F411878

General Info

Members Datasets Scaffolds Average Seq Length
334 107 668 250

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0038337|Ga0395899_0038337_1652_2563
Length 303
Sequence MGVSSEAGESAPIWDSALGSNAPGIVARKRAGGAAKARLGCKDARVWNRTLQRMTDLADSASTGAPSNELGSAADAPLLRGLPAVVRQRLLHSARVERFAPRAEVIRVGETPSHLHVVLSGLIDLSCTYKGNECSALMMAAGDVFMPAAALYAEPYLVSAHALVATRILMIDAKLVQRETERCPELALVLARIMAGQWRIALKIILDLKCRSPSQRLGAFLLRLYDSAKPGPPAEIPFSKRQLASRIGMQPETLSRTLQTLAANGLYLRGRQIIITNRSAIEAFCGPDPYPPASEYELGVHAL

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
41 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
42 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
82 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
83 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
84 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
85 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
86 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
87 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
88 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
89 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
92 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
93 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
94 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
95 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
96 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
97 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
98 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
99 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
100 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
101 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
102 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
103 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
104 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
105 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
106 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
107 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.8
Rhizosphere 98.2
Stem 0
Stem Tuber 0
Unclassified 14.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0038337 3300037312 Bacteria 3590
2 JGI24741J21665_1004367 3300001915 Bacteria 3151
3 JGI24739J22299_10005165 3300001989 Bacteria 4972
4 JGI24735J21928_10003466 3300002067 Bacteria 5372
5 JGI24735J21928_10049245 3300002067 Unclassified 1218
6 JGI24738J21930_10005306 3300002075 Bacteria 3100
7 Ga0070658_10001186 3300005327 Bacteria 22303
8 Ga0070658_10021494 3300005327 Bacteria 5171
9 Ga0070658_10083994 3300005327 Bacteria 2618
10 Ga0070683_100007551 3300005329 Bacteria 9189
11 Ga0070683_100012114 3300005329 Bacteria 7484
12 Ga0070683_100137931 3300005329 Bacteria 2310
13 Ga0070683_100141355 3300005329 Bacteria 2280
14 Ga0070683_100361061 3300005329 Unclassified 1383
15 Ga0070666_10007307 3300005335 Bacteria 6806
16 Ga0070680_100000197 3300005336 Bacteria 39326
17 Ga0070680_100033835 3300005336 Bacteria 4121
18 Ga0070680_100056854 3300005336 Bacteria 3197
19 Ga0070680_100079490 3300005336 Bacteria 2703
20 Ga0070680_100089076 3300005336 Unclassified 2553
21 Ga0070680_100185295 3300005336 Bacteria 1753
22 Ga0070682_100039398 3300005337 Bacteria 2904
23 Ga0070682_100066841 3300005337 Bacteria 2288
24 Ga0070660_100000861 3300005339 Bacteria 20243
25 Ga0070660_100008662 3300005339 Bacteria 7125
26 Ga0070660_100036772 3300005339 Bacteria 3710
27 Ga0070660_100047227 3300005339 Bacteria 3302
28 Ga0070660_100053802 3300005339 Bacteria 3106
29 Ga0070660_100093225 3300005339 Bacteria 2378
30 Ga0070660_100093522 3300005339 Bacteria 2374
31 Ga0070660_100368712 3300005339 Unclassified 1184
32 Ga0070691_10012494 3300005341 Bacteria 3889
