F411801

General Info

Members Datasets Scaffolds Average Seq Length
334 156 332 117

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10171560|Ga0163163_101715603
Length 126
Sequence MKKIYHLGNCTTCQAIIKDTAIDKKGFDMQDIKFEKISPDQLEEMKKMAGSYEALFSRRAMKYKEWGLKDKKLTEKDYRQYILDEYTFLKRPVVIINDRIFIGSEKKNVSELKKKLDAGYWILDAG

Samples

Sample ID Description Type Environment
1 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
124 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
125 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
128 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
132 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
133 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
134 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
135 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
136 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
137 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
138 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
139 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
142 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
143 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
146 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
147 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
148 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
149 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
150 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
151 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
152 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
153 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
154 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
155 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
156 8036736890 Flavobacterium dauae TCH3-2 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0
Rhizoplane 0.6
Rhizosphere 96.11
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1001653 3300000545 Bacteria 1502
2 rootL2_10155628 3300003322 Bacteria 2934
3 Ga0065704_10103191 3300005289 Bacteria 2180
4 Ga0065715_10421923 3300005293 Bacteria 857
5 Ga0070676_10014629 3300005328 Bacteria 4316
6 Ga0070676_10053862 3300005328 Bacteria 2370
7 Ga0070676_10528116 3300005328 Bacteria 842
8 Ga0070676_10544341 3300005328 Bacteria 830
9 Ga0070690_100603492 3300005330 Bacteria 833
10 Ga0070670_100031709 3300005331 Bacteria 4552
11 Ga0070670_100187192 3300005331 Bacteria 1797
12 Ga0070670_100274072 3300005331 Bacteria 1473
13 Ga0070677_10097990 3300005333 Bacteria 1287
14 Ga0070677_10111615 3300005333 Bacteria 1221
15 Ga0068869_100008042 3300005334 Bacteria 6774
16 Ga0068869_100015301 3300005334 Bacteria 5143
17 Ga0068869_100049750 3300005334 Bacteria 3035
18 Ga0068869_100078357 3300005334 Bacteria 2461
19 Ga0068869_100111220 3300005334 Bacteria 2084
20 Ga0068869_100801699 3300005334 Unclassified 809
21 Ga0070666_10000030 3300005335 Bacteria 137543
22 Ga0070666_10006828 3300005335 Bacteria 7031
23 Ga0068868_100001929 3300005338 Bacteria 14246
24 Ga0068868_100002753 3300005338 Bacteria 12174
25 Ga0068868_100040496 3300005338 Bacteria 3626
26 Ga0068868_100988521 3300005338 Bacteria 769
