F411812

General Info

Members Datasets Scaffolds Average Seq Length
334 237 668 210

Family's Representative Sequence

Representative Sequence 3300025291|Ga0209675_1003714|Ga0209675_10037148
Length 233
Sequence MQSEQIHLSHQQQKGHPYPGRFITLEGGEGSGKTSAIQYIERYYQEQGLPVMLTREPGGIEISEKIRTLILDPAHTAMDGRTEALLYAAARRQHLVEKVIPALQQGMIVICDRFIDSSLAYQGHARGLGMDEVWSINQFAIGEVMPDVTLYLDIEPEVGLARIQANAQREVNRLDLEQLSFHLKVREGYNIVAEQFPERIHKVDASLSLPEVAGQILQILAALQEDFPPTVSN

Samples

Sample ID Description Type Environment
1 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
16 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
17 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
18 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
23 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
24 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
25 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
26 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
27 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
28 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
29 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
30 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
31 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
32 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
35 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
36 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
37 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
38 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
49 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
50 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
52 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
53 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
54 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
55 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
56 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
59 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
60 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
61 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
62 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
63 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
64 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
65 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
66 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
67 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
68 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
69 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
70 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
71 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
72 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
73 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
74 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
75 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
76 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
77 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
78 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
79 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
80 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
81 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
82 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
83 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
84 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
85 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
86 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
87 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
88 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
89 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
90 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
91 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
92 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
93 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
94 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
95 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
96 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
98 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
99 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
100 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
101 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
102 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
103 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
104 2510917027 Brevibacillus sp. CF112 Isolate Rhizosphere