33 Ga0070691_10107879 3300005341 Unclassified 1390
34 Ga0070661_100000101 3300005344 Bacteria 70279
35 Ga0070661_100027855 3300005344 Bacteria 4072
36 Ga0070661_100069258 3300005344 Unclassified 2594
37 Ga0070661_100070152 3300005344 Bacteria 2577
38 Ga0070661_100087585 3300005344 Bacteria 2303
39 Ga0070661_100093606 3300005344 Bacteria 2226
40 Ga0070661_100097567 3300005344 Unclassified 2182
41 Ga0070661_100122429 3300005344 Bacteria 1949
42 Ga0070661_100354560 3300005344 Unclassified 1152
43 Ga0070661_100440434 3300005344 Bacteria 1035
44 Ga0070692_10042726 3300005345 Bacteria 2329
45 Ga0070692_10073849 3300005345 Unclassified 1823
46 Ga0070692_10076020 3300005345 Bacteria 1799
47 Ga0070671_100505613 3300005355 Bacteria 1040
48 Ga0070673_100021056 3300005364 Bacteria 4717
49 Ga0070659_100000045 3300005366 Bacteria 101520
50 Ga0070659_100007575 3300005366 Bacteria 7891
51 Ga0070659_100019577 3300005366 Bacteria 5131
52 Ga0070659_100039506 3300005366 Bacteria 3684
53 Ga0070659_100067765 3300005366 Bacteria 2830
54 Ga0070667_100025572 3300005367 Bacteria 4909
55 Ga0070714_100290014 3300005435 Bacteria 1523
56 Ga0070663_100160382 3300005455 Bacteria 1731
57 Ga0070662_100000036 3300005457 Bacteria 77190
58 Ga0070662_100129694 3300005457 Bacteria 1942
59 Ga0070681_10022649 3300005458 Bacteria 6310
60 Ga0070679_100063973 3300005530 Bacteria 3666
61 Ga0070679_100351159 3300005530 Bacteria 1422
62 Ga0070684_100010629 3300005535 Bacteria 7298
63 Ga0070684_100020379 3300005535 Bacteria 5502
64 Ga0070684_100025922 3300005535 Bacteria 4932
65 Ga0070684_100179124 3300005535 Unclassified 1927
66 Ga0070684_100428739 3300005535 Bacteria 1221
67 Ga0068853_100000059 3300005539 Bacteria 78301
68 Ga0068853_100013457 3300005539 Bacteria 6680
69 Ga0068853_100301971 3300005539 Unclassified 1480
70 Ga0068853_100395706 3300005539 Bacteria 1292
71 Ga0070693_100000361 3300005547 Bacteria 20637
72 Ga0070665_100022291 3300005548 Bacteria 6374
73 Ga0068855_100003767 3300005563 Bacteria 18537
74 Ga0068855_100013991 3300005563 Bacteria 9673
75 Ga0068855_100324360 3300005563 Bacteria 1701
76 Ga0068855_100739859 3300005563 Unclassified 1049
77 Ga0070664_100000027 3300005564 Bacteria 90881
78 Ga0070664_100025634 3300005564 Bacteria 4890
79 Ga0070664_100028127 3300005564 Bacteria 4675
80 Ga0070664_100067966 3300005564 Bacteria 3046
81 Ga0070664_100140432 3300005564 Bacteria 2127
82 Ga0068857_100034480 3300005577 Bacteria 4477
83 Ga0068857_100054943 3300005577 Bacteria 3534
84 Ga0068857_100074376 3300005577 Bacteria 3027
85 Ga0068857_100134107 3300005577 Bacteria 2235
86 Ga0068854_100011111 3300005578 Bacteria 5846
87 Ga0068854_100143862 3300005578 Bacteria 1832
88 Ga0068854_100172981 3300005578 Bacteria 1682
89 Ga0068854_100197475 3300005578 Bacteria 1579
90 Ga0068854_100339511 3300005578 Bacteria 1226
91 Ga0068854_100579164 3300005578 Unclassified 955
92 Ga0068856_100000699 3300005614 Bacteria 36354
93 Ga0068856_100185931 3300005614 Bacteria 2091
94 Ga0068856_100489805 3300005614 Bacteria 1250
95 Ga0068856_100594720 3300005614 Bacteria 1127
96 Ga0068856_100679833 3300005614 Bacteria 1050
97 Ga0068856_100827979 3300005614 Unclassified 945
98 Ga0068852_100000433 3300005616 Bacteria 27783
99 Ga0068852_100002131 3300005616 Bacteria 13562
100 Ga0068852_100004384 3300005616 Bacteria 9974
101 Ga0068852_100031537 3300005616 Bacteria 4375
102 Ga0068852_100070104 3300005616 Bacteria 3074
103 Ga0068852_100081949 3300005616 Bacteria 2866
104 Ga0068859_100075996 3300005617 Bacteria 3400
105 Ga0068864_100004541 3300005618 Bacteria 11400
106 Ga0068864_100017981 3300005618 Bacteria 5899
107 Ga0068851_10065048 3300005834 Bacteria 1876
108 Ga0068851_10128586 3300005834 Unclassified 1368
109 Ga0068871_100756291 3300006358 Bacteria 894