27 Ga0068868_101934799 3300005338 Bacteria 559
28 Ga0070689_100491075 3300005340 Bacteria 1050
29 Ga0070689_100827819 3300005340 Bacteria 815
30 Ga0070661_100327880 3300005344 Bacteria 1197
31 Ga0070668_100052844 3300005347 Bacteria 3132
32 Ga0070668_100098551 3300005347 Unclassified 2313
33 Ga0070668_101493742 3300005347 Bacteria 617
34 Ga0070669_100005901 3300005353 Bacteria 8836
35 Ga0070669_100053830 3300005353 Bacteria 2946
36 Ga0070669_100078286 3300005353 Bacteria 2457
37 Ga0070669_100714727 3300005353 Unclassified 847
38 Ga0070675_100017234 3300005354 Bacteria 5739
39 Ga0070675_100079425 3300005354 Bacteria 2733
40 Ga0070675_100328210 3300005354 Bacteria 1353
41 Ga0070675_100338475 3300005354 Bacteria 1332
42 Ga0070671_100094713 3300005355 Bacteria 2503
43 Ga0070671_100461843 3300005355 Bacteria 1090
44 Ga0070671_100962320 3300005355 Bacteria 747
45 Ga0070674_100053540 3300005356 Unclassified 2787
46 Ga0070673_100001872 3300005364 Bacteria 12593
47 Ga0070673_101052173 3300005364 Unclassified 759
48 Ga0070688_100048194 3300005365 Bacteria 2646
49 Ga0070688_100118873 3300005365 Bacteria 1767
50 Ga0070667_100048393 3300005367 Bacteria 3578
51 Ga0070667_100068775 3300005367 Unclassified 3013
52 Ga0070701_10061332 3300005438 Bacteria 1983
53 Ga0070700_100068523 3300005441 Bacteria 2256
54 Ga0070700_100177854 3300005441 Bacteria 1478
55 Ga0070678_100020649 3300005456 Bacteria 4325
56 Ga0070678_100042818 3300005456 Bacteria 3221
57 Ga0070662_100008765 3300005457 Bacteria 6598
58 Ga0070662_100152874 3300005457 Unclassified 1798
59 Ga0068867_100259775 3300005459 Bacteria 1415
60 Ga0068867_101260862 3300005459 Unclassified 681
61 Ga0068867_101518408 3300005459 Bacteria 624
62 Ga0070685_10135704 3300005466 Unclassified 1543
63 Ga0070698_100003501 3300005471 Bacteria 17268
64 Ga0070698_100004308 3300005471 Bacteria 15657
65 Ga0070698_100008096 3300005471 Bacteria 11367
66 Ga0068853_100161562 3300005539 Unclassified 2022
67 Ga0068853_100983209 3300005539 Bacteria 812
68 Ga0070672_100004307 3300005543 Bacteria 9309
69 Ga0070665_100268565 3300005548 Unclassified 1707
70 Ga0070665_101128344 3300005548 Bacteria 795
71 Ga0070704_100294129 3300005549 Unclassified 1350
72 Ga0070704_101021406 3300005549 Bacteria 748
73 Ga0070664_100068791 3300005564 Bacteria 3028
74 Ga0068857_100156956 3300005577 Bacteria 2063
75 Ga0068857_100577184 3300005577 Unclassified 1061
76 Ga0068854_100058775 3300005578 Unclassified 2777
77 Ga0068854_100094563 3300005578 Bacteria 2229
78 Ga0068854_100484214 3300005578 Bacteria 1039
79 Ga0068854_101529055 3300005578 Unclassified 606
80 Ga0068852_100019481 3300005616 Bacteria 5372
81 Ga0068859_100000003 3300005617 Bacteria 479218
82 Ga0068859_100006324 3300005617 Bacteria 12012
83 Ga0068859_100031415 3300005617 Bacteria 5334
84 Ga0068859_100112396 3300005617 Bacteria 2787
85 Ga0068859_100126337 3300005617 Bacteria 2627
86 Ga0068859_103116275 3300005617 Bacteria 505
87 Ga0068864_100006709 3300005618 Bacteria 9431
88 Ga0068864_101504014 3300005618 Bacteria 676
89 Ga0068864_102549594 3300005618 Unclassified 517
90 Ga0068866_10010035 3300005718 Bacteria 4047
91 Ga0068866_10188496 3300005718 Bacteria 1224
