F411812
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 334 | 237 | 668 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300025291|Ga0209675_1003714|Ga0209675_10037148 |
| Length | 233 |
| Sequence | MQSEQIHLSHQQQKGHPYPGRFITLEGGEGSGKTSAIQYIERYYQEQGLPVMLTREPGGIEISEKIRTLILDPAHTAMDGRTEALLYAAARRQHLVEKVIPALQQGMIVICDRFIDSSLAYQGHARGLGMDEVWSINQFAIGEVMPDVTLYLDIEPEVGLARIQANAQREVNRLDLEQLSFHLKVREGYNIVAEQFPERIHKVDASLSLPEVAGQILQILAALQEDFPPTVSN |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 2 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 16 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 18 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 19 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 21 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 27 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 31 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 32 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 33 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 34 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 35 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 39 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 49 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 52 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 53 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 54 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 55 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 56 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 57 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 58 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 59 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 60 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 61 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 62 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 63 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 64 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 65 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 66 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 67 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 68 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 69 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 70 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 71 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 72 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 73 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 74 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 75 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 76 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 77 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 78 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 79 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 80 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 81 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 82 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 83 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 84 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 85 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 86 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 87 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 88 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 89 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 90 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 91 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 92 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 93 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 94 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 95 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 96 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 97 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 98 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 99 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 100 | 3300049684 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control | Metagenome | Rhizosphere |
| 101 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 102 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 103 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 104 | 2510917027 | Brevibacillus sp. CF112 | Isolate | Rhizosphere |
| 105 | 2511231119 | Bacillus velezensis CAU B946 | Isolate | Rhizosphere |
| 106 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 107 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 108 | 2540341094 | Bacillus subtilis XF-1 | Isolate | Rhizosphere |
| 109 | 2545555800 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 110 | 2551306519 | Bacillus sp. WBUNB004 | Isolate | Rhizosphere |
| 111 | 2554235283 | Bacillus safensis VK | Isolate | Rhizosphere |
| 112 | 2576861599 | Bacillus amyloliquefaciens EGD-AQ14 | Isolate | Rhizosphere |
| 113 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 114 | 2630968484 | Bacillus methylotrophicus KACC 13105 | Isolate | Rhizosphere |
| 115 | 2643221729 | Bacillus sp. Root11 | Isolate | Unclassified |
| 116 | 2643221730 | Bacillus sp. Root131 | Isolate | Unclassified |
| 117 | 2643221731 | Bacillus sp. Root147 | Isolate | Unclassified |
| 118 | 2643221732 | Bacillus sp. Root239 | Isolate | Unclassified |
| 119 | 2643221735 | Bacillus sp. Root920 | Isolate | Unclassified |
| 120 | 2648501850 | Bacillus amyloliquefaciens RHNK22 | Isolate | Rhizosphere |
| 121 | 2671180694 | Paenibacillus sp. A3 | Isolate | Unclassified |
| 122 | 2671180844 | Bacillus amyloliquefaciens Bs006 | Isolate | Unclassified |