110 Ga0097620_100075997 3300006931 Bacteria 3400
111 Ga0105240_10018660 3300009093 Bacteria 9296
112 Ga0105240_10019627 3300009093 Bacteria 9028
113 Ga0105240_10034327 3300009093 Bacteria 6544
114 Ga0105241_10485051 3300009174 Unclassified 1099
115 Ga0105241_10511605 3300009174 Bacteria 1072
116 Ga0105248_10001451 3300009177 Bacteria 26388
117 Ga0105248_10216310 3300009177 Bacteria 2158
118 Ga0105237_10011326 3300009545 Bacteria 9434
119 Ga0105237_10043262 3300009545 Bacteria 4538
120 Ga0105238_10009347 3300009551 Bacteria 9819
121 Ga0105238_10009558 3300009551 Bacteria 9701
122 Ga0105238_10021258 3300009551 Bacteria 6613
123 Ga0105238_10057508 3300009551 Bacteria 3899
124 Ga0105238_10333541 3300009551 Unclassified 1504
125 Ga0105239_10148269 3300010375 Bacteria 2618
126 Ga0157373_10015698 3300013100 Bacteria 5532
127 Ga0157373_10019273 3300013100 Bacteria 4969
128 Ga0157373_10038456 3300013100 Bacteria 3429
129 Ga0157373_10062665 3300013100 Bacteria 2634
130 Ga0157373_10082562 3300013100 Bacteria 2265
131 Ga0157373_10118957 3300013100 Bacteria 1857
132 Ga0157373_10319556 3300013100 Unclassified 1104
133 Ga0157371_10012821 3300013102 Bacteria 6389
134 Ga0157371_10015590 3300013102 Bacteria 5697
135 Ga0157371_10030066 3300013102 Bacteria 3920
136 Ga0157371_10065689 3300013102 Bacteria 2569
137 Ga0157371_10122452 3300013102 Bacteria 1850
138 Ga0157370_10020069 3300013104 Bacteria 6684
139 Ga0157370_10020885 3300013104 Bacteria 6533
140 Ga0157370_10036395 3300013104 Bacteria 4776
141 Ga0157370_10081620 3300013104 Bacteria 3042
142 Ga0157370_10165663 3300013104 Bacteria 2055
143 Ga0157369_10009620 3300013105 Bacteria 11052
144 Ga0157369_10020994 3300013105 Bacteria 7302
145 Ga0157369_10075933 3300013105 Bacteria 3602
146 Ga0157369_10115982 3300013105 Bacteria 2844
147 Ga0157369_10142102 3300013105 Bacteria 2539
148 Ga0157369_10144757 3300013105 Bacteria 2513
149 Ga0157369_10168358 3300013105 Bacteria 2310
150 Ga0157369_10322112 3300013105 Bacteria 1607
151 Ga0157372_10002183 3300013307 Bacteria 21305
152 Ga0157372_10102191 3300013307 Bacteria 3274
153 Ga0157372_10219346 3300013307 Bacteria 2205
154 Ga0157372_10635102 3300013307 Bacteria 1244
155 Ga0163163_10000187 3300014325 Bacteria 63661
156 Ga0206353_10498858 3300020082 Unclassified 1062
157 Ga0207656_10011331 3300025321 Bacteria 3367
158 Ga0207656_10271455 3300025321 Unclassified 835
159 Ga0207680_10006265 3300025903 Bacteria 5742
160 Ga0207647_10002445 3300025904 Bacteria 14083
161 Ga0207647_10007033 3300025904 Bacteria 8160
162 Ga0207705_10000912 3300025909 Bacteria 24200
163 Ga0207705_10021424 3300025909 Bacteria 4612
164 Ga0207705_10047571 3300025909 Bacteria 3084
165 Ga0207705_10056752 3300025909 Bacteria 2824
166 Ga0207705_10098266 3300025909 Bacteria 2151
167 Ga0207707_10260706 3300025912 Unclassified 1504
168 Ga0207671_10386136 3300025914 Unclassified 1113
169 Ga0207660_10000563 3300025917 Bacteria 24920
170 Ga0207660_10004550 3300025917 Bacteria 9046
171 Ga0207660_10030493 3300025917 Bacteria 3707
172 Ga0207660_10164081 3300025917 Bacteria 1716
173 Ga0207660_10179608 3300025917 Bacteria 1643
174 Ga0207657_10000133 3300025919 Bacteria 75282
175 Ga0207657_10003049 3300025919 Bacteria 17918
176 Ga0207657_10011223 3300025919 Bacteria 8904
177 Ga0207657_10035051 3300025919 Bacteria 4505
178 Ga0207657_10045621 3300025919 Bacteria 3844
179 Ga0207657_10063250 3300025919 Bacteria 3165
180 Ga0207657_10126878 3300025919 Unclassified 2095
181 Ga0207649_10000378 3300025920 Bacteria 33311
182 Ga0207649_10008289 3300025920 Bacteria 5663
183 Ga0207649_10023957 3300025920 Unclassified 3541
184 Ga0207649_10103754 3300025920 Bacteria 1887
185 Ga0207649_10150631 3300025920 Bacteria 1602