105 2511231119 Bacillus velezensis CAU B946 Isolate Rhizosphere
106 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
107 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
108 2540341094 Bacillus subtilis XF-1 Isolate Rhizosphere
109 2545555800 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
110 2551306519 Bacillus sp. WBUNB004 Isolate Rhizosphere
111 2554235283 Bacillus safensis VK Isolate Rhizosphere
112 2576861599 Bacillus amyloliquefaciens EGD-AQ14 Isolate Rhizosphere
113 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
114 2630968484 Bacillus methylotrophicus KACC 13105 Isolate Rhizosphere
115 2643221729 Bacillus sp. Root11 Isolate Unclassified
116 2643221730 Bacillus sp. Root131 Isolate Unclassified
117 2643221731 Bacillus sp. Root147 Isolate Unclassified
118 2643221732 Bacillus sp. Root239 Isolate Unclassified
119 2643221735 Bacillus sp. Root920 Isolate Unclassified
120 2648501850 Bacillus amyloliquefaciens RHNK22 Isolate Rhizosphere
121 2671180694 Paenibacillus sp. A3 Isolate Unclassified
122 2671180844 Bacillus amyloliquefaciens Bs006 Isolate Unclassified
123 2684622632 Bacillus cereus 905 Isolate Unclassified
124 2684623153 Bacillus pumilus SH-B9 Isolate Unclassified
125 2687453109 Bacillus pumilus SH-B11 Isolate Unclassified
126 2695420354 Bacillus sp. Co1-6 Isolate Unclassified
127 2695420987 Bacillus thuringiensis KNU-07 Isolate Unclassified
128 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
129 2716884898 Bacillus methylotrophicus FKM10 Isolate Rhizosphere
130 2718218445 Bacillus sp. B25(2016b) Isolate Rhizosphere
131 2721755693 Paenibacillus polymyxa YC0573 Isolate Rhizosphere
132 2728369359 Paenibacillus polymyxa YC0136 Isolate Rhizosphere
133 2738541295 Bacillus sp. OK085 Isolate Unclassified
134 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
135 2738541358 Bacillus sp. OV752 Isolate Unclassified
136 2738543006 Bacillus sp. OK077 Isolate Unclassified
137 2738543010 Bacillus sp. YR335 Isolate Unclassified
138 2738543017 Bacillus sp. OV186 Isolate Unclassified
139 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
140 2751185905 Paenibacillus kribbensis 6hRe76 Isolate Unclassified
141 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
142 2802428803 Paenibacillus peoriae NMA1017 Isolate Rhizosphere
143 2808606399 Bacillus sp. SJZ110 Isolate Rhizosphere
144 2811994870 Bacillus sp. JB4 Isolate Unclassified
145 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
146 2818991441 Niallia circulans 3243 Isolate Rhizosphere
147 2818991443 Bacillus thuringiensis 1230 Isolate Unclassified
148 2818991465 Priestia megaterium 3291 Isolate Rhizosphere
149 2818991468 Bacillus safensis 3300 Isolate Rhizosphere
150 2823526263 Bacillus altitudinis P-10 Isolate Unclassified
151 2842882022 Bacillus sp. R-71893 Isolate Unclassified
152 2857472729 Cohnella sp. R-74144 Isolate Unclassified
153 2857586860 Bacillus sp. R-71935 Isolate Unclassified
154 2857604169 Domibacillus sp. R-71921 Isolate Unclassified
155 2857609550 Domibacillus sp. R-71929 Isolate Unclassified
156 2858438669 Leuconostoc mesenteroides YL48 Isolate Unclassified
157 2860837431 Bacillus sp. WR11 Isolate Unclassified
158 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
159 2865002811 Paenibacillus sp. R-74131 Isolate Unclassified
160 2877768649 Bacillus amyloliquefaciens Y14 Isolate Rhizosphere
161 2880169592 Bacillus velezensis T20E-257 Isolate Unclassified
162 2889042446 Paenibacillus sp. 37 Isolate Rhizosphere
163 2889276214 Paenibacillus sp. PvR133 Isolate Rhizosphere
164 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
165 2897109615 Bacillus amyloliquefaciens YP6 Isolate Unclassified
166 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
167 2904490793 Paenibacillus sp. 1295 Isolate Rhizosphere
168 2904524088 Priestia megaterium 1428 Isolate Rhizosphere
169 2904560550 Bacillus velezensis 1780 Isolate Rhizosphere
170 2904595352 Paenibacillus sp. 1182 Isolate Unclassified
171 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
172 2908665501 Bacillus pumilus 1391 Isolate Rhizosphere
173 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
174 2916971899 Alkalihalobacillus miscanthi AK13 Isolate Rhizosphere
175 2919093281 Bacillus safensis 1383 Isolate Rhizosphere
176 2919143609 Priestia megaterium 1751 Isolate Rhizosphere
177 2919160200 Paenibacillus sp. 2003 Isolate Unclassified
178 2919517244 Priestia aryabhattai 3820 Isolate Unclassified
179 2919720352 Priestia megaterium 4340 Isolate Unclassified
180 2919726948 Bacillus pumilus 4489 Isolate Unclassified