| 123 | 2684622632 | Bacillus cereus 905 | Isolate | Unclassified |
| 124 | 2684623153 | Bacillus pumilus SH-B9 | Isolate | Unclassified |
| 125 | 2687453109 | Bacillus pumilus SH-B11 | Isolate | Unclassified |
| 126 | 2695420354 | Bacillus sp. Co1-6 | Isolate | Unclassified |
| 127 | 2695420987 | Bacillus thuringiensis KNU-07 | Isolate | Unclassified |
| 128 | 2703719227 | Bacillus mycoides GOE6 | Isolate | Rhizosphere |
| 129 | 2716884898 | Bacillus methylotrophicus FKM10 | Isolate | Rhizosphere |
| 130 | 2718218445 | Bacillus sp. B25(2016b) | Isolate | Rhizosphere |
| 131 | 2721755693 | Paenibacillus polymyxa YC0573 | Isolate | Rhizosphere |
| 132 | 2728369359 | Paenibacillus polymyxa YC0136 | Isolate | Rhizosphere |
| 133 | 2738541295 | Bacillus sp. OK085 | Isolate | Unclassified |
| 134 | 2738541299 | Paenisporosarcina sp. OV554 | Isolate | Unclassified |
| 135 | 2738541358 | Bacillus sp. OV752 | Isolate | Unclassified |
| 136 | 2738543006 | Bacillus sp. OK077 | Isolate | Unclassified |
| 137 | 2738543010 | Bacillus sp. YR335 | Isolate | Unclassified |
| 138 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 139 | 2744054657 | Brevibacillus sp. SKDU10 | Isolate | Unclassified |
| 140 | 2751185905 | Paenibacillus kribbensis 6hRe76 | Isolate | Unclassified |
| 141 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 142 | 2802428803 | Paenibacillus peoriae NMA1017 | Isolate | Rhizosphere |
| 143 | 2808606399 | Bacillus sp. SJZ110 | Isolate | Rhizosphere |
| 144 | 2811994870 | Bacillus sp. JB4 | Isolate | Unclassified |
| 145 | 2816332336 | Brevibacillus laterosporus ZQ2 | Isolate | Unclassified |
| 146 | 2818991441 | Niallia circulans 3243 | Isolate | Rhizosphere |
| 147 | 2818991443 | Bacillus thuringiensis 1230 | Isolate | Unclassified |
| 148 | 2818991465 | Priestia megaterium 3291 | Isolate | Rhizosphere |
| 149 | 2818991468 | Bacillus safensis 3300 | Isolate | Rhizosphere |
| 150 | 2823526263 | Bacillus altitudinis P-10 | Isolate | Unclassified |
| 151 | 2842882022 | Bacillus sp. R-71893 | Isolate | Unclassified |
| 152 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 153 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 154 | 2857604169 | Domibacillus sp. R-71921 | Isolate | Unclassified |
| 155 | 2857609550 | Domibacillus sp. R-71929 | Isolate | Unclassified |
| 156 | 2858438669 | Leuconostoc mesenteroides YL48 | Isolate | Unclassified |
| 157 | 2860837431 | Bacillus sp. WR11 | Isolate | Unclassified |
| 158 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 159 | 2865002811 | Paenibacillus sp. R-74131 | Isolate | Unclassified |
| 160 | 2877768649 | Bacillus amyloliquefaciens Y14 | Isolate | Rhizosphere |
| 161 | 2880169592 | Bacillus velezensis T20E-257 | Isolate | Unclassified |
| 162 | 2889042446 | Paenibacillus sp. 37 | Isolate | Rhizosphere |
| 163 | 2889276214 | Paenibacillus sp. PvR133 | Isolate | Rhizosphere |
| 164 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 165 | 2897109615 | Bacillus amyloliquefaciens YP6 | Isolate | Unclassified |
| 166 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 167 | 2904490793 | Paenibacillus sp. 1295 | Isolate | Rhizosphere |
| 168 | 2904524088 | Priestia megaterium 1428 | Isolate | Rhizosphere |
| 169 | 2904560550 | Bacillus velezensis 1780 | Isolate | Rhizosphere |
| 170 | 2904595352 | Paenibacillus sp. 1182 | Isolate | Unclassified |
| 171 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 172 | 2908665501 | Bacillus pumilus 1391 | Isolate | Rhizosphere |
| 173 | 2915606848 | Brevibacillus sp. HD1.4A | Isolate | Rhizosphere |
| 174 | 2916971899 | Alkalihalobacillus miscanthi AK13 | Isolate | Rhizosphere |
| 175 | 2919093281 | Bacillus safensis 1383 | Isolate | Rhizosphere |
| 176 | 2919143609 | Priestia megaterium 1751 | Isolate | Rhizosphere |
| 177 | 2919160200 | Paenibacillus sp. 2003 | Isolate | Unclassified |
| 178 | 2919517244 | Priestia aryabhattai 3820 | Isolate | Unclassified |
| 179 | 2919720352 | Priestia megaterium 4340 | Isolate | Unclassified |
| 180 | 2919726948 | Bacillus pumilus 4489 | Isolate | Unclassified |
| 181 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 182 | 2928093941 | Priestia aryabhattai 1389 | Isolate | Rhizosphere |
| 183 | 2928519762 | Leuconostoc citreum 1377 | Isolate | Rhizosphere |
| 184 | 2929004312 | Priestia megaterium 1104 | Isolate | Unclassified |
| 185 | 2929233124 | Bacillus sp. R-74298 Hybrid assembly | Isolate | Unclassified |
| 186 | 2931384279 | Paenibacillus sp. DR312 | Isolate | Rhizosphere |
| 187 | 2936361878 | Neobacillus endophyticus BRMEA1 | Isolate | Unclassified |
| 188 | 2938917290 | Bacillus sp. CR71 | Isolate | Unclassified |
| 189 | 2939702853 | Paenibacillus sp. PvR008 | Isolate | Rhizosphere |
| 190 | 2946053406 | Paenibacillus sp. W4I10 | Isolate | Rhizosphere |
| 191 | 2947426588 | Bacillus sp. RZ2MS9 | Isolate | Rhizosphere |
| 192 | 2954773129 | Bacillus sp. TBS-096 | Isolate | Rhizosphere |
| 193 | 2956897341 | Ectobacillus funiculus W18-2 | Isolate | Rhizosphere |
| 194 | 2960319331 | Priestia megaterium AFS057444 | Isolate | Unclassified |
| 195 | 2960375949 | Priestia megaterium AFS067084 | Isolate | Unclassified |
| 196 | 2962290636 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 197 | 2964375228 | Anaerobacillus alkaliphilus B16-10 | Isolate | Rhizosphere |
| 198 | 2965761152 | Bacillus sp. COPE52 | Isolate | Unclassified |
| 199 | 2969136845 | Bacillus subtilis TLO3 | Isolate | Rhizosphere |
| 200 | 2969141011 | Bacillus velezensis MH25 | Isolate | Unclassified |
| 201 | 2969765954 | Bacillus intestinalis GM2 | Isolate | Rhizosphere |