186 Ga0207649_10236904 3300025920 Bacteria 1308
187 Ga0207649_10306808 3300025920 Bacteria 1162
188 Ga0207652_10110160 3300025921 Bacteria 2441
189 Ga0207652_10194555 3300025921 Bacteria 1824
190 Ga0207652_10301911 3300025921 Unclassified 1445
191 Ga0207694_10008960 3300025924 Bacteria 7555
192 Ga0207694_10038310 3300025924 Bacteria 3686
193 Ga0207694_10247577 3300025924 Unclassified 1458
194 Ga0207664_10160268 3300025929 Unclassified 1918
195 Ga0207664_10278814 3300025929 Bacteria 1466
196 Ga0207644_10046410 3300025931 Bacteria 3095
197 Ga0207690_10000080 3300025932 Bacteria 82082
198 Ga0207690_10034444 3300025932 Bacteria 3263
199 Ga0207690_10040848 3300025932 Bacteria 3035
200 Ga0207690_10042683 3300025932 Bacteria 2980
201 Ga0207690_10074797 3300025932 Bacteria 2347
202 Ga0207706_10000159 3300025933 Bacteria 75284
203 Ga0207706_10027266 3300025933 Bacteria 5109
204 Ga0207706_10080695 3300025933 Bacteria 2860
205 Ga0207706_10231085 3300025933 Unclassified 1618
206 Ga0207711_10004362 3300025941 Bacteria 12072
207 Ga0207711_10008307 3300025941 Bacteria 8692
208 Ga0207661_10012433 3300025944 Bacteria 6186
209 Ga0207661_10073446 3300025944 Bacteria 2801
210 Ga0207661_10087797 3300025944 Bacteria 2583
211 Ga0207661_10116091 3300025944 Bacteria 2272
212 Ga0207661_10172259 3300025944 Bacteria 1884
213 Ga0207679_10000155 3300025945 Bacteria 56504
214 Ga0207679_10056831 3300025945 Bacteria 2891
215 Ga0207679_10174178 3300025945 Bacteria 1774
216 Ga0207679_10409783 3300025945 Bacteria 1194
217 Ga0207667_10024261 3300025949 Bacteria 6661
218 Ga0207667_10132953 3300025949 Unclassified 2562
219 Ga0207667_10265901 3300025949 Bacteria 1754
220 Ga0207667_10635379 3300025949 Bacteria 1074
221 Ga0207651_10190024 3300025960 Bacteria 1637
222 Ga0207640_10140790 3300025981 Bacteria 1758
223 Ga0207639_10001539 3300026041 Bacteria 15489
224 Ga0207639_10005003 3300026041 Bacteria 8927
225 Ga0207639_10090121 3300026041 Bacteria 2452
226 Ga0207639_10113915 3300026041 Bacteria 2209
227 Ga0207678_10025003 3300026067 Bacteria 5215
228 Ga0207678_10060271 3300026067 Bacteria 3264
229 Ga0207678_10134247 3300026067 Bacteria 2112
230 Ga0207702_10000246 3300026078 Bacteria 63201
231 Ga0207702_10249178 3300026078 Bacteria 1667
232 Ga0207702_10329840 3300026078 Bacteria 1455
233 Ga0207702_10347027 3300026078 Bacteria 1419
234 Ga0207702_10443079 3300026078 Unclassified 1259
235 Ga0207702_10573806 3300026078 Bacteria 1105
236 Ga0207676_10011168 3300026095 Bacteria 6413
237 Ga0207674_10001151 3300026116 Bacteria 34261
238 Ga0207674_10005788 3300026116 Bacteria 14661
239 Ga0207674_10014936 3300026116 Bacteria 8556
240 Ga0207674_10036696 3300026116 Bacteria 5103
241 Ga0207698_10000421 3300026142 Bacteria 24394
242 Ga0207698_10003497 3300026142 Bacteria 9469
243 Ga0207698_10010901 3300026142 Bacteria 5869
244 Ga0207698_10011656 3300026142 Bacteria 5712
245 Ga0207698_10025108 3300026142 Bacteria 4192
246 Ga0207698_10027468 3300026142 Bacteria 4041
247 Ga0207698_10111681 3300026142 Bacteria 2292
248 Ga0207698_10227663 3300026142 Bacteria 1690
249 Ga0207698_10269979 3300026142 Bacteria 1567
250 Ga0268266_10041501 3300028379 Bacteria 3926
251 Ga0373930_0037243 3300034816 Bacteria 1023
252 Ga0373923_0031457 3300035111 Unclassified 2140
253 Ga0373957_0018596 3300035120 Bacteria 2437
254 Ga0373955_0034932 3300035172 Plasmid 2659
255 Ga0373933_0106611 3300035724 Bacteria 1744
256 Ga0373937_0021171 3300036401 Bacteria 5836
257 Ga0395899_0002359 3300037312 Bacteria 15373
258 Ga0395899_0115910 3300037312 Bacteria 1922
259 Ga0395899_0138605 3300037312 Bacteria 1732
260 Ga0395899_0183497 3300037312 Unclassified 1467
261 Ga0395900_0004245 3300037418 Bacteria 15205
262 Ga0395900_0046867 3300037418 Bacteria 4450
