1756_2727 311
326 3300049589 Ga0501073_0129433 Ga0501073_0129433_742_1695 311
327 3300049742 Ga0501080_0113566 Ga0501080_0113566_648_1619 311
328 3300049742 Ga0501080_0412816 Ga0501080_0412816_70_1023 311
329 3300049822 Ga0501035_0144388 Ga0501035_0144388_250_1221 311
330 3300049823 Ga0501044_0060485 Ga0501044_0060485_809_1780 311
331 3300050510 nmdc:mga06r32_117065_c1 nmdc:mga06r32_117065_c1_349_1308 311
332 3300053087 Ga0500643_048932 Ga0500643_048932_196_1155 311
333 3300053093 Ga0500651_0000023 Ga0500651_0000023_22042_23004 311
334 3300053119 Ga0500595_000026 Ga0500595_000026_29674_30630 311

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06439

3keto-disac_hyd

3-keto-disaccharide hydrolase

174

353

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hbk-assembly1.cif.gz_A crystal structure of putative glycosyl hydrolase, was domain of unknown function (duf1080) (yp_001302580.1) from parabacteroides distasonis atcc 8503 at 2.36 a resolution 0.7409 120 306
3u1x-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_1869) from parabacteroides distasonis atcc 8503 at 1.70 a resolution 0.7327 129 311
4qhz-assembly1.cif.gz_B crystal structure of a putative glycosyl hydrolase (bdi_3914) from parabacteroides distasonis atcc 8503 at 2.13 a resolution 0.7274 120 306
7n35-assembly2.cif.gz_A structure of yersinia aleksiciae cap15 cyclic dinucleotide receptor, crystal form 2 0.7224 24 114
3s5q-assembly1.cif.gz_A crystal structure of a putative glycosyl hydrolase (bdi_2473) from parabacteroides distasonis atcc 8503 at 1.85 a resolution 0.7213 129 306
ID Description Score Start End Superfamily
1pbyA02 Mainly Beta;Beta Barrel;Lipocalin;Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 0.7199 24 115 2.40.128.120
3u1xA00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7126 129 311 2.60.120.560
4qhzB00 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.7017 120 306 2.60.120.560
4jqtB02 Mainly Beta;Sandwich;Jelly Rolls;Exo-inulinase; domain 1 0.6805 114 306 2.60.120.560
1jmzA02 Mainly Beta;Beta Barrel;Lipocalin;Quinohemoprotein amine dehydrogenase alpha subunit, domain 2 0.6698 24 114 2.40.128.120
ID Description Score Start End GO Terms
AF-A0A1G7QYP8-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9346 1 311 GO:0016787
AF-A0A1G7QYP8-F1-model_v4 3-keto-disaccharide hydrolase domain-containing protein 0.9317 1 311 GO:0016787
AF-A0A534HCP7-F1-model_v4 DUF1080 domain-containing protein 0.9246 114 311 GO:0016787
AF-A0A534C932-F1-model_v4 DUF1080 domain-containing protein 0.9241 172 311 GO:0016787
AF-A0A7S7SKM5-F1-model_v4 DUF1080 domain-containing protein 0.9184 1 311 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.98 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map