| 202 | 2969770375 | Bacillus subtilis GM5 | Isolate | Rhizosphere |
| 203 | 2971893375 | Bacillus sp. HNA3 | Isolate | Rhizosphere |
| 204 | 2979083700 | Bacillus toyonensis SORGH_AS 407 | Isolate | Unclassified |
| 205 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 206 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 207 | 2980492589 | Bacillus subtilis GQJK2 | Isolate | Rhizosphere |
| 208 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 209 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 210 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 211 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 212 | 2996706504 | Paenibacillus sp. OT2-17 | Isolate | Rhizosphere |
| 213 | 3001267043 | Bacillus sp. FJAT-49870 | Isolate | Rhizosphere |
| 214 | 3001892409 | Neobacillus rhizophilus FJAT-49825 | Isolate | Rhizosphere |
| 215 | 3006826541 | Bacillus haikouensis CrR16 | Isolate | Unclassified |
| 216 | 3006973921 | Bacillus sp. FJAT-49736 | Isolate | Rhizosphere |
| 217 | 3006984091 | Lederbergia citrea FJAT-49754 | Isolate | Rhizosphere |
| 218 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 219 | 648028048 | Paenibacillus polymyxa E681 | Isolate | Rhizosphere |
| 220 | 8002317523 | Cohnella sp. GbtcB17 | Isolate | Unclassified |
| 221 | 8022621104 | Bacillus sp. PIC28 | Isolate | Rhizosphere |
| 222 | 8022630665 | Bacillus sp. PW192 | Isolate | Rhizosphere |
| 223 | 8022653035 | Bacillus sp. Rc4 | Isolate | Unclassified |
| 224 | 8022792930 | Bacillus sp. Xin | Isolate | Rhizosphere |
| 225 | 8022893055 | Bacillus aryabhattai AFS007213 | Isolate | Unclassified |
| 226 | 8022914991 | Bacillus aryabhattai SQU-R12 | Isolate | Unclassified |
| 227 | 8023438354 | Bacillus sp. BH2 | Isolate | Unclassified |
| 228 | 8023444577 | Bacillus sp. BH32 | Isolate | Unclassified |
| 229 | 8046991243 | Cohnella rhizosphaerae DSM 28161 | Isolate | Rhizosphere |
| 230 | 8051952484 | Bacillus amyloliquefaciens K2 | Isolate | Rhizosphere |
| 231 | 8052174270 | Bacillus velezensis CH13 | Isolate | Rhizosphere |
| 232 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 233 | 8055632911 | Paenibacillus radicibacter N1-5-1-14 | Isolate | Unclassified |
| 234 | 8057582654 | Bacillus arachidis YX15 | Isolate | Rhizosphere |
| 235 | 8057632132 | Cytobacillus kochii RZ2 | Isolate | Rhizosphere |
| 236 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
| 237 | 8057977335 | Paenibacillus oenotherae DT7-4 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 57.19 |
| Metatranscriptomes | 1.8 |
| Isolates | 41.02 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.87 |
| Nodule | 1.5 |
| Rhizoplane | 4.49 |
| Rhizosphere | 46.71 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.6 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0209675_1003714 | 3300025291 | Bacteria | 7100 |
| 2 | JGI25159J45721_1009884 | 3300002987 | Bacteria | 2481 |
| 3 | JGI25151J46595_10000294 | 3300003187 | Bacteria | 55267 |
| 4 | JGI25151J46595_10011275 | 3300003187 | Bacteria | 4116 |
| 5 | JGI25151J46595_10013680 | 3300003187 | Bacteria | 3642 |
| 6 | JGI25151J46595_10013816 | 3300003187 | Bacteria | 3621 |
| 7 | JGI25151J46595_10013836 | 3300003187 | Bacteria | 3618 |
| 8 | JGI25151J46595_10019668 | 3300003187 | Bacteria | 2863 |
| 9 | JGI25151J46595_10020378 | 3300003187 | Bacteria | 2797 |
| 10 | JGI25151J46595_10022128 | 3300003187 | Bacteria | 2645 |
| 11 | JGI25151J46595_10031830 | 3300003187 | Bacteria | 2054 |
| 12 | JGI25151J46595_10041471 | 3300003187 | Bacteria | 1672 |
| 13 | JGI25151J46595_10058968 | 3300003187 | Bacteria | 1238 |
| 14 | rootH2_10071156 | 3300003320 | Bacteria | 3335 |
| 15 | rootL2_10026919 | 3300003322 | Bacteria | 23390 |
| 16 | rootH1_10260965 | 3300003323 | Bacteria | 2765 |
| 17 | Ga0006562J51391_1000026 | 3300003578 | Bacteria | 55240 |
| 18 | Ga0006562J51391_1001096 | 3300003578 | Bacteria | 7601 |
| 19 | Ga0006562J51391_1008740 | 3300003578 | Bacteria | 2673 |
| 20 | Ga0006562J51391_1036913 | 3300003578 | Bacteria | 1353 |
| 21 | Ga0055532_1005065 | 3300003758 | Bacteria | 1895 |
| 22 | Ga0055535_1003128 | 3300003761 | Bacteria | 4967 |
| 23 | Ga0055541_1003743 | 3300003841 | Bacteria | 2823 |
| 24 | Ga0070670_100109552 | 3300005331 | Bacteria | 2379 |
| 25 | Ga0070670_100381943 | 3300005331 | Bacteria | 1241 |
| 26 | Ga0070669_100675832 | 3300005353 | Bacteria | 870 |
| 27 | Ga0070675_100132244 | 3300005354 | Bacteria | 2127 |
| 28 | Ga0070671_100053951 | 3300005355 | Bacteria | 3341 |
| 29 | Ga0068864_100113709 | 3300005618 | Bacteria | 2413 |
| 30 | Ga0070715_10307592 | 3300006163 | Bacteria | 850 |
| 31 | Ga0079104_1003286 | 3300006946 | Bacteria | 7701 |
| 32 | Ga0079104_1003940 | 3300006946 | Bacteria | 6620 |
| 33 | Ga0105251_10004718 | 3300009011 | Bacteria | 9147 |
| 34 | Ga0105251_10031999 | 3300009011 | Bacteria | 2626 |
| 35 | Ga0105251_10054073 | 3300009011 | Bacteria | 1908 |
| 36 | Ga0105244_10007338 | 3300009036 | Bacteria | 7012 |
| 37 | Ga0105244_10020094 | 3300009036 | Bacteria | 3714 |
| 38 | Ga0105244_10041436 | 3300009036 | Bacteria | 2386 |
| 39 | Ga0105244_10169467 | 3300009036 | Bacteria | 1039 |
| 40 | Ga0105250_10011000 | 3300009092 | Bacteria | 3761 |
| 41 | Ga0105250_10012558 | 3300009092 | Bacteria | 3492 |
| 42 | Ga0105250_10020650 | 3300009092 | Bacteria | 2661 |
| 43 | Ga0105250_10020912 | 3300009092 | Bacteria | 2642 |
| 44 | Ga0105250_10076389 | 3300009092 | Bacteria | 1355 |
| 45 | Ga0105245_10007570 | 3300009098 | Bacteria | 9513 |
| 46 | Ga0105247_10003349 | 3300009101 | Bacteria | 10487 |
| 47 | Ga0105243_10011289 | 3300009148 | Bacteria | 6758 |