263 Ga0395900_0121164 3300037418 Unclassified 2684
264 Ga0395900_0122928 3300037418 Bacteria 2662
265 Ga0395900_0194529 3300037418 Unclassified 2055
266 Ga0395900_0205597 3300037418 Bacteria 1990
267 Ga0395900_0491334 3300037418 Bacteria 1179
268 Ga0395900_0708121 3300037418 Unclassified 940
269 Ga0395900_0721962 3300037418 Unclassified 929
270 Ga0395898_0004355 3300037466 Bacteria 15496
271 Ga0395898_0036093 3300037466 Bacteria 4910
272 Ga0395898_0053891 3300037466 Bacteria 3926
273 Ga0395898_0447468 3300037466 Bacteria 1230
274 Ga0395905_0049360 3300037471 Bacteria 3943
275 Ga0395905_0084917 3300037471 Bacteria 2966
276 Ga0395905_0097314 3300037471 Bacteria 2763
277 Ga0395905_0137373 3300037471 Bacteria 2300
278 Ga0395905_0150388 3300037471 Bacteria 2190
279 Ga0395905_0293426 3300037471 Bacteria 1513
280 Ga0395901_0002327 3300038443 Bacteria 19364
281 Ga0395901_0081188 3300038443 Bacteria 3387
282 Ga0395901_0083570 3300038443 Bacteria 3337
283 Ga0395901_0084629 3300038443 Bacteria 3314
284 Ga0395901_0112050 3300038443 Bacteria 2865
285 Ga0395901_0116497 3300038443 Bacteria 2806
286 Ga0395901_0377969 3300038443 Bacteria 1458
287 Ga0395901_0417228 3300038443 Bacteria 1377
288 Ga0395901_0572978 3300038443 Unclassified 1141
289 Ga0466969_0149585 3300044656 Bacteria 1076
290 Ga0466966_0124406 3300044684 Bacteria 1582
291 Ga0466961_0052515 3300044693 Bacteria 2601
292 Ga0466961_0092391 3300044693 Unclassified 1910
293 Ga0466961_0230971 3300044693 Unclassified 1138
294 Ga0466961_0261995 3300044693 Unclassified 1060
295 Ga0466963_0002404 3300044694 Bacteria 10469
296 Ga0466963_0002482 3300044694 Bacteria 10314
297 Ga0466963_0045011 3300044694 Bacteria 2906
298 Ga0466963_0167989 3300044694 Bacteria 1528
299 Ga0466963_0378026 3300044694 Bacteria 998
300 Ga0466957_0005096 3300044842 Bacteria 7345
301 Ga0466957_0051338 3300044842 Bacteria 2510
302 Ga0466957_0220747 3300044842 Bacteria 1251
303 Ga0466959_0099474 3300045049 Bacteria 2082
304 Ga0466959_0115589 3300045049 Unclassified 1911
305 Ga0466959_0163073 3300045049 Unclassified 1566
306 Ga0466967_0001074 3300045976 Bacteria 15102
307 Ga0466967_0004071 3300045976 Bacteria 9758
308 Ga0466967_0006921 3300045976 Bacteria 8105
309 Ga0466967_0008683 3300045976 Bacteria 7476
310 Ga0466967_0028037 3300045976 Bacteria 4695
311 Ga0466967_0029596 3300045976 Bacteria 4585
312 Ga0466967_0049789 3300045976 Bacteria 3666
313 Ga0466967_0065095 3300045976 Bacteria 3244
314 Ga0466967_0117678 3300045976 Bacteria 2450
315 Ga0466967_0188331 3300045976 Bacteria 1949
316 Ga0466967_0287650 3300045976 Bacteria 1578
317 Ga0466967_0421495 3300045976 Bacteria 1301
318 Ga0466967_0422603 3300045976 Bacteria 1299
319 Ga0466967_0491575 3300045976 Bacteria 1203
320 Ga0466967_0654588 3300045976 Bacteria 1039
321 Ga0466967_0934625 3300045976 Bacteria 863
322 Ga0495623_0331317 3300046679 Unclassified 833
323 Ga0495669_0063004 3300046684 Unclassified 1681
324 Ga0495602_0170746 3300048088 Bacteria 1688
325 Ga0496102_0250279 3300048905 Unclassified 1671
326 Ga0496107_0100908 3300048910 Unclassified 2116
327 Ga0496109_0001322 3300048912 Bacteria 20436
328 Ga0496111_0087576 3300048914 Unclassified 2279
329 Ga0496112_0001301 3300048915 Bacteria 18983
330 Ga0496113_0003389 3300048916 Bacteria 9534
331 Ga0501070_0308510 3300049586 Bacteria 1288
332 Ga0466962_0020521 3300061719 Bacteria 3175
333 Ga0466962_0032989 3300061719 Bacteria 2477
334 Ga0466962_0039494 3300061719 Bacteria 2260
335 Ga0395899_0038337
336 JGI24741J21665_1004367
337 JGI24739J22299_10005165
338 JGI24735J21928_10003466
339 JGI24735J21928_10049245
340 JGI24738J21930_10005306
341 Ga0070658_10001186
342 Ga0070658_10021494
343 Ga0070658_10083994
344 Ga0070683_100007551
345 Ga0070683_100012114