92 Ga0068866_10697769 3300005718 Bacteria 696
93 Ga0068866_11306748 3300005718 Unclassified 527
94 Ga0068861_100003873 3300005719 Bacteria 10003
95 Ga0068861_100122018 3300005719 Bacteria 2104
96 Ga0068861_100183997 3300005719 Bacteria 1741
97 Ga0068861_100223210 3300005719 Bacteria 1594
98 Ga0068861_101701871 3300005719 Unclassified 624
99 Ga0068861_102237011 3300005719 Bacteria 548
100 Ga0068851_10002845 3300005834 Bacteria 7638
101 Ga0068870_10084639 3300005840 Bacteria 1761
102 Ga0068863_100006964 3300005841 Bacteria 11087
103 Ga0068858_100020300 3300005842 Bacteria 6213
104 Ga0068860_100045970 3300005843 Bacteria 4164
105 Ga0068860_101717526 3300005843 Bacteria 650
106 Ga0068862_100003760 3300005844 Bacteria 12947
107 Ga0068862_100047358 3300005844 Bacteria 3669
108 Ga0068862_100215834 3300005844 Bacteria 1735
109 Ga0097621_100000626 3300006237 Bacteria 24907
110 Ga0097621_100059386 3300006237 Bacteria 3131
111 Ga0097621_100105070 3300006237 Bacteria 2380
112 Ga0097621_100861449 3300006237 Bacteria 842
113 Ga0097621_100996148 3300006237 Unclassified 784
114 Ga0068871_100006293 3300006358 Bacteria 8384
115 Ga0068871_100025480 3300006358 Bacteria 4602
116 Ga0068871_100986428 3300006358 Unclassified 784
117 Ga0068865_100004942 3300006881 Bacteria 8058
118 Ga0068865_100152788 3300006881 Bacteria 1753
119 Ga0068865_100281164 3300006881 Bacteria 1325
120 Ga0097620_100000003 3300006931 Bacteria 479218
121 Ga0097620_100006324 3300006931 Bacteria 12012
122 Ga0097620_100031416 3300006931 Bacteria 5334
123 Ga0097620_100112396 3300006931 Bacteria 2787
124 Ga0097620_100126338 3300006931 Bacteria 2627
125 Ga0097620_103115954 3300006931 Bacteria 505
126 Ga0111539_10010902 3300009094 Bacteria 11441
127 Ga0111539_12132003 3300009094 Bacteria 650
128 Ga0105245_10035757 3300009098 Bacteria 4409
129 Ga0105245_10962265 3300009098 Unclassified 897
130 Ga0105247_10000331 3300009101 Bacteria 41671
131 Ga0105247_10001011 3300009101 Bacteria 21244
132 Ga0105243_10441876 3300009148 Bacteria 1218
133 Ga0105241_10003226 3300009174 Bacteria 12137
134 Ga0105241_10719258 3300009174 Bacteria 913
135 Ga0105242_10042100 3300009176 Bacteria 3686
136 Ga0105242_10252213 3300009176 Bacteria 1590
137 Ga0105242_10376567 3300009176 Bacteria 1318
138 Ga0105248_10433034 3300009177 Unclassified 1481
139 Ga0105237_10008019 3300009545 Bacteria 11494
140 Ga0105238_10488862 3300009551 Unclassified 1231
141 Ga0105249_10003433 3300009553 Bacteria 13723
142 Ga0105249_10010692 3300009553 Bacteria 8061
143 Ga0105249_10038612 3300009553 Bacteria 4333
144 Ga0105249_10338488 3300009553 Bacteria 1520
145 Ga0105249_11011101 3300009553 Bacteria 900
146 Ga0105249_13229159 3300009553 Bacteria 524
147 Ga0105246_10002310 3300011119 Bacteria 11513
148 Ga0105246_10380073 3300011119 Bacteria 1167
149 Ga0105246_11067183 3300011119 Bacteria 735
150 Ga0157370_10000771 3300013104 Bacteria 40125
151 Ga0157370_10377128 3300013104 Bacteria 1307
152 Ga0157370_10685081 3300013104 Unclassified 936
153 Ga0157370_11380290 3300013104 Bacteria 634
154 Ga0157374_10005326 3300013296 Bacteria 10806
155 Ga0157378_10005392 3300013297 Bacteria 11214
156 Ga0157378_10064451 3300013297 Bacteria 3278