181 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
182 2928093941 Priestia aryabhattai 1389 Isolate Rhizosphere
183 2928519762 Leuconostoc citreum 1377 Isolate Rhizosphere
184 2929004312 Priestia megaterium 1104 Isolate Unclassified
185 2929233124 Bacillus sp. R-74298 Hybrid assembly Isolate Unclassified
186 2931384279 Paenibacillus sp. DR312 Isolate Rhizosphere
187 2936361878 Neobacillus endophyticus BRMEA1 Isolate Unclassified
188 2938917290 Bacillus sp. CR71 Isolate Unclassified
189 2939702853 Paenibacillus sp. PvR008 Isolate Rhizosphere
190 2946053406 Paenibacillus sp. W4I10 Isolate Rhizosphere
191 2947426588 Bacillus sp. RZ2MS9 Isolate Rhizosphere
192 2954773129 Bacillus sp. TBS-096 Isolate Rhizosphere
193 2956897341 Ectobacillus funiculus W18-2 Isolate Rhizosphere
194 2960319331 Priestia megaterium AFS057444 Isolate Unclassified
195 2960375949 Priestia megaterium AFS067084 Isolate Unclassified
196 2962290636 Bacillus subtilis TLO3 Isolate Rhizosphere
197 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
198 2965761152 Bacillus sp. COPE52 Isolate Unclassified
199 2969136845 Bacillus subtilis TLO3 Isolate Rhizosphere
200 2969141011 Bacillus velezensis MH25 Isolate Unclassified
201 2969765954 Bacillus intestinalis GM2 Isolate Rhizosphere
202 2969770375 Bacillus subtilis GM5 Isolate Rhizosphere
203 2971893375 Bacillus sp. HNA3 Isolate Rhizosphere
204 2979083700 Bacillus toyonensis SORGH_AS 407 Isolate Unclassified
205 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
206 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
207 2980492589 Bacillus subtilis GQJK2 Isolate Rhizosphere
208 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
209 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
210 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
211 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
212 2996706504 Paenibacillus sp. OT2-17 Isolate Rhizosphere
213 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
214 3001892409 Neobacillus rhizophilus FJAT-49825 Isolate Rhizosphere
215 3006826541 Bacillus haikouensis CrR16 Isolate Unclassified
216 3006973921 Bacillus sp. FJAT-49736 Isolate Rhizosphere
217 3006984091 Lederbergia citrea FJAT-49754 Isolate Rhizosphere
218 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
219 648028048 Paenibacillus polymyxa E681 Isolate Rhizosphere
220 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
221 8022621104 Bacillus sp. PIC28 Isolate Rhizosphere
222 8022630665 Bacillus sp. PW192 Isolate Rhizosphere
223 8022653035 Bacillus sp. Rc4 Isolate Unclassified
224 8022792930 Bacillus sp. Xin Isolate Rhizosphere
225 8022893055 Bacillus aryabhattai AFS007213 Isolate Unclassified
226 8022914991 Bacillus aryabhattai SQU-R12 Isolate Unclassified
227 8023438354 Bacillus sp. BH2 Isolate Unclassified
228 8023444577 Bacillus sp. BH32 Isolate Unclassified
229 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere
230 8051952484 Bacillus amyloliquefaciens K2 Isolate Rhizosphere
231 8052174270 Bacillus velezensis CH13 Isolate Rhizosphere
232 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
233 8055632911 Paenibacillus radicibacter N1-5-1-14 Isolate Unclassified
234 8057582654 Bacillus arachidis YX15 Isolate Rhizosphere
235 8057632132 Cytobacillus kochii RZ2 Isolate Rhizosphere
236 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere
237 8057977335 Paenibacillus oenotherae DT7-4 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 57.19
Metatranscriptomes 1.8
Isolates 41.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.87
Nodule 1.5
Rhizoplane 4.49
Rhizosphere 46.71
Stem 0
Stem Tuber 0
Unclassified 0.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209675_1003714 3300025291 Bacteria 7100
2 JGI25159J45721_1009884 3300002987 Bacteria 2481
3 JGI25151J46595_10000294 3300003187 Bacteria 55267
4 JGI25151J46595_10011275 3300003187 Bacteria 4116
5 JGI25151J46595_10013680 3300003187 Bacteria 3642
6 JGI25151J46595_10013816 3300003187 Bacteria 3621
7 JGI25151J46595_10013836 3300003187 Bacteria 3618
8 JGI25151J46595_10019668 3300003187 Bacteria 2863
9 JGI25151J46595_10020378 3300003187 Bacteria 2797
10 JGI25151J46595_10022128 3300003187 Bacteria 2645
11 JGI25151J46595_10031830 3300003187 Bacteria 2054
12 JGI25151J46595_10041471 3300003187 Bacteria 1672
13 JGI25151J46595_10058968 3300003187 Bacteria 1238
14 rootH2_10071156 3300003320 Bacteria 3335
15 rootL2_10026919 3300003322 Bacteria 23390
16 rootH1_10260965 3300003323 Bacteria 2765