| 48 | Ga0105242_10003548 | 3300009176 | Bacteria | 12126 |
| 49 | Ga0105249_10123260 | 3300009553 | Bacteria | 2465 |
| 50 | Ga0105249_10921835 | 3300009553 | Bacteria | 941 |
| 51 | Ga0105246_10010346 | 3300011119 | Bacteria | 5769 |
| 52 | Ga0105246_10027499 | 3300011119 | Bacteria | 3727 |
| 53 | Ga0105246_10134956 | 3300011119 | Bacteria | 1848 |
| 54 | Ga0157371_10006708 | 3300013102 | Bacteria | 9415 |
| 55 | Ga0157378_10009806 | 3300013297 | Bacteria | 8348 |
| 56 | Ga0157377_10000539 | 3300014745 | Bacteria | 15995 |
| 57 | Ga0209566_100116 | 3300025225 | Bacteria | 107510 |
| 58 | Ga0209147_100136 | 3300025229 | Bacteria | 117683 |
| 59 | Ga0209147_100717 | 3300025229 | Bacteria | 16793 |
| 60 | Ga0209147_102199 | 3300025229 | Bacteria | 5270 |
| 61 | Ga0209258_104308 | 3300025242 | Bacteria | 2737 |
| 62 | Ga0209673_1003365 | 3300025273 | Bacteria | 9518 |
| 63 | Ga0209130_1003110 | 3300025284 | Bacteria | 7398 |
| 64 | Ga0209130_1006821 | 3300025284 | Bacteria | 3638 |
| 65 | Ga0209130_1006826 | 3300025284 | Bacteria | 3635 |
| 66 | Ga0209676_1006831 | 3300025292 | Bacteria | 5532 |
| 67 | Ga0209025_1000734 | 3300025294 | Bacteria | 55490 |
| 68 | Ga0209025_1000834 | 3300025294 | Bacteria | 48958 |
| 69 | Ga0209025_1002991 | 3300025294 | Bacteria | 16752 |
| 70 | Ga0209025_1003686 | 3300025294 | Bacteria | 14128 |
| 71 | Ga0209025_1007082 | 3300025294 | Bacteria | 8482 |
| 72 | Ga0209025_1012773 | 3300025294 | Bacteria | 5345 |
| 73 | Ga0209025_1017460 | 3300025294 | Bacteria | 4138 |
| 74 | Ga0209025_1018803 | 3300025294 | Bacteria | 3888 |
| 75 | Ga0209025_1018871 | 3300025294 | Bacteria | 3878 |
| 76 | Ga0209025_1019004 | 3300025294 | Bacteria | 3847 |
| 77 | Ga0209025_1019292 | 3300025294 | Bacteria | 3797 |
| 78 | Ga0209025_1020036 | 3300025294 | Bacteria | 3681 |
| 79 | Ga0209025_1022850 | 3300025294 | Bacteria | 3297 |
| 80 | Ga0209025_1029183 | 3300025294 | Bacteria | 2678 |
| 81 | Ga0209025_1034370 | 3300025294 | Bacteria | 2316 |
| 82 | Ga0209025_1061511 | 3300025294 | Bacteria | 1401 |
| 83 | Ga0207426_1038672 | 3300025302 | Bacteria | 1501 |
| 84 | Ga0207696_1002558 | 3300025711 | Bacteria | 8852 |
| 85 | Ga0207696_1003549 | 3300025711 | Bacteria | 7048 |
| 86 | Ga0207696_1003612 | 3300025711 | Bacteria | 6979 |
| 87 | Ga0207696_1009085 | 3300025711 | Bacteria | 3727 |
| 88 | Ga0207696_1010815 | 3300025711 | Bacteria | 3326 |
| 89 | Ga0207696_1019818 | 3300025711 | Bacteria | 2180 |
| 90 | Ga0207655_1008584 | 3300025728 | Bacteria | 6464 |
| 91 | Ga0207655_1027286 | 3300025728 | Bacteria | 2723 |
| 92 | Ga0207655_1107636 | 3300025728 | Bacteria | 948 |
| 93 | Ga0207713_1000839 | 3300025735 | Bacteria | 28258 |
| 94 | Ga0207713_1000866 | 3300025735 | Bacteria | 27707 |
| 95 | Ga0207713_1008017 | 3300025735 | Bacteria | 6140 |
| 96 | Ga0207713_1023461 | 3300025735 | Bacteria | 2903 |
| 97 | Ga0207713_1024376 | 3300025735 | Bacteria | 2823 |
| 98 | Ga0207710_10008339 | 3300025900 | Bacteria | 4371 |
| 99 | Ga0207645_10181770 | 3300025907 | Bacteria | 1380 |
| 100 | Ga0207681_10528994 | 3300025923 | Bacteria | 968 |
| 101 | Ga0207687_10016293 | 3300025927 | Bacteria | 4880 |
| 102 | Ga0207686_10013732 | 3300025934 | Bacteria | 4490 |
| 103 | Ga0207709_10010485 | 3300025935 | Bacteria | 5103 |
| 104 | Ga0207709_10790486 | 3300025935 | Bacteria | 765 |
| 105 | Ga0207712_10355966 | 3300025961 | Bacteria | 1218 |
| 106 | Ga0207712_10500144 | 3300025961 | Bacteria | 1039 |
| 107 | Ga0209281_1000059 | 3300027111 | Bacteria | 295913 |
| 108 | Ga0209281_1000435 | 3300027111 | Bacteria | 61761 |
| 109 | Ga0209371_1006371 | 3300027312 | Bacteria | 4382 |
| 110 | Ga0209970_1012712 | 3300027614 | Bacteria | 1392 |
| 111 | Ga0237817_10033 | 3300030083 | Bacteria | 48418 |
| 112 | Ga0237817_10401 | 3300030083 | Bacteria | 7235 |
| 113 | Ga0268256_1006402 | 3300030500 | Bacteria | 4385 |
| 114 | Ga0307408_100089262 | 3300031548 | Bacteria | 2323 |
| 115 | Ga0307408_100244914 | 3300031548 | Bacteria | 1475 |
| 116 | Ga0307406_10387992 | 3300031901 | Bacteria | 1103 |
| 117 | Ga0307416_100298016 | 3300032002 | Bacteria | 1601 |
| 118 | Ga0307416_101162205 | 3300032002 | Bacteria | 877 |
| 119 | Ga0237819_02464 | 3300038705 | Bacteria | 3711 |
| 120 | Ga0237819_02535 | 3300038705 | Bacteria | 3631 |
| 121 | Ga0439439_0001476 | 3300041406 | Bacteria | 4702 |
| 122 | Ga0451855_1508422 | 3300041511 | Bacteria | 5557 |
| 123 | Ga0439449_0000662 | 3300042007 | Bacteria | 13021 |
| 124 | Ga0439457_032506 | 3300042014 | Bacteria | 1158 |
| 125 | Ga0439462_0009533 | 3300042015 | Bacteria | 2455 |
| 126 | Ga0466967_0050141 | 3300045976 | Bacteria | 3654 |
| 127 | Ga0466967_0585166 | 3300045976 | Bacteria | 1101 |
| 128 | Ga0495603_0008253 | 3300046455 | Bacteria | 6294 |
| 129 | Ga0495585_0084256 | 3300046492 | Bacteria | 1719 |
| 130 | Ga0495606_0000038 | 3300046507 | Bacteria | 226810 |
| 131 | Ga0495606_0148683 | 3300046507 | Bacteria | 1377 |
| 132 | Ga0495620_0078634 | 3300046515 | Bacteria | 1337 |
| 133 | Ga0495654_0007934 | 3300046530 | Bacteria | 5898 |
| 134 | Ga0495649_0003900 | 3300046694 | Bacteria | 9869 |
| 135 | Ga0495672_0025251 | 3300047320 | Bacteria | 3807 |
| 136 | Ga0495626_0018131 | 3300048091 | Bacteria | 3542 |
| 137 | Ga0496100_0001157 | 3300048903 | Bacteria | 12834 |
| 138 | Ga0496102_0138062 | 3300048905 | Bacteria | 2284 |
| 139 | Ga0496103_0006698 | 3300048906 | Bacteria | 6876 |
| 140 | Ga0496104_0011022 | 3300048907 | Bacteria | 8087 |
| 141 | Ga0496105_0001202 | 3300048908 | Bacteria | 18028 |
| 142 | Ga0496106_0002287 | 3300048909 | Bacteria | 14290 |