157 Ga0157378_10100341 3300013297 Bacteria 2642
158 Ga0157378_10148338 3300013297 Bacteria 2184
159 Ga0157378_10711633 3300013297 Bacteria 1024
160 Ga0157378_11595978 3300013297 Bacteria 698
161 Ga0163162_10000555 3300013306 Bacteria 34535
162 Ga0163162_10010481 3300013306 Bacteria 9012
163 Ga0163162_10108007 3300013306 Bacteria 2879
164 Ga0163162_10130035 3300013306 Bacteria 2626
165 Ga0163162_10349107 3300013306 Bacteria 1612
166 Ga0163162_10379475 3300013306 Bacteria 1547
167 Ga0163162_10571796 3300013306 Unclassified 1257
168 Ga0157372_10344021 3300013307 Bacteria 1737
169 Ga0157375_10014730 3300013308 Bacteria 6988
170 Ga0157375_10021981 3300013308 Bacteria 5864
171 Ga0157375_10042020 3300013308 Bacteria 4421
172 Ga0157375_10052622 3300013308 Bacteria 4003
173 Ga0157375_10150725 3300013308 Bacteria 2460
174 Ga0157375_10171461 3300013308 Unclassified 2318
175 Ga0157375_12565770 3300013308 Bacteria 609
176 Ga0163163_10012755 3300014325 Bacteria 7667
177 Ga0163163_10144372 3300014325 Bacteria 2423
178 Ga0163163_10171560 3300014325 Bacteria 2216
179 Ga0163163_10373256 3300014325 Bacteria 1484
180 Ga0157380_10000477 3300014326 Bacteria 24458
181 Ga0157380_10270107 3300014326 Unclassified 1550
182 Ga0157380_10893763 3300014326 Unclassified 914
183 Ga0157377_10003110 3300014745 Bacteria 7466
184 Ga0157377_10032427 3300014745 Bacteria 2844
185 Ga0157379_10196761 3300014968 Unclassified 1822
186 Ga0157379_10369969 3300014968 Bacteria 1314
187 Ga0157379_10652511 3300014968 Bacteria 985
188 Ga0157379_10829295 3300014968 Bacteria 874
189 Ga0157379_11221875 3300014968 Bacteria 723
190 Ga0157376_10045594 3300014969 Bacteria 3611
191 Ga0157376_10143248 3300014969 Unclassified 2146
192 Ga0163161_10749615 3300017792 Bacteria 817
193 Ga0163161_11500166 3300017792 Bacteria 592
194 Ga0207697_10029052 3300025315 Bacteria 2262
195 Ga0207656_10046018 3300025321 Unclassified 1870
196 Ga0207656_10681745 3300025321 Bacteria 526
197 Ga0207656_10687876 3300025321 Unclassified 524
198 Ga0207682_10096209 3300025893 Bacteria 1290
199 Ga0207682_10447905 3300025893 Bacteria 611
200 Ga0207642_10025419 3300025899 Unclassified 2395
201 Ga0207642_10494968 3300025899 Bacteria 748
202 Ga0207710_10001266 3300025900 Bacteria 12785
203 Ga0207710_10052513 3300025900 Unclassified 1832
204 Ga0207688_10002062 3300025901 Bacteria 10799
205 Ga0207688_10066968 3300025901 Bacteria 2032
206 Ga0207680_10000014 3300025903 Bacteria 179035
207 Ga0207680_10107791 3300025903 Bacteria 1801
208 Ga0207645_10000050 3300025907 Bacteria 84659
209 Ga0207645_10030927 3300025907 Bacteria 3448
210 Ga0207643_10035298 3300025908 Unclassified 2803
211 Ga0207654_10031704 3300025911 Bacteria 2913
212 Ga0207671_10003129 3300025914 Bacteria 16809
213 Ga0207681_10006289 3300025923 Bacteria 7289
214 Ga0207681_10347522 3300025923 Unclassified 1186
215 Ga0207681_10531666 3300025923 Unclassified 966
216 Ga0207650_10042570 3300025925 Bacteria 3331
217 Ga0207650_10127819 3300025925 Unclassified 1985
218 Ga0207659_10021337 3300025926 Bacteria 4298
219 Ga0207659_10601589 3300025926 Unclassified 937
220 Ga0207687_10778880 3300025927 Bacteria 815
221 Ga0207687_11637399 3300025927 Bacteria 552