17 Ga0006562J51391_1000026 3300003578 Bacteria 55240
18 Ga0006562J51391_1001096 3300003578 Bacteria 7601
19 Ga0006562J51391_1008740 3300003578 Bacteria 2673
20 Ga0006562J51391_1036913 3300003578 Bacteria 1353
21 Ga0055532_1005065 3300003758 Bacteria 1895
22 Ga0055535_1003128 3300003761 Bacteria 4967
23 Ga0055541_1003743 3300003841 Bacteria 2823
24 Ga0070670_100109552 3300005331 Bacteria 2379
25 Ga0070670_100381943 3300005331 Bacteria 1241
26 Ga0070669_100675832 3300005353 Bacteria 870
27 Ga0070675_100132244 3300005354 Bacteria 2127
28 Ga0070671_100053951 3300005355 Bacteria 3341
29 Ga0068864_100113709 3300005618 Bacteria 2413
30 Ga0070715_10307592 3300006163 Bacteria 850
31 Ga0079104_1003286 3300006946 Bacteria 7701
32 Ga0079104_1003940 3300006946 Bacteria 6620
33 Ga0105251_10004718 3300009011 Bacteria 9147
34 Ga0105251_10031999 3300009011 Bacteria 2626
35 Ga0105251_10054073 3300009011 Bacteria 1908
36 Ga0105244_10007338 3300009036 Bacteria 7012
37 Ga0105244_10020094 3300009036 Bacteria 3714
38 Ga0105244_10041436 3300009036 Bacteria 2386
39 Ga0105244_10169467 3300009036 Bacteria 1039
40 Ga0105250_10011000 3300009092 Bacteria 3761
41 Ga0105250_10012558 3300009092 Bacteria 3492
42 Ga0105250_10020650 3300009092 Bacteria 2661
43 Ga0105250_10020912 3300009092 Bacteria 2642
44 Ga0105250_10076389 3300009092 Bacteria 1355
45 Ga0105245_10007570 3300009098 Bacteria 9513
46 Ga0105247_10003349 3300009101 Bacteria 10487
47 Ga0105243_10011289 3300009148 Bacteria 6758
48 Ga0105242_10003548 3300009176 Bacteria 12126
49 Ga0105249_10123260 3300009553 Bacteria 2465
50 Ga0105249_10921835 3300009553 Bacteria 941
51 Ga0105246_10010346 3300011119 Bacteria 5769
52 Ga0105246_10027499 3300011119 Bacteria 3727
53 Ga0105246_10134956 3300011119 Bacteria 1848
54 Ga0157371_10006708 3300013102 Bacteria 9415
55 Ga0157378_10009806 3300013297 Bacteria 8348
56 Ga0157377_10000539 3300014745 Bacteria 15995
57 Ga0209566_100116 3300025225 Bacteria 107510
58 Ga0209147_100136 3300025229 Bacteria 117683
59 Ga0209147_100717 3300025229 Bacteria 16793
60 Ga0209147_102199 3300025229 Bacteria 5270
61 Ga0209258_104308 3300025242 Bacteria 2737
62 Ga0209673_1003365 3300025273 Bacteria 9518
63 Ga0209130_1003110 3300025284 Bacteria 7398
64 Ga0209130_1006821 3300025284 Bacteria 3638
65 Ga0209130_1006826 3300025284 Bacteria 3635
66 Ga0209676_1006831 3300025292 Bacteria 5532
67 Ga0209025_1000734 3300025294 Bacteria 55490
68 Ga0209025_1000834 3300025294 Bacteria 48958
69 Ga0209025_1002991 3300025294 Bacteria 16752
70 Ga0209025_1003686 3300025294 Bacteria 14128
71 Ga0209025_1007082 3300025294 Bacteria 8482
72 Ga0209025_1012773 3300025294 Bacteria 5345
73 Ga0209025_1017460 3300025294 Bacteria 4138
74 Ga0209025_1018803 3300025294 Bacteria 3888
75 Ga0209025_1018871 3300025294 Bacteria 3878
76 Ga0209025_1019004 3300025294 Bacteria 3847
77 Ga0209025_1019292 3300025294 Bacteria 3797
78 Ga0209025_1020036 3300025294 Bacteria 3681
79 Ga0209025_1022850 3300025294 Bacteria 3297
80 Ga0209025_1029183 3300025294 Bacteria 2678
81 Ga0209025_1034370 3300025294 Bacteria 2316
82 Ga0209025_1061511 3300025294 Bacteria 1401
83 Ga0207426_1038672 3300025302 Bacteria 1501
84 Ga0207696_1002558 3300025711 Bacteria 8852
85 Ga0207696_1003549 3300025711 Bacteria 7048
86 Ga0207696_1003612 3300025711 Bacteria 6979
87 Ga0207696_1009085 3300025711 Bacteria 3727
88 Ga0207696_1010815 3300025711 Bacteria 3326
89 Ga0207696_1019818 3300025711 Bacteria 2180
90 Ga0207655_1008584 3300025728 Bacteria 6464
91 Ga0207655_1027286 3300025728 Bacteria 2723
92 Ga0207655_1107636 3300025728 Bacteria 948
93 Ga0207713_1000839 3300025735 Bacteria 28258
94 Ga0207713_1000866 3300025735 Bacteria 27707
95 Ga0207713_1008017 3300025735 Bacteria 6140
96 Ga0207713_1023461 3300025735 Bacteria 2903
97 Ga0207713_1024376 3300025735 Bacteria 2823
98 Ga0207710_10008339 3300025900 Bacteria 4371
99 Ga0207645_10181770 3300025907 Bacteria 1380
100 Ga0207681_10528994 3300025923 Bacteria 968
101 Ga0207687_10016293 3300025927 Bacteria 4880
102 Ga0207686_10013732 3300025934 Bacteria 4490
103 Ga0207709_10010485 3300025935 Bacteria 5103
104 Ga0207709_10790486 3300025935 Bacteria 765
105 Ga0207712_10355966 3300025961 Bacteria 1218
106 Ga0207712_10500144 3300025961 Bacteria 1039
107 Ga0209281_1000059 3300027111 Bacteria 295913
108 Ga0209281_1000435 3300027111 Bacteria 61761
109 Ga0209371_1006371 3300027312 Bacteria 4382
110 Ga0209970_1012712 3300027614 Bacteria 1392
111 Ga0237817_10033 3300030083 Bacteria 48418
112 Ga0237817_10401 3300030083 Bacteria 7235
113 Ga0268256_1006402 3300030500 Bacteria 4385