| 143 | Ga0496107_0008398 | 3300048910 | Bacteria | 7146 |
| 144 | Ga0496107_0303327 | 3300048910 | Unclassified | 1189 |
| 145 | Ga0496108_0014252 | 3300048911 | Bacteria | 6487 |
| 146 | Ga0496109_0014402 | 3300048912 | Bacteria | 6881 |
| 147 | Ga0496110_0012954 | 3300048913 | Bacteria | 6876 |
| 148 | Ga0496111_0296134 | 3300048914 | Bacteria | 1199 |
| 149 | Ga0496112_0001079 | 3300048915 | Bacteria | 20179 |
| 150 | Ga0496113_0039749 | 3300048916 | Bacteria | 3464 |
| 151 | Ga0496113_0058236 | 3300048916 | Bacteria | 2906 |
| 152 | Ga0496116_0003491 | 3300048919 | Bacteria | 15469 |
| 153 | Ga0496116_0009357 | 3300048919 | Bacteria | 8365 |
| 154 | Ga0496116_0016836 | 3300048919 | Bacteria | 5703 |
| 155 | Ga0496116_0054010 | 3300048919 | Unclassified | 2650 |
| 156 | Ga0496116_0075661 | 3300048919 | Bacteria | 2112 |
| 157 | Ga0496116_0180702 | 3300048919 | Bacteria | 1130 |
| 158 | Ga0496116_0263800 | 3300048919 | Bacteria | 847 |
| 159 | Ga0496117_0012274 | 3300048920 | Bacteria | 7573 |
| 160 | Ga0496118_0104787 | 3300048921 | Bacteria | 1897 |
| 161 | Ga0496118_0142234 | 3300048921 | Bacteria | 1518 |
| 162 | Ga0496119_0000682 | 3300048922 | Bacteria | 45362 |
| 163 | Ga0496119_0075345 | 3300048922 | Bacteria | 1961 |
| 164 | Ga0496119_0097769 | 3300048922 | Bacteria | 1654 |
| 165 | Ga0496120_0000678 | 3300048923 | Bacteria | 49988 |
| 166 | Ga0496120_0018545 | 3300048923 | Bacteria | 4479 |
| 167 | Ga0496120_0204881 | 3300048923 | Bacteria | 952 |
| 168 | Ga0496121_0050761 | 3300048924 | Bacteria | 3500 |
| 169 | Ga0496121_0345216 | 3300048924 | Bacteria | 993 |
| 170 | Ga0496122_0008861 | 3300048925 | Bacteria | 10734 |
| 171 | Ga0496122_0012050 | 3300048925 | Bacteria | 8669 |
| 172 | Ga0496122_0036643 | 3300048925 | Bacteria | 3961 |
| 173 | Ga0496122_0367946 | 3300048925 | Bacteria | 743 |
| 174 | Ga0496123_0002354 | 3300048926 | Bacteria | 23709 |
| 175 | Ga0496123_0026698 | 3300048926 | Bacteria | 4319 |
| 176 | Ga0496124_0000542 | 3300048927 | Bacteria | 64211 |
| 177 | Ga0496124_0010181 | 3300048927 | Bacteria | 9562 |
| 178 | Ga0496124_0202089 | 3300048927 | Bacteria | 1510 |
| 179 | Ga0496124_0527747 | 3300048927 | Bacteria | 785 |
| 180 | Ga0496125_0005940 | 3300048928 | Bacteria | 13373 |
| 181 | Ga0496125_0007220 | 3300048928 | Bacteria | 11841 |
| 182 | Ga0496125_0008810 | 3300048928 | Bacteria | 10492 |
| 183 | Ga0496126_0002188 | 3300048929 | Bacteria | 27167 |
| 184 | Ga0496126_0002905 | 3300048929 | Bacteria | 22320 |
| 185 | Ga0496126_0005347 | 3300048929 | Bacteria | 14684 |
| 186 | Ga0496126_0012044 | 3300048929 | Bacteria | 8887 |
| 187 | Ga0496126_0012170 | 3300048929 | Bacteria | 8831 |
| 188 | Ga0501312_000312 | 3300049528 | Bacteria | 3639 |
| 189 | Ga0501317_015673 | 3300049533 | Bacteria | 974 |
| 190 | Ga0501217_003373 | 3300049661 | Bacteria | 3227 |
| 191 | Ga0501217_122430 | 3300049661 | Bacteria | 756 |
| 192 | Ga0501233_052100 | 3300049668 | Bacteria | 994 |
| 193 | Ga0501251_032940 | 3300049681 | Bacteria | 749 |
| 194 | Ga0501255_027649 | 3300049684 | Bacteria | 773 |
| 195 | Ga0501225_0104311 | 3300049705 | Bacteria | 831 |
| 196 | Ga0501234_010942 | 3300049707 | Bacteria | 1416 |
| 197 | Ga0501270_007893 | 3300049767 | Bacteria | 1331 |
| 198 | 2511176001 | 2510917027 | Bacteria | 5287437 |
| 199 | 2511697895 | 2511231119 | Bacteria | 4019861 |
| 200 | 2512736628 | 2512564039 | Bacteria | 8739048 |
| 201 | 2524191714 | 2524023129 | Bacteria | 6762600 |
| 202 | 2540605119 | 2540341094 | Bacteria | 4061186 |
| 203 | 2545559852 | 2545555800 | Bacteria | 4222588 |
| 204 | 2553395947 | 2551306519 | Bacteria | 5465154 |
| 205 | 2555470930 | 2554235283 | Bacteria | 3683090 |
| 206 | 2578930809 | 2576861599 | Bacteria | 4217202 |
| 207 | 2595320773 | 2593339198 | Bacteria | 7267884 |
| 208 | 2631985990 | 2630968484 | Bacteria | 3876276 |
| 209 | 2644705889 | 2643221729 | Bacteria | 6621700 |
| 210 | 2644713339 | 2643221730 | Bacteria | 6523787 |
| 211 | 2644718574 | 2643221731 | Bacteria | 5623886 |
| 212 | 2644723505 | 2643221732 | Bacteria | 5756404 |
| 213 | 2644741751 | 2643221735 | Bacteria | 3676263 |
| 214 | 2651529648 | 2648501850 | Bacteria | 3975476 |
| 215 | 2673818965 | 2671180694 | Bacteria | 7506943 |
| 216 | 2674421165 | 2671180844 | Bacteria | 4164150 |
| 217 | 2685153473 | 2684622632 | Bacteria | 5380049 |
| 218 | 2686995217 | 2684623153 | Bacteria | 3878815 |
| 219 | 2687496466 | 2687453109 | Bacteria | 3860091 |
| 220 | 2695629810 | 2695420354 | Bacteria | 3922431 |
| 221 | 2698319717 | 2695420987 | Bacteria | 6152737 |
| 222 | 2705991922 | 2703719227 | Bacteria | 5631989 |
| 223 | 2717914504 | 2716884898 | Bacteria | 3928789 |
| 224 | 2721503347 | 2718218445 | Bacteria | 5113413 |
| 225 | 2723601364 | 2721755693 | Bacteria | 6126117 |
| 226 | 2730137487 | 2728369359 | Bacteria | 5621728 |
| 227 | 2738817592 | 2738541295 | Bacteria | 5730091 |
| 228 | 2738840610 | 2738541299 | Bacteria | 4020721 |
| 229 | 2739160231 | 2738541358 | Bacteria | 5932299 |
| 230 | 2739212750 | 2738543006 | Bacteria | 5904091 |
| 231 | 2739234678 | 2738543010 | Bacteria | 5583595 |
| 232 | 2739271827 | 2738543017 | Bacteria | 4271950 |
| 233 | 2745169596 | 2744054657 | Bacteria | 5016802 |
| 234 | 2753812974 | 2751185905 | Bacteria | 6142767 |
| 235 | 2793186384 | 2791355222 | Bacteria | 5898266 |
| 236 | 2802440577 | 2802428803 | Bacteria | 5806948 |
| 237 | 2809057161 | 2808606399 | Bacteria | 4021018 |
| 238 | 2812314354 | 2811994870 | Bacteria | 3776934 |
| 239 | 2817616324 | 2816332336 | Bacteria | 5207640 |
| 240 | 2819571324 | 2818991441 | Bacteria | 5062707 |
| 241 | 2819585124 | 2818991443 | Bacteria | 6598732 |