346 Ga0070683_100137931
347 Ga0070683_100141355
348 Ga0070683_100361061
349 Ga0070666_10007307
350 Ga0070680_100000197
351 Ga0070680_100033835
352 Ga0070680_100056854
353 Ga0070680_100079490
354 Ga0070680_100089076
355 Ga0070680_100185295
356 Ga0070682_100039398
357 Ga0070682_100066841
358 Ga0070660_100000861
359 Ga0070660_100008662
360 Ga0070660_100036772
361 Ga0070660_100047227
362 Ga0070660_100053802
363 Ga0070660_100093225
364 Ga0070660_100093522
365 Ga0070660_100368712
366 Ga0070691_10012494
367 Ga0070691_10107879
368 Ga0070661_100000101
369 Ga0070661_100027855
370 Ga0070661_100069258
371 Ga0070661_100070152
372 Ga0070661_100087585
373 Ga0070661_100093606
374 Ga0070661_100097567
375 Ga0070661_100122429
376 Ga0070661_100354560
377 Ga0070661_100440434
378 Ga0070692_10042726
379 Ga0070692_10073849
380 Ga0070692_10076020
381 Ga0070671_100505613
382 Ga0070673_100021056
383 Ga0070659_100000045
384 Ga0070659_100007575
385 Ga0070659_100019577
386 Ga0070659_100039506
387 Ga0070659_100067765
388 Ga0070667_100025572
389 Ga0070714_100290014
390 Ga0070663_100160382
391 Ga0070662_100000036
392 Ga0070662_100129694
393 Ga0070681_10022649
394 Ga0070679_100063973
395 Ga0070679_100351159
396 Ga0070684_100010629
397 Ga0070684_100020379
398 Ga0070684_100025922
399 Ga0070684_100179124
400 Ga0070684_100428739
401 Ga0068853_100000059
402 Ga0068853_100013457
403 Ga0068853_100301971
404 Ga0068853_100395706
405 Ga0070693_100000361
406 Ga0070665_100022291
407 Ga0068855_100003767
408 Ga0068855_100013991
409 Ga0068855_100324360
410 Ga0068855_100739859
411 Ga0070664_100000027
412 Ga0070664_100025634
413 Ga0070664_100028127
414 Ga0070664_100067966
415 Ga0070664_100140432
416 Ga0068857_100034480
417 Ga0068857_100054943
418 Ga0068857_100074376
419 Ga0068857_100134107
420 Ga0068854_100011111
421 Ga0068854_100143862
422 Ga0068854_100172981
423 Ga0068854_100197475
424 Ga0068854_100339511
425 Ga0068854_100579164
426 Ga0068856_100000699
427 Ga0068856_100185931
428 Ga0068856_100489805
429 Ga0068856_100594720
430 Ga0068856_100679833
431 Ga0068856_100827979
432 Ga0068852_100000433
433 Ga0068852_100002131
434 Ga0068852_100004384
435 Ga0068852_100031537
436 Ga0068852_100070104
437 Ga0068852_100081949
438 Ga0068859_100075996
439 Ga0068864_100004541
440 Ga0068864_100017981
441 Ga0068851_10065048
442 Ga0068851_10128586
443 Ga0068871_100756291
444 Ga0097620_100075997
445 Ga0105240_10018660
446 Ga0105240_10019627
447 Ga0105240_10034327
448 Ga0105241_10485051
449 Ga0105241_10511605
450 Ga0105248_10001451
451 Ga0105248_10216310
452 Ga0105237_10011326
453 Ga0105237_10043262
454 Ga0105238_10009347
455 Ga0105238_10009558
456 Ga0105238_10021258
457 Ga0105238_10057508
458 Ga0105238_10333541
459 Ga0105239_10148269
460 Ga0157373_10015698
461 Ga0157373_10019273
462 Ga0157373_10038456
463 Ga0157373_10062665
464 Ga0157373_10082562
465 Ga0157373_10118957
466 Ga0157373_10319556
467 Ga0157371_10012821
468 Ga0157371_10015590
469 Ga0157371_10030066
470 Ga0157371_10065689
471 Ga0157371_10122452
472 Ga0157370_10020069
473 Ga0157370_10020885
474 Ga0157370_10036395
475 Ga0157370_10081620
476 Ga0157370_10165663
477 Ga0157369_10009620
478 Ga0157369_10020994
479 Ga0157369_10075933
480 Ga0157369_10115982
481 Ga0157369_10142102
482 Ga0157369_10144757
483 Ga0157369_10168358
484 Ga0157369_10322112
485 Ga0157372_10002183
486 Ga0157372_10102191
487 Ga0157372_10219346
488 Ga0157372_10635102
489 Ga0163163_10000187
490 Ga0206353_10498858
491 Ga0207656_10011331
492 Ga0207656_10271455
493 Ga0207680_10006265
494 Ga0207647_10002445
495 Ga0207647_10007033
496 Ga0207705_10000912
497 Ga0207705_10021424
498 Ga0207705_10047571
499 Ga0207705_10056752
500 Ga0207705_10098266
501 Ga0207707_10260706
502 Ga0207671_10386136
503 Ga0207660_10000563