114 Ga0307408_100089262 3300031548 Bacteria 2323
115 Ga0307408_100244914 3300031548 Bacteria 1475
116 Ga0307406_10387992 3300031901 Bacteria 1103
117 Ga0307416_100298016 3300032002 Bacteria 1601
118 Ga0307416_101162205 3300032002 Bacteria 877
119 Ga0237819_02464 3300038705 Bacteria 3711
120 Ga0237819_02535 3300038705 Bacteria 3631
121 Ga0439439_0001476 3300041406 Bacteria 4702
122 Ga0451855_1508422 3300041511 Bacteria 5557
123 Ga0439449_0000662 3300042007 Bacteria 13021
124 Ga0439457_032506 3300042014 Bacteria 1158
125 Ga0439462_0009533 3300042015 Bacteria 2455
126 Ga0466967_0050141 3300045976 Bacteria 3654
127 Ga0466967_0585166 3300045976 Bacteria 1101
128 Ga0495603_0008253 3300046455 Bacteria 6294
129 Ga0495585_0084256 3300046492 Bacteria 1719
130 Ga0495606_0000038 3300046507 Bacteria 226810
131 Ga0495606_0148683 3300046507 Bacteria 1377
132 Ga0495620_0078634 3300046515 Bacteria 1337
133 Ga0495654_0007934 3300046530 Bacteria 5898
134 Ga0495649_0003900 3300046694 Bacteria 9869
135 Ga0495672_0025251 3300047320 Bacteria 3807
136 Ga0495626_0018131 3300048091 Bacteria 3542
137 Ga0496100_0001157 3300048903 Bacteria 12834
138 Ga0496102_0138062 3300048905 Bacteria 2284
139 Ga0496103_0006698 3300048906 Bacteria 6876
140 Ga0496104_0011022 3300048907 Bacteria 8087
141 Ga0496105_0001202 3300048908 Bacteria 18028
142 Ga0496106_0002287 3300048909 Bacteria 14290
143 Ga0496107_0008398 3300048910 Bacteria 7146
144 Ga0496107_0303327 3300048910 Unclassified 1189
145 Ga0496108_0014252 3300048911 Bacteria 6487
146 Ga0496109_0014402 3300048912 Bacteria 6881
147 Ga0496110_0012954 3300048913 Bacteria 6876
148 Ga0496111_0296134 3300048914 Bacteria 1199
149 Ga0496112_0001079 3300048915 Bacteria 20179
150 Ga0496113_0039749 3300048916 Bacteria 3464
151 Ga0496113_0058236 3300048916 Bacteria 2906
152 Ga0496116_0003491 3300048919 Bacteria 15469
153 Ga0496116_0009357 3300048919 Bacteria 8365
154 Ga0496116_0016836 3300048919 Bacteria 5703
155 Ga0496116_0054010 3300048919 Unclassified 2650
156 Ga0496116_0075661 3300048919 Bacteria 2112
157 Ga0496116_0180702 3300048919 Bacteria 1130
158 Ga0496116_0263800 3300048919 Bacteria 847
159 Ga0496117_0012274 3300048920 Bacteria 7573
160 Ga0496118_0104787 3300048921 Bacteria 1897
161 Ga0496118_0142234 3300048921 Bacteria 1518
162 Ga0496119_0000682 3300048922 Bacteria 45362
163 Ga0496119_0075345 3300048922 Bacteria 1961
164 Ga0496119_0097769 3300048922 Bacteria 1654
165 Ga0496120_0000678 3300048923 Bacteria 49988
166 Ga0496120_0018545 3300048923 Bacteria 4479
167 Ga0496120_0204881 3300048923 Bacteria 952
168 Ga0496121_0050761 3300048924 Bacteria 3500
169 Ga0496121_0345216 3300048924 Bacteria 993
170 Ga0496122_0008861 3300048925 Bacteria 10734
171 Ga0496122_0012050 3300048925 Bacteria 8669
172 Ga0496122_0036643 3300048925 Bacteria 3961
173 Ga0496122_0367946 3300048925 Bacteria 743
174 Ga0496123_0002354 3300048926 Bacteria 23709
175 Ga0496123_0026698 3300048926 Bacteria 4319
176 Ga0496124_0000542 3300048927 Bacteria 64211
177 Ga0496124_0010181 3300048927 Bacteria 9562
178 Ga0496124_0202089 3300048927 Bacteria 1510
179 Ga0496124_0527747 3300048927 Bacteria 785
180 Ga0496125_0005940 3300048928 Bacteria 13373
181 Ga0496125_0007220 3300048928 Bacteria 11841
182 Ga0496125_0008810 3300048928 Bacteria 10492
183 Ga0496126_0002188 3300048929 Bacteria 27167
184 Ga0496126_0002905 3300048929 Bacteria 22320
185 Ga0496126_0005347 3300048929 Bacteria 14684
186 Ga0496126_0012044 3300048929 Bacteria 8887
187 Ga0496126_0012170 3300048929 Bacteria 8831
188 Ga0501312_000312 3300049528 Bacteria 3639
189 Ga0501317_015673 3300049533 Bacteria 974
190 Ga0501217_003373 3300049661 Bacteria 3227
191 Ga0501217_122430 3300049661 Bacteria 756
192 Ga0501233_052100 3300049668 Bacteria 994
193 Ga0501251_032940 3300049681 Bacteria 749
194 Ga0501255_027649 3300049684 Bacteria 773
195 Ga0501225_0104311 3300049705 Bacteria 831
196 Ga0501234_010942 3300049707 Bacteria 1416
197 Ga0501270_007893 3300049767 Bacteria 1331
198 2511176001 2510917027 Bacteria 5287437
199 2511697895 2511231119 Bacteria 4019861
200 2512736628 2512564039 Bacteria 8739048
201 2524191714 2524023129 Bacteria 6762600
202 2540605119 2540341094 Bacteria 4061186
203 2545559852 2545555800 Bacteria 4222588
204 2553395947 2551306519 Bacteria 5465154
205 2555470930 2554235283 Bacteria 3683090
206 2578930809 2576861599 Bacteria 4217202
207 2595320773 2593339198 Bacteria 7267884
208 2631985990 2630968484 Bacteria 3876276
209 2644705889 2643221729 Bacteria 6621700
210 2644713339 2643221730 Bacteria 6523787