| 242 | 2819712042 | 2818991465 | Bacteria | 5388835 |
| 243 | 2819726111 | 2818991468 | Bacteria | 3723169 |
| 244 | 2823526305 | 2823526263 | Bacteria | 3765752 |
| 245 | 2842888023 | 2842882022 | Bacteria | 6158489 |
| 246 | 2857477613 | 2857472729 | Bacteria | 6568124 |
| 247 | 2857591237 | 2857586860 | Bacteria | 4354574 |
| 248 | 2857609066 | 2857604169 | Bacteria | 5111450 |
| 249 | 2857613510 | 2857609550 | Bacteria | 3753890 |
| 250 | 2858439387 | 2858438669 | Bacteria | 2058402 |
| 251 | 2860837471 | 2860837431 | Bacteria | 4202080 |
| 252 | 2865002649 | 2864997549 | Bacteria | 5139696 |
| 253 | 2865008724 | 2865002811 | Bacteria | 6333767 |
| 254 | 2877768690 | 2877768649 | Bacteria | 3957164 |
| 255 | 2880169633 | 2880169592 | Bacteria | 3900066 |
| 256 | 2889042465 | 2889042446 | Bacteria | 7618936 |
| 257 | 2889277457 | 2889276214 | Bacteria | 5979355 |
| 258 | 2889299053 | 2889295896 | Bacteria | 4704906 |
| 259 | 2897109657 | 2897109615 | Bacteria | 4009619 |
| 260 | 2904119535 | 2904113452 | Bacteria | 7796941 |
| 261 | 2904496846 | 2904490793 | Bacteria | 7046938 |
| 262 | 2904530272 | 2904524088 | Bacteria | 5887454 |
| 263 | 2904564547 | 2904560550 | Bacteria | 4029838 |
| 264 | 2904597386 | 2904595352 | Bacteria | 6124848 |
| 265 | 2904601003 | 2904595352 | Bacteria | 6124848 |
| 266 | 2907205071 | 2907202186 | Bacteria | 6632024 |
| 267 | 2908669293 | 2908665501 | Bacteria | 3678115 |
| 268 | 2915609137 | 2915606848 | Bacteria | 6032732 |
| 269 | 2916971947 | 2916971899 | Bacteria | 4250608 |
| 270 | 2919097052 | 2919093281 | Bacteria | 3660974 |
| 271 | 2919149593 | 2919143609 | Bacteria | 6219228 |
| 272 | 2919166199 | 2919160200 | Bacteria | 6929020 |
| 273 | 2919523117 | 2919517244 | Bacteria | 5858162 |
| 274 | 2919726313 | 2919720352 | Bacteria | 5986006 |
| 275 | 2919730723 | 2919726948 | Bacteria | 3696050 |
| 276 | 2925332279 | 2925326138 | Bacteria | 9652120 |
| 277 | 2928099775 | 2928093941 | Bacteria | 5965005 |
| 278 | 2928521370 | 2928519762 | Bacteria | 1953908 |
| 279 | 2929010056 | 2929004312 | Bacteria | 5678476 |
| 280 | 2929233161 | 2929233124 | Bacteria | 5948380 |
| 281 | 2931385890 | 2931384279 | Bacteria | 7299545 |
| 282 | 2936363589 | 2936361878 | Bacteria | 5632809 |
| 283 | 2938917339 | 2938917290 | Bacteria | 5914775 |
| 284 | 2939706820 | 2939702853 | Bacteria | 5139229 |
| 285 | 2946058215 | 2946053406 | Bacteria | 6978655 |
| 286 | 2947426627 | 2947426588 | Bacteria | 5357194 |
| 287 | 2954776188 | 2954773129 | Bacteria | 3741715 |
| 288 | 2956901162 | 2956897341 | Bacteria | 5447711 |
| 289 | 2960323614 | 2960319331 | Bacteria | 5502575 |
| 290 | 2960379229 | 2960375949 | Bacteria | 5361395 |
| 291 | 2962290681 | 2962290636 | Bacteria | 4072939 |
| 292 | 2964376584 | 2964375228 | Bacteria | 4909004 |
| 293 | 2965761224 | 2965761152 | Bacteria | 5806513 |
| 294 | 2969136888 | 2969136845 | Bacteria | 3923176 |
| 295 | 2969141054 | 2969141011 | Bacteria | 4118468 |
| 296 | 2969766298 | 2969765954 | Bacteria | 4216713 |
| 297 | 2969770382 | 2969770375 | Bacteria | 4271280 |
| 298 | 2971893418 | 2971893375 | Bacteria | 3929648 |
| 299 | 2979089182 | 2979083700 | Bacteria | 5894929 |
| 300 | 2980129488 | 2980125574 | Bacteria | 5567337 |
| 301 | 2980185283 | 2980182181 | Bacteria | 9454109 |
| 302 | 2980492632 | 2980492589 | Bacteria | 4072961 |
| 303 | 2981289565 | 2981284811 | Bacteria | 4641497 |
| 304 | 2981294510 | 2981289755 | Bacteria | 4641509 |
| 305 | 2981985221 | 2981980479 | Bacteria | 4641628 |
| 306 | 2981990156 | 2981985349 | Bacteria | 4641497 |
| 307 | 2996711051 | 2996706504 | Bacteria | 5757485 |
| 308 | 3001272010 | 3001267043 | Bacteria | 4823521 |
| 309 | 3001894130 | 3001892409 | Bacteria | 6328293 |
| 310 | 3006828681 | 3006826541 | Bacteria | 4678913 |
| 311 | 3006976360 | 3006973921 | Bacteria | 4423788 |
| 312 | 3006978451 | 3006973921 | Bacteria | 4423788 |
| 313 | 3006988395 | 3006984091 | Bacteria | 4207523 |
| 314 | 3006993314 | 3006988479 | Bacteria | 4767936 |
| 315 | 648167948 | 648028048 | Bacteria | 5394884 |
| 316 | 8002323450 | 8002317523 | Bacteria | 8051857 |
| 317 | 8022621125 | 8022621104 | Bacteria | 5241040 |
| 318 | 8022631734 | 8022630665 | Bacteria | 3886130 |
| 319 | 8022655713 | 8022653035 | Bacteria | 4035078 |
| 320 | 8022796038 | 8022792930 | Bacteria | 5693794 |
| 321 | 8022896328 | 8022893055 | Bacteria | 5300455 |
| 322 | 8022917956 | 8022914991 | Bacteria | 5584517 |
| 323 | 8023440738 | 8023438354 | Bacteria | 5779374 |
| 324 | 8023447659 | 8023444577 | Bacteria | 5661597 |
| 325 | 8046992111 | 8046991243 | Bacteria | 8497463 |
| 326 | 8051956560 | 8051952484 | Bacteria | 3926774 |
| 327 | 8052175037 | 8052174270 | Bacteria | 3881265 |
| 328 | 8054801415 | 8054795415 | Bacteria | 9785225 |
| 329 | 8055634119 | 8055632911 | Bacteria | 5283357 |
| 330 | 8055635345 | 8055632911 | Bacteria | 5283357 |
| 331 | 8057582693 | 8057582654 | Bacteria | 5218944 |
| 332 | 8057632168 | 8057632132 | Bacteria | 4726859 |
| 333 | 8057735761 | 8057733483 | Bacteria | 6578323 |
| 334 | 8057979750 | 8057977335 | Bacteria | 5694872 |
| 335 | Ga0209675_1003714 | |||
| 336 | JGI25159J45721_1009884 | |||
| 337 | JGI25151J46595_10000294 | |||
| 338 | JGI25151J46595_10011275 | |||
| 339 | JGI25151J46595_10013680 | |||
| 340 | JGI25151J46595_10013816 | |||
| 341 | JGI25151J46595_10013836 | |||
| 342 | JGI25151J46595_10019668 | |||
| 343 | JGI25151J46595_10020378 | |||
| 344 | JGI25151J46595_10022128 | |||
| 345 | JGI25151J46595_10031830 | |||
| 346 | JGI25151J46595_10041471 | |||
| 347 | JGI25151J46595_10058968 | |||