504 Ga0207660_10004550
505 Ga0207660_10030493
506 Ga0207660_10164081
507 Ga0207660_10179608
508 Ga0207657_10000133
509 Ga0207657_10003049
510 Ga0207657_10011223
511 Ga0207657_10035051
512 Ga0207657_10045621
513 Ga0207657_10063250
514 Ga0207657_10126878
515 Ga0207649_10000378
516 Ga0207649_10008289
517 Ga0207649_10023957
518 Ga0207649_10103754
519 Ga0207649_10150631
520 Ga0207649_10236904
521 Ga0207649_10306808
522 Ga0207652_10110160
523 Ga0207652_10194555
524 Ga0207652_10301911
525 Ga0207694_10008960
526 Ga0207694_10038310
527 Ga0207694_10247577
528 Ga0207664_10160268
529 Ga0207664_10278814
530 Ga0207644_10046410
531 Ga0207690_10000080
532 Ga0207690_10034444
533 Ga0207690_10040848
534 Ga0207690_10042683
535 Ga0207690_10074797
536 Ga0207706_10000159
537 Ga0207706_10027266
538 Ga0207706_10080695
539 Ga0207706_10231085
540 Ga0207711_10004362
541 Ga0207711_10008307
542 Ga0207661_10012433
543 Ga0207661_10073446
544 Ga0207661_10087797
545 Ga0207661_10116091
546 Ga0207661_10172259
547 Ga0207679_10000155
548 Ga0207679_10056831
549 Ga0207679_10174178
550 Ga0207679_10409783
551 Ga0207667_10024261
552 Ga0207667_10132953
553 Ga0207667_10265901
554 Ga0207667_10635379
555 Ga0207651_10190024
556 Ga0207640_10140790
557 Ga0207639_10001539
558 Ga0207639_10005003
559 Ga0207639_10090121
560 Ga0207639_10113915
561 Ga0207678_10025003
562 Ga0207678_10060271
563 Ga0207678_10134247
564 Ga0207702_10000246
565 Ga0207702_10249178
566 Ga0207702_10329840
567 Ga0207702_10347027
568 Ga0207702_10443079
569 Ga0207702_10573806
570 Ga0207676_10011168
571 Ga0207674_10001151
572 Ga0207674_10005788
573 Ga0207674_10014936
574 Ga0207674_10036696
575 Ga0207698_10000421
576 Ga0207698_10003497
577 Ga0207698_10010901
578 Ga0207698_10011656
579 Ga0207698_10025108
580 Ga0207698_10027468
581 Ga0207698_10111681
582 Ga0207698_10227663
583 Ga0207698_10269979
584 Ga0268266_10041501
585 Ga0373930_0037243
586 Ga0373923_0031457
587 Ga0373957_0018596
588 Ga0373955_0034932
589 Ga0373933_0106611
590 Ga0373937_0021171
591 Ga0395899_0002359
592 Ga0395899_0115910
593 Ga0395899_0138605
594 Ga0395899_0183497
595 Ga0395900_0004245
596 Ga0395900_0046867
597 Ga0395900_0121164
598 Ga0395900_0122928
599 Ga0395900_0194529
600 Ga0395900_0205597
601 Ga0395900_0491334
602 Ga0395900_0708121
603 Ga0395900_0721962
604 Ga0395898_0004355
605 Ga0395898_0036093
606 Ga0395898_0053891
607 Ga0395898_0447468
608 Ga0395905_0049360
609 Ga0395905_0084917
610 Ga0395905_0097314
611 Ga0395905_0137373
612 Ga0395905_0150388
613 Ga0395905_0293426
614 Ga0395901_0002327
615 Ga0395901_0081188
616 Ga0395901_0083570
617 Ga0395901_0084629
618 Ga0395901_0112050
619 Ga0395901_0116497
620 Ga0395901_0377969
621 Ga0395901_0417228
622 Ga0395901_0572978
623 Ga0466969_0149585
624 Ga0466966_0124406
625 Ga0466961_0052515
626 Ga0466961_0092391
627 Ga0466961_0230971
628 Ga0466961_0261995
629 Ga0466963_0002404
630 Ga0466963_0002482
631 Ga0466963_0045011
632 Ga0466963_0167989
633 Ga0466963_0378026
634 Ga0466957_0005096
635 Ga0466957_0051338
636 Ga0466957_0220747
637 Ga0466959_0099474
638 Ga0466959_0115589
639 Ga0466959_0163073
640 Ga0466967_0001074
641 Ga0466967_0004071
642 Ga0466967_0006921
643 Ga0466967_0008683
644 Ga0466967_0028037
645 Ga0466967_0029596
646 Ga0466967_0049789
647 Ga0466967_0065095
648 Ga0466967_0117678
649 Ga0466967_0188331
650 Ga0466967_0287650
651 Ga0466967_0421495
652 Ga0466967_0422603
653 Ga0466967_0491575
654 Ga0466967_0654588
655 Ga0466967_0934625
656 Ga0495623_0331317
657 Ga0495669_0063004
658 Ga0495602_0170746
659 Ga0496102_0250279
660 Ga0496107_0100908
661 Ga0496109_0001322
662 Ga0496111_0087576
663 Ga0496112_0001301
664 Ga0496113_0003389
665 Ga0501070_0308510
666 Ga0466962_0020521
667 Ga0466962_0032989
668 Ga0466962_0039494