211 2644718574 2643221731 Bacteria 5623886
212 2644723505 2643221732 Bacteria 5756404
213 2644741751 2643221735 Bacteria 3676263
214 2651529648 2648501850 Bacteria 3975476
215 2673818965 2671180694 Bacteria 7506943
216 2674421165 2671180844 Bacteria 4164150
217 2685153473 2684622632 Bacteria 5380049
218 2686995217 2684623153 Bacteria 3878815
219 2687496466 2687453109 Bacteria 3860091
220 2695629810 2695420354 Bacteria 3922431
221 2698319717 2695420987 Bacteria 6152737
222 2705991922 2703719227 Bacteria 5631989
223 2717914504 2716884898 Bacteria 3928789
224 2721503347 2718218445 Bacteria 5113413
225 2723601364 2721755693 Bacteria 6126117
226 2730137487 2728369359 Bacteria 5621728
227 2738817592 2738541295 Bacteria 5730091
228 2738840610 2738541299 Bacteria 4020721
229 2739160231 2738541358 Bacteria 5932299
230 2739212750 2738543006 Bacteria 5904091
231 2739234678 2738543010 Bacteria 5583595
232 2739271827 2738543017 Bacteria 4271950
233 2745169596 2744054657 Bacteria 5016802
234 2753812974 2751185905 Bacteria 6142767
235 2793186384 2791355222 Bacteria 5898266
236 2802440577 2802428803 Bacteria 5806948
237 2809057161 2808606399 Bacteria 4021018
238 2812314354 2811994870 Bacteria 3776934
239 2817616324 2816332336 Bacteria 5207640
240 2819571324 2818991441 Bacteria 5062707
241 2819585124 2818991443 Bacteria 6598732
242 2819712042 2818991465 Bacteria 5388835
243 2819726111 2818991468 Bacteria 3723169
244 2823526305 2823526263 Bacteria 3765752
245 2842888023 2842882022 Bacteria 6158489
246 2857477613 2857472729 Bacteria 6568124
247 2857591237 2857586860 Bacteria 4354574
248 2857609066 2857604169 Bacteria 5111450
249 2857613510 2857609550 Bacteria 3753890
250 2858439387 2858438669 Bacteria 2058402
251 2860837471 2860837431 Bacteria 4202080
252 2865002649 2864997549 Bacteria 5139696
253 2865008724 2865002811 Bacteria 6333767
254 2877768690 2877768649 Bacteria 3957164
255 2880169633 2880169592 Bacteria 3900066
256 2889042465 2889042446 Bacteria 7618936
257 2889277457 2889276214 Bacteria 5979355
258 2889299053 2889295896 Bacteria 4704906
259 2897109657 2897109615 Bacteria 4009619
260 2904119535 2904113452 Bacteria 7796941
261 2904496846 2904490793 Bacteria 7046938
262 2904530272 2904524088 Bacteria 5887454
263 2904564547 2904560550 Bacteria 4029838
264 2904597386 2904595352 Bacteria 6124848
265 2904601003 2904595352 Bacteria 6124848
266 2907205071 2907202186 Bacteria 6632024
267 2908669293 2908665501 Bacteria 3678115
268 2915609137 2915606848 Bacteria 6032732
269 2916971947 2916971899 Bacteria 4250608
270 2919097052 2919093281 Bacteria 3660974
271 2919149593 2919143609 Bacteria 6219228
272 2919166199 2919160200 Bacteria 6929020
273 2919523117 2919517244 Bacteria 5858162
274 2919726313 2919720352 Bacteria 5986006
275 2919730723 2919726948 Bacteria 3696050
276 2925332279 2925326138 Bacteria 9652120
277 2928099775 2928093941 Bacteria 5965005
278 2928521370 2928519762 Bacteria 1953908
279 2929010056 2929004312 Bacteria 5678476
280 2929233161 2929233124 Bacteria 5948380
281 2931385890 2931384279 Bacteria 7299545
282 2936363589 2936361878 Bacteria 5632809
283 2938917339 2938917290 Bacteria 5914775
284 2939706820 2939702853 Bacteria 5139229
285 2946058215 2946053406 Bacteria 6978655
286 2947426627 2947426588 Bacteria 5357194
287 2954776188 2954773129 Bacteria 3741715
288 2956901162 2956897341 Bacteria 5447711
289 2960323614 2960319331 Bacteria 5502575
290 2960379229 2960375949 Bacteria 5361395
291 2962290681 2962290636 Bacteria 4072939
292 2964376584 2964375228 Bacteria 4909004
293 2965761224 2965761152 Bacteria 5806513
294 2969136888 2969136845 Bacteria 3923176
295 2969141054 2969141011 Bacteria 4118468
296 2969766298 2969765954 Bacteria 4216713
297 2969770382 2969770375 Bacteria 4271280
298 2971893418 2971893375 Bacteria 3929648
299 2979089182 2979083700 Bacteria 5894929
300 2980129488 2980125574 Bacteria 5567337
301 2980185283 2980182181 Bacteria 9454109
302 2980492632 2980492589 Bacteria 4072961
303 2981289565 2981284811 Bacteria 4641497
304 2981294510 2981289755 Bacteria 4641509
305 2981985221 2981980479 Bacteria 4641628
306 2981990156 2981985349 Bacteria 4641497
307 2996711051 2996706504 Bacteria 5757485
308 3001272010 3001267043 Bacteria 4823521
309 3001894130 3001892409 Bacteria 6328293
310 3006828681 3006826541 Bacteria 4678913
311 3006976360 3006973921 Bacteria 4423788
312 3006978451 3006973921 Bacteria 4423788
313 3006988395 3006984091 Bacteria 4207523
314 3006993314 3006988479 Bacteria 4767936
315 648167948 648028048 Bacteria 5394884