222 Ga0207644_10586599 3300025931 Bacteria 925
223 Ga0207706_10030130 3300025933 Bacteria 4841
224 Ga0207706_10118853 3300025933 Unclassified 2324
225 Ga0207706_10506744 3300025933 Unclassified 1041
226 Ga0207686_10519943 3300025934 Bacteria 926
227 Ga0207670_10127404 3300025936 Bacteria 1859
228 Ga0207670_10235270 3300025936 Bacteria 1409
229 Ga0207670_10990225 3300025936 Bacteria 707
230 Ga0207669_10139673 3300025937 Unclassified 1679
231 Ga0207669_11836064 3300025937 Bacteria 518
232 Ga0207704_10093830 3300025938 Unclassified 1980
233 Ga0207704_10204528 3300025938 Bacteria 1448
234 Ga0207704_10690326 3300025938 Bacteria 844
235 Ga0207691_10002788 3300025940 Bacteria 17034
236 Ga0207691_10263226 3300025940 Bacteria 1486
237 Ga0207689_10002235 3300025942 Bacteria 18142
238 Ga0207689_10005895 3300025942 Bacteria 10853
239 Ga0207689_10010116 3300025942 Bacteria 8132
240 Ga0207689_10026298 3300025942 Bacteria 4873
241 Ga0207689_10046255 3300025942 Bacteria 3596
242 Ga0207689_10104522 3300025942 Bacteria 2327
243 Ga0207689_11282335 3300025942 Bacteria 616
244 Ga0207651_10049218 3300025960 Unclassified 2854
245 Ga0207712_10010801 3300025961 Bacteria 5808
246 Ga0207712_10046917 3300025961 Bacteria 2997
247 Ga0207712_11269922 3300025961 Unclassified 658
248 Ga0207668_10082824 3300025972 Bacteria 2332
249 Ga0207668_10139562 3300025972 Bacteria 1862
250 Ga0207668_10713085 3300025972 Bacteria 882
251 Ga0207640_10097828 3300025981 Bacteria 2050
252 Ga0207640_10152575 3300025981 Unclassified 1699
253 Ga0207640_10449420 3300025981 Bacteria 1062
254 Ga0207658_11265604 3300025986 Bacteria 674
255 Ga0207677_10054706 3300026023 Unclassified 2725
256 Ga0207677_10110039 3300026023 Bacteria 2050
257 Ga0207677_10593556 3300026023 Bacteria 971
258 Ga0207703_10001353 3300026035 Bacteria 22448
259 Ga0207639_10268208 3300026041 Unclassified 1496
260 Ga0207639_10814450 3300026041 Bacteria 870
261 Ga0207708_10042195 3300026075 Unclassified 3478
262 Ga0207708_10926164 3300026075 Bacteria 755
263 Ga0207641_10000015 3300026088 Bacteria 321332
264 Ga0207641_10014083 3300026088 Bacteria 6556
265 Ga0207641_10234637 3300026088 Bacteria 1707
266 Ga0207648_10000464 3300026089 Bacteria 45165
267 Ga0207648_10079840 3300026089 Bacteria 2854
268 Ga0207648_10740386 3300026089 Bacteria 913
269 Ga0207676_10047101 3300026095 Bacteria 3339
270 Ga0207676_10108716 3300026095 Bacteria 2316
271 Ga0207674_10092109 3300026116 Bacteria 3021
272 Ga0207674_10719888 3300026116 Bacteria 963
273 Ga0207675_100000790 3300026118 Bacteria 31482
274 Ga0207675_100006113 3300026118 Bacteria 11449
275 Ga0207675_100083477 3300026118 Bacteria 2996
276 Ga0207675_100105260 3300026118 Bacteria 2659
277 Ga0207675_100226557 3300026118 Bacteria 1802
278 Ga0207683_10000736 3300026121 Bacteria 29807
279 Ga0207683_10012032 3300026121 Bacteria 7387
280 Ga0209971_1039134 3300027682 Bacteria 1142
281 Ga0207428_10009780 3300027907 Bacteria 8592
282 Ga0268266_11286921 3300028379 Bacteria 706
283 Ga0268265_10079817 3300028380 Bacteria 2578
284 Ga0268265_10355543 3300028380 Unclassified 1339
285 Ga0268265_10553454 3300028380 Unclassified 1092
286 Ga0268264_10001730 3300028381 Bacteria 20054