| 348 | rootH2_10071156 | |||
| 349 | rootL2_10026919 | |||
| 350 | rootH1_10260965 | |||
| 351 | Ga0006562J51391_1000026 | |||
| 352 | Ga0006562J51391_1001096 | |||
| 353 | Ga0006562J51391_1008740 | |||
| 354 | Ga0006562J51391_1036913 | |||
| 355 | Ga0055532_1005065 | |||
| 356 | Ga0055535_1003128 | |||
| 357 | Ga0055541_1003743 | |||
| 358 | Ga0070670_100109552 | |||
| 359 | Ga0070670_100381943 | |||
| 360 | Ga0070669_100675832 | |||
| 361 | Ga0070675_100132244 | |||
| 362 | Ga0070671_100053951 | |||
| 363 | Ga0068864_100113709 | |||
| 364 | Ga0070715_10307592 | |||
| 365 | Ga0079104_1003286 | |||
| 366 | Ga0079104_1003940 | |||
| 367 | Ga0105251_10004718 | |||
| 368 | Ga0105251_10031999 | |||
| 369 | Ga0105251_10054073 | |||
| 370 | Ga0105244_10007338 | |||
| 371 | Ga0105244_10020094 | |||
| 372 | Ga0105244_10041436 | |||
| 373 | Ga0105244_10169467 | |||
| 374 | Ga0105250_10011000 | |||
| 375 | Ga0105250_10012558 | |||
| 376 | Ga0105250_10020650 | |||
| 377 | Ga0105250_10020912 | |||
| 378 | Ga0105250_10076389 | |||
| 379 | Ga0105245_10007570 | |||
| 380 | Ga0105247_10003349 | |||
| 381 | Ga0105243_10011289 | |||
| 382 | Ga0105242_10003548 | |||
| 383 | Ga0105249_10123260 | |||
| 384 | Ga0105249_10921835 | |||
| 385 | Ga0105246_10010346 | |||
| 386 | Ga0105246_10027499 | |||
| 387 | Ga0105246_10134956 | |||
| 388 | Ga0157371_10006708 | |||
| 389 | Ga0157378_10009806 | |||
| 390 | Ga0157377_10000539 | |||
| 391 | Ga0209566_100116 | |||
| 392 | Ga0209147_100136 | |||
| 393 | Ga0209147_100717 | |||
| 394 | Ga0209147_102199 | |||
| 395 | Ga0209258_104308 | |||
| 396 | Ga0209673_1003365 | |||
| 397 | Ga0209130_1003110 | |||
| 398 | Ga0209130_1006821 | |||
| 399 | Ga0209130_1006826 | |||
| 400 | Ga0209676_1006831 | |||
| 401 | Ga0209025_1000734 | |||
| 402 | Ga0209025_1000834 | |||
| 403 | Ga0209025_1002991 | |||
| 404 | Ga0209025_1003686 | |||
| 405 | Ga0209025_1007082 | |||
| 406 | Ga0209025_1012773 | |||
| 407 | Ga0209025_1017460 | |||
| 408 | Ga0209025_1018803 | |||
| 409 | Ga0209025_1018871 | |||
| 410 | Ga0209025_1019004 | |||
| 411 | Ga0209025_1019292 | |||
| 412 | Ga0209025_1020036 | |||
| 413 | Ga0209025_1022850 | |||
| 414 | Ga0209025_1029183 | |||
| 415 | Ga0209025_1034370 | |||
| 416 | Ga0209025_1061511 | |||
| 417 | Ga0207426_1038672 | |||
| 418 | Ga0207696_1002558 | |||
| 419 | Ga0207696_1003549 | |||
| 420 | Ga0207696_1003612 | |||
| 421 | Ga0207696_1009085 | |||
| 422 | Ga0207696_1010815 | |||
| 423 | Ga0207696_1019818 | |||
| 424 | Ga0207655_1008584 | |||
| 425 | Ga0207655_1027286 | |||
| 426 | Ga0207655_1107636 | |||
| 427 | Ga0207713_1000839 | |||
| 428 | Ga0207713_1000866 | |||
| 429 | Ga0207713_1008017 | |||
| 430 | Ga0207713_1023461 | |||
| 431 | Ga0207713_1024376 | |||
| 432 | Ga0207710_10008339 | |||
| 433 | Ga0207645_10181770 | |||
| 434 | Ga0207681_10528994 | |||
| 435 | Ga0207687_10016293 | |||
| 436 | Ga0207686_10013732 | |||
| 437 | Ga0207709_10010485 | |||
| 438 | Ga0207709_10790486 | |||
| 439 | Ga0207712_10355966 | |||
| 440 | Ga0207712_10500144 | |||
| 441 | Ga0209281_1000059 | |||
| 442 | Ga0209281_1000435 | |||
| 443 | Ga0209371_1006371 | |||
| 444 | Ga0209970_1012712 | |||
| 445 | Ga0237817_10033 | |||
| 446 | Ga0237817_10401 | |||
| 447 | Ga0268256_1006402 | |||
| 448 | Ga0307408_100089262 | |||
| 449 | Ga0307408_100244914 | |||
| 450 | Ga0307406_10387992 | |||
| 451 | Ga0307416_100298016 | |||
| 452 | Ga0307416_101162205 | |||
| 453 | Ga0237819_02464 | |||
| 454 | Ga0237819_02535 | |||
| 455 | Ga0439439_0001476 | |||
| 456 | Ga0451855_1508422 | |||
| 457 | Ga0439449_0000662 | |||
| 458 | Ga0439457_032506 | |||
| 459 | Ga0439462_0009533 | |||
| 460 | Ga0466967_0050141 | |||
| 461 | Ga0466967_0585166 | |||
| 462 | Ga0495603_0008253 | |||
| 463 | Ga0495585_0084256 | |||
| 464 | Ga0495606_0000038 | |||
| 465 | Ga0495606_0148683 | |||
| 466 | Ga0495620_0078634 | |||
| 467 | Ga0495654_0007934 | |||
| 468 | Ga0495649_0003900 | |||
| 469 | Ga0495672_0025251 | |||
| 470 | Ga0495626_0018131 | |||
| 471 | Ga0496100_0001157 | |||
| 472 | Ga0496102_0138062 | |||
| 473 | Ga0496103_0006698 | |||
| 474 | Ga0496104_0011022 | |||
| 475 | Ga0496105_0001202 | |||
| 476 | Ga0496106_0002287 | |||
| 477 | Ga0496107_0008398 | |||
| 478 | Ga0496107_0303327 | |||
| 479 | Ga0496108_0014252 | |||
| 480 | Ga0496109_0014402 | |||
| 481 | Ga0496110_0012954 | |||
| 482 | Ga0496111_0296134 | |||
| 483 | Ga0496112_0001079 | |||
| 484 | Ga0496113_0039749 | |||
| 485 | Ga0496113_0058236 | |||
| 486 | Ga0496116_0003491 | |||
| 487 | Ga0496116_0009357 | |||
| 488 | Ga0496116_0016836 | |||
| 489 | Ga0496116_0054010 | |||
| 490 | Ga0496116_0075661 | |||
| 491 | Ga0496116_0180702 | |||
| 492 | Ga0496116_0263800 | |||
| 493 | Ga0496117_0012274 | |||
| 494 | Ga0496118_0104787 | |||
| 495 | Ga0496118_0142234 | |||
| 496 | Ga0496119_0000682 | |||
| 497 | Ga0496119_0075345 | |||
| 498 | Ga0496119_0097769 | |||
| 499 | Ga0496120_0000678 | |||
| 500 | Ga0496120_0018545 | |||
| 501 | Ga0496120_0204881 | |||
| 502 | Ga0496121_0050761 | |||
| 503 | Ga0496121_0345216 | |||
| 504 | Ga0496122_0008861 | |||
| 505 | Ga0496122_0012050 | |||
| 506 | Ga0496122_0036643 | |||
| 507 | Ga0496122_0367946 | |||
| 508 | Ga0496123_0002354 | |||
| 509 | Ga0496123_0026698 | |||
| 510 | Ga0496124_0000542 | |||
| 511 | Ga0496124_0010181 | |||
| 512 | Ga0496124_0202089 | |||
| 513 | Ga0496124_0527747 | |||
| 514 | Ga0496125_0005940 | |||
| 515 | Ga0496125_0007220 | |||
| 516 | Ga0496125_0008810 | |||
| 517 | Ga0496126_0002188 | |||
| 518 | Ga0496126_0002905 | |||
| 519 | Ga0496126_0005347 | |||
| 520 | Ga0496126_0012044 | |||