316 8002323450 8002317523 Bacteria 8051857
317 8022621125 8022621104 Bacteria 5241040
318 8022631734 8022630665 Bacteria 3886130
319 8022655713 8022653035 Bacteria 4035078
320 8022796038 8022792930 Bacteria 5693794
321 8022896328 8022893055 Bacteria 5300455
322 8022917956 8022914991 Bacteria 5584517
323 8023440738 8023438354 Bacteria 5779374
324 8023447659 8023444577 Bacteria 5661597
325 8046992111 8046991243 Bacteria 8497463
326 8051956560 8051952484 Bacteria 3926774
327 8052175037 8052174270 Bacteria 3881265
328 8054801415 8054795415 Bacteria 9785225
329 8055634119 8055632911 Bacteria 5283357
330 8055635345 8055632911 Bacteria 5283357
331 8057582693 8057582654 Bacteria 5218944
332 8057632168 8057632132 Bacteria 4726859
333 8057735761 8057733483 Bacteria 6578323
334 8057979750 8057977335 Bacteria 5694872
335 Ga0209675_1003714
336 JGI25159J45721_1009884
337 JGI25151J46595_10000294
338 JGI25151J46595_10011275
339 JGI25151J46595_10013680
340 JGI25151J46595_10013816
341 JGI25151J46595_10013836
342 JGI25151J46595_10019668
343 JGI25151J46595_10020378
344 JGI25151J46595_10022128
345 JGI25151J46595_10031830
346 JGI25151J46595_10041471
347 JGI25151J46595_10058968
348 rootH2_10071156
349 rootL2_10026919
350 rootH1_10260965
351 Ga0006562J51391_1000026
352 Ga0006562J51391_1001096
353 Ga0006562J51391_1008740
354 Ga0006562J51391_1036913
355 Ga0055532_1005065
356 Ga0055535_1003128
357 Ga0055541_1003743
358 Ga0070670_100109552
359 Ga0070670_100381943
360 Ga0070669_100675832
361 Ga0070675_100132244
362 Ga0070671_100053951
363 Ga0068864_100113709
364 Ga0070715_10307592
365 Ga0079104_1003286
366 Ga0079104_1003940
367 Ga0105251_10004718
368 Ga0105251_10031999
369 Ga0105251_10054073
370 Ga0105244_10007338
371 Ga0105244_10020094
372 Ga0105244_10041436
373 Ga0105244_10169467
374 Ga0105250_10011000
375 Ga0105250_10012558
376 Ga0105250_10020650
377 Ga0105250_10020912
378 Ga0105250_10076389
379 Ga0105245_10007570
380 Ga0105247_10003349
381 Ga0105243_10011289
382 Ga0105242_10003548
383 Ga0105249_10123260
384 Ga0105249_10921835
385 Ga0105246_10010346
386 Ga0105246_10027499
387 Ga0105246_10134956
388 Ga0157371_10006708
389 Ga0157378_10009806
390 Ga0157377_10000539
391 Ga0209566_100116
392 Ga0209147_100136
393 Ga0209147_100717
394 Ga0209147_102199
395 Ga0209258_104308
396 Ga0209673_1003365
397 Ga0209130_1003110
398 Ga0209130_1006821
399 Ga0209130_1006826
400 Ga0209676_1006831
401 Ga0209025_1000734
402 Ga0209025_1000834
403 Ga0209025_1002991
404 Ga0209025_1003686
405 Ga0209025_1007082
406 Ga0209025_1012773
407 Ga0209025_1017460
408 Ga0209025_1018803
409 Ga0209025_1018871
410 Ga0209025_1019004
411 Ga0209025_1019292
412 Ga0209025_1020036
413 Ga0209025_1022850
414 Ga0209025_1029183
415 Ga0209025_1034370
416 Ga0209025_1061511
417 Ga0207426_1038672
418 Ga0207696_1002558
419 Ga0207696_1003549
420 Ga0207696_1003612
421 Ga0207696_1009085
422 Ga0207696_1010815
423 Ga0207696_1019818
424 Ga0207655_1008584
425 Ga0207655_1027286
426 Ga0207655_1107636
427 Ga0207713_1000839
428 Ga0207713_1000866
429 Ga0207713_1008017
430 Ga0207713_1023461
431 Ga0207713_1024376
432 Ga0207710_10008339
433 Ga0207645_10181770
434 Ga0207681_10528994
435 Ga0207687_10016293
436 Ga0207686_10013732
437 Ga0207709_10010485
438 Ga0207709_10790486
439 Ga0207712_10355966
440 Ga0207712_10500144
441 Ga0209281_1000059
442 Ga0209281_1000435
443 Ga0209371_1006371
444 Ga0209970_1012712
445 Ga0237817_10033
446 Ga0237817_10401
447 Ga0268256_1006402
448 Ga0307408_100089262
449 Ga0307408_100244914
450 Ga0307406_10387992
451 Ga0307416_100298016
452 Ga0307416_101162205
453 Ga0237819_02464
454 Ga0237819_02535
455 Ga0439439_0001476
456 Ga0451855_1508422
457 Ga0439449_0000662
458 Ga0439457_032506
459 Ga0439462_0009533
460 Ga0466967_0050141
461 Ga0466967_0585166
462 Ga0495603_0008253
463 Ga0495585_0084256
464 Ga0495606_0000038
465 Ga0495606_0148683
466 Ga0495620_0078634
467 Ga0495654_0007934
468 Ga0495649_0003900
469 Ga0495672_0025251
470 Ga0495626_0018131
471 Ga0496100_0001157
472 Ga0496102_0138062
473 Ga0496103_0006698
474 Ga0496104_0011022
475 Ga0496105_0001202
476 Ga0496106_0002287
477 Ga0496107_0008398
478 Ga0496107_0303327
479 Ga0496108_0014252
480 Ga0496109_0014402
481 Ga0496110_0012954
482 Ga0496111_0296134
483 Ga0496112_0001079
484 Ga0496113_0039749
485 Ga0496113_0058236
486 Ga0496116_0003491
487 Ga0496116_0009357
488 Ga0496116_0016836
489 Ga0496116_0054010
490 Ga0496116_0075661
491 Ga0496116_0180702
492 Ga0496116_0263800
493 Ga0496117_0012274
494 Ga0496118_0104787
495 Ga0496118_0142234
496 Ga0496119_0000682