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00027

cNMP_binding

Cyclic nucleotide-binding domain

96

183

0.92

PF13545

HTH_Crp_2

Crp-like helix-turn-helix domain

215

284

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rsx-assembly1.cif.gz_A regulatory subunit of camp-dependant protein kinase a from euglena gracilis at 1.6 a resolution 0.8965 10 143
7lz4-assembly4.cif.gz_D crystal structure of a211d mutant of protein kinase a ria subunit, a carney complex mutation 0.8945 12 128
5j48-assembly2.cif.gz_B pkg i's carboyl terminal cyclic nucleotide binding domain (cnb-b) in a complex with 8-pcpt-cgmp 0.8919 10 128
3of1-assembly1.cif.gz_A crystal structure of bcy1, the yeast regulatory subunit of pka 0.8845 10 137
3iia-assembly1.cif.gz_A crystal structure of apo (91-244) ria subunit of camp-dependent protein kinase 0.8826 12 128
ID Description Score Start End Superfamily
af_E7F4S2_593_708_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9363 38 143 2.60.120.10
4jv4A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9181 12 124 2.60.120.10
3cf6E02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9084 41 124 2.60.120.10
2gauA01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9053 24 157 2.60.120.10
af_Q9VL34_535_672_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.8997 10 121 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A6N7ALD4-F1-model_v4 Flp 0.9346 20 118 GO:0003700
GO:0005829
AF-A0A7I8DX66-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9232 19 131
AF-A0A2H0MND8-F1-model_v4 ABC transporter ATP-binding protein 0.9215 10 142 GO:0005524
GO:0016887
AF-A0A1G4VYM4-F1-model_v4 Cyclic nucleotide-binding domain-containing protein 0.9131 10 151
AF-A0A2A2RHS0-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9121 15 145 GO:0005524
GO:0005886
GO:0015421
GO:0016887

Map