| 521 | Ga0496126_0012170 | |||
| 522 | Ga0501312_000312 | |||
| 523 | Ga0501317_015673 | |||
| 524 | Ga0501217_003373 | |||
| 525 | Ga0501217_122430 | |||
| 526 | Ga0501233_052100 | |||
| 527 | Ga0501251_032940 | |||
| 528 | Ga0501255_027649 | |||
| 529 | Ga0501225_0104311 | |||
| 530 | Ga0501234_010942 | |||
| 531 | Ga0501270_007893 | |||
| 532 | 2511176001 | |||
| 533 | 2511697895 | |||
| 534 | 2512736628 | |||
| 535 | 2524191714 | |||
| 536 | 2540605119 | |||
| 537 | 2545559852 | |||
| 538 | 2553395947 | |||
| 539 | 2555470930 | |||
| 540 | 2578930809 | |||
| 541 | 2595320773 | |||
| 542 | 2631985990 | |||
| 543 | 2644705889 | |||
| 544 | 2644713339 | |||
| 545 | 2644718574 | |||
| 546 | 2644723505 | |||
| 547 | 2644741751 | |||
| 548 | 2651529648 | |||
| 549 | 2673818965 | |||
| 550 | 2674421165 | |||
| 551 | 2685153473 | |||
| 552 | 2686995217 | |||
| 553 | 2687496466 | |||
| 554 | 2695629810 | |||
| 555 | 2698319717 | |||
| 556 | 2705991922 | |||
| 557 | 2717914504 | |||
| 558 | 2721503347 | |||
| 559 | 2723601364 | |||
| 560 | 2730137487 | |||
| 561 | 2738817592 | |||
| 562 | 2738840610 | |||
| 563 | 2739160231 | |||
| 564 | 2739212750 | |||
| 565 | 2739234678 | |||
| 566 | 2739271827 | |||
| 567 | 2745169596 | |||
| 568 | 2753812974 | |||
| 569 | 2793186384 | |||
| 570 | 2802440577 | |||
| 571 | 2809057161 | |||
| 572 | 2812314354 | |||
| 573 | 2817616324 | |||
| 574 | 2819571324 | |||
| 575 | 2819585124 | |||
| 576 | 2819712042 | |||
| 577 | 2819726111 | |||
| 578 | 2823526305 | |||
| 579 | 2842888023 | |||
| 580 | 2857477613 | |||
| 581 | 2857591237 | |||
| 582 | 2857609066 | |||
| 583 | 2857613510 | |||
| 584 | 2858439387 | |||
| 585 | 2860837471 | |||
| 586 | 2865002649 | |||
| 587 | 2865008724 | |||
| 588 | 2877768690 | |||
| 589 | 2880169633 | |||
| 590 | 2889042465 | |||
| 591 | 2889277457 | |||
| 592 | 2889299053 | |||
| 593 | 2897109657 | |||
| 594 | 2904119535 | |||
| 595 | 2904496846 | |||
| 596 | 2904530272 | |||
| 597 | 2904564547 | |||
| 598 | 2904597386 | |||
| 599 | 2904601003 | |||
| 600 | 2907205071 | |||
| 601 | 2908669293 | |||
| 602 | 2915609137 | |||
| 603 | 2916971947 | |||
| 604 | 2919097052 | |||
| 605 | 2919149593 | |||
| 606 | 2919166199 | |||
| 607 | 2919523117 | |||
| 608 | 2919726313 | |||
| 609 | 2919730723 | |||
| 610 | 2925332279 | |||
| 611 | 2928099775 | |||
| 612 | 2928521370 | |||
| 613 | 2929010056 | |||
| 614 | 2929233161 | |||
| 615 | 2931385890 | |||
| 616 | 2936363589 | |||
| 617 | 2938917339 | |||
| 618 | 2939706820 | |||
| 619 | 2946058215 | |||
| 620 | 2947426627 | |||
| 621 | 2954776188 | |||
| 622 | 2956901162 | |||
| 623 | 2960323614 | |||
| 624 | 2960379229 | |||
| 625 | 2962290681 | |||
| 626 | 2964376584 | |||
| 627 | 2965761224 | |||
| 628 | 2969136888 | |||
| 629 | 2969141054 | |||
| 630 | 2969766298 | |||
| 631 | 2969770382 | |||
| 632 | 2971893418 | |||
| 633 | 2979089182 | |||
| 634 | 2980129488 | |||
| 635 | 2980185283 | |||
| 636 | 2980492632 | |||
| 637 | 2981289565 | |||
| 638 | 2981294510 | |||
| 639 | 2981985221 | |||
| 640 | 2981990156 | |||
| 641 | 2996711051 | |||
| 642 | 3001272010 | |||
| 643 | 3001894130 | |||
| 644 | 3006828681 | |||
| 645 | 3006976360 | |||
| 646 | 3006978451 | |||
| 647 | 3006988395 | |||
| 648 | 3006993314 | |||
| 649 | 648167948 | |||
| 650 | 8002323450 | |||
| 651 | 8022621125 | |||
| 652 | 8022631734 | |||
| 653 | 8022655713 | |||
| 654 | 8022796038 | |||
| 655 | 8022896328 | |||
| 656 | 8022917956 | |||
| 657 | 8023440738 | |||
| 658 | 8023447659 | |||
| 659 | 8046992111 | |||
| 660 | 8051956560 | |||
| 661 | 8052175037 | |||
| 662 | 8054801415 | |||
| 663 | 8055634119 | |||
| 664 | 8055635345 | |||
| 665 | 8057582693 | |||
| 666 | 8057632168 | |||
| 667 | 8057735761 | |||
| 668 | 8057979750 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hjn-assembly1.cif.gz_A | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9704 | 4 | 204 |
| 3hjn-assembly1.cif.gz_B | crystal structure of thymidylate kinase in complex with dtdp and adp from thermotoga maritima | 0.9665 | 4 | 201 |
| 4edh-assembly1.cif.gz_B | the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with adp,tmp and mg. | 0.9621 | 1 | 207 |
| 4gmd-assembly2.cif.gz_B | the crystal structure of thymidylate kinase from pseudomonas aeruginosa pao1 in complex with azt monophosphate | 0.9605 | 3 | 207 |
| 3uwo-assembly3.cif.gz_A | structure guided development of novel thymidine mimetics targeting pseudomonas aeruginosa thymidylate kinase: from hit to lead generation | 0.9593 | 3 | 207 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9507 | 5 | 201 | 3.40.50.300 |
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9493 | 3 | 208 | 3.40.50.300 |
| 3uwoB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9419 | 3 | 208 | 3.40.50.300 |
| 2z0hB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9402 | 5 | 201 | 3.40.50.300 |
| 5x7jB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.94 | 3 | 208 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-C2UPE2-F1-model_v4 | deleted | 0.9991 | 35 | 208 |
|
| AF-S7SNE7-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9978 | 1 | 207 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A3Q9RJS2-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9972 | 2 | 207 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-Q65PJ3-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9968 | 1 | 207 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |
| AF-A0A544SLT4-F1-model_v4 | Thymidylate kinase (EC 2.7.4.9) (dTMP kinase) | 0.9964 | 2 | 207 |
GO:0004798
GO:0005524 GO:0005829 GO:0006227 GO:0006233 GO:0006235 |