497 Ga0496119_0075345
498 Ga0496119_0097769
499 Ga0496120_0000678
500 Ga0496120_0018545
501 Ga0496120_0204881
502 Ga0496121_0050761
503 Ga0496121_0345216
504 Ga0496122_0008861
505 Ga0496122_0012050
506 Ga0496122_0036643
507 Ga0496122_0367946
508 Ga0496123_0002354
509 Ga0496123_0026698
510 Ga0496124_0000542
511 Ga0496124_0010181
512 Ga0496124_0202089
513 Ga0496124_0527747
514 Ga0496125_0005940
515 Ga0496125_0007220
516 Ga0496125_0008810
517 Ga0496126_0002188
518 Ga0496126_0002905
519 Ga0496126_0005347
520 Ga0496126_0012044
521 Ga0496126_0012170
522 Ga0501312_000312
523 Ga0501317_015673
524 Ga0501217_003373
525 Ga0501217_122430
526 Ga0501233_052100
527 Ga0501251_032940
528 Ga0501255_027649
529 Ga0501225_0104311
530 Ga0501234_010942
531 Ga0501270_007893
532 2511176001
533 2511697895
534 2512736628
535 2524191714
536 2540605119
537 2545559852
538 2553395947
539 2555470930
540 2578930809
541 2595320773
542 2631985990
543 2644705889
544 2644713339
545 2644718574
546 2644723505
547 2644741751
548 2651529648
549 2673818965
550 2674421165
551 2685153473
552 2686995217
553 2687496466
554 2695629810
555 2698319717
556 2705991922
557 2717914504
558 2721503347
559 2723601364
560 2730137487
561 2738817592
562 2738840610
563 2739160231
564 2739212750
565 2739234678
566 2739271827
567 2745169596
568 2753812974
569 2793186384
570 2802440577
571 2809057161
572 2812314354
573 2817616324
574 2819571324
575 2819585124
576 2819712042
577 2819726111
578 2823526305
579 2842888023
580 2857477613
581 2857591237
582 2857609066
583 2857613510
584 2858439387
585 2860837471
586 2865002649
587 2865008724
588 2877768690
589 2880169633
590 2889042465
591 2889277457
592 2889299053
593 2897109657
594 2904119535
595 2904496846
596 2904530272
597 2904564547
598 2904597386
599 2904601003
600 2907205071
601 2908669293
602 2915609137
603 2916971947
604 2919097052
605 2919149593
606 2919166199
607 2919523117
608 2919726313
609 2919730723
610 2925332279
611 2928099775
612 2928521370
613 2929010056
614 2929233161
615 2931385890
616 2936363589
617 2938917339
618 2939706820
619 2946058215
620 2947426627
621 2954776188
622 2956901162
623 2960323614
624 2960379229
625 2962290681
626 2964376584
627 2965761224
628 2969136888
629 2969141054
630 2969766298
631 2969770382
632 2971893418
633 2979089182
634 2980129488
635 2980185283
636 2980492632
637 2981289565
638 2981294510
639 2981985221
640 2981990156
641 2996711051
642 3001272010
643 3001894130
644 3006828681
645 3006976360
646 3006978451
647 3006988395
648 3006993314
649 648167948
650 8002323450
651 8022621125
652 8022631734
653 8022655713
654 8022796038
655 8022896328
656 8022917956
657 8023440738
658 8023447659
659 8046992111
660 8051956560
661 8052175037
662 8054801415
663 8055634119
664 8055635345
665 8057582693
666 8057632168
667 8057735761
668 8057979750

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02223

Thymidylate_kin

Thymidylate kinase

25

216

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjn-assembly1.cif.gz_A crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9704 4 204
3hjn-assembly1.cif.gz_B crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima 0.9665 4 201
4edh-assembly1.cif.gz_B the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with adp,tmp and mg. 0.9621 1 207
4gmd-assembly2.cif.gz_B the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate 0.9605 3 207
3uwo-assembly3.cif.gz_A structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation 0.9593 3 207
ID Description Score Start End Superfamily
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9507 5 201 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9493 3 208 3.40.50.300
3uwoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9419 3 208 3.40.50.300
2z0hB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9402 5 201 3.40.50.300
5x7jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.94 3 208 3.40.50.300
ID Description Score Start End GO Terms
AF-C2UPE2-F1-model_v4 deleted 0.9991 35 208
AF-S7SNE7-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9978 1 207 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A3Q9RJS2-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9972 2 207 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-Q65PJ3-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9968 1 207 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235
AF-A0A544SLT4-F1-model_v4 Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) 0.9964 2 207 GO:0004798
GO:0005524
GO:0005829
GO:0006227
GO:0006233
GO:0006235

Map