287 Ga0268264_10015348 3300028381 Bacteria 6282
288 Ga0268264_10037956 3300028381 Bacteria 3973
289 Ga0268264_11849256 3300028381 Bacteria 614
290 Ga0265313_10101107 3300031595 Bacteria 1280
291 Ga0307406_11576841 3300031901 Bacteria 579
292 Ga0307414_10000824 3300032004 Bacteria 15843
293 Ga0307414_10243256 3300032004 Bacteria 1491
294 Ga0307411_10595121 3300032005 Bacteria 950
295 Ga0373937_0839232 3300036401 Unclassified 867
296 Ga0439454_009581 3300042011 Bacteria 1260
297 Ga0450922_003593 3300042124 Bacteria 1426
298 Ga0439435_0102208 3300042436 Bacteria 882
299 Ga0466969_0091163 3300044656 Bacteria 1444
300 Ga0495650_0009833 3300046471 Bacteria 5400
301 Ga0495607_0039014 3300046501 Bacteria 2839
302 Ga0495616_0005467 3300046513 Bacteria 7815
303 Ga0495643_0000067 3300046522 Bacteria 175403
304 Ga0495611_0576202 3300046648 Bacteria 509
305 Ga0495625_0028062 3300046660 Bacteria 4225
306 Ga0495672_0220656 3300047320 Bacteria 936
307 Ga0495672_0558952 3300047320 Bacteria 500
308 Ga0496106_0665970 3300048909 Bacteria 831
309 Ga0496115_0145164 3300048918 Bacteria 1958
310 Ga0496125_0000024 3300048928 Bacteria 442149
311 Ga0496126_0015607 3300048929 Bacteria 7633
312 Ga0501297_012126 3300049520 Bacteria 998
313 Ga0501300_072752 3300049523 Bacteria 558
314 Ga0501072_0040101 3300049588 Bacteria 3677
315 Ga0501198_061825 3300049649 Bacteria 689
316 Ga0501207_053488 3300049654 Bacteria 726
317 Ga0501217_077568 3300049661 Bacteria 915
318 Ga0501080_0616193 3300049742 Bacteria 962
319 Ga0501266_072020 3300049763 Bacteria 572
320 Ga0501280_028684 3300049776 Bacteria 861
321 nmdc:mga0k408_19751_c1 3300050493 Bacteria 3768
322 nmdc:mga09592_1146418_c1 3300050508 Bacteria 644
323 nmdc:mga08y16_1836790_c1 3300050511 Bacteria 558
324 nmdc:mga08y16_19206_c1 3300050511 Bacteria 7201
325 nmdc:mga08y16_557545_c1 3300050511 Unclassified 1159
326 Ga0500646_0021363 3300053090 Bacteria 1724
327 Ga0500641_0000293 3300053096 Bacteria 18720
328 Ga0500641_0001147 3300053096 Bacteria 9413
329 Ga0500608_189367 3300053122 Bacteria 862
330 Ga0500568_0000088 3300053139 Bacteria 89215
331 Ga0500616_0142440 3300053153 Bacteria 1119
332 Ga0500622_0091373 3300053156 Unclassified 1510

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050511 nmdc:mga08y16_557545_c1 nmdc:mga08y16_557545_c1_19_336 102
2 3300050508 nmdc:mga09592_1146418_c1 nmdc:mga09592_1146418_c1_309_632 104
3 3300053153 Ga0500616_0142440 Ga0500616_0142440_359_718 106
4 3300014968 Ga0157379_10196761 Ga0157379_101967613 107
5 iso_pu_bacteria 2958512119 2958515698 110
6 3300005334 Ga0068869_100015301 Ga0068869_1000153013 111
7 3300005338 Ga0068868_100001929 Ga0068868_10000192912 111
8 3300005353 Ga0070669_100714727 Ga0070669_1007147272 111
9 3300005354 Ga0070675_100328210 Ga0070675_1003282103 111
10 3300005355 Ga0070671_100461843 Ga0070671_1004618432 111
11 3300005578 Ga0068854_100094563 Ga0068854_1000945632 111
12 3300005617 Ga0068859_100126337 Ga0068859_1001263373 111
13 3300005718 Ga0068866_10188496 Ga0068866_101884962 111
14 3300005719 Ga0068861_101701871 Ga0068861_1017018712 111
15 3300006237 Ga0097621_100996148 Ga0097621_1009961481 111
16 3300006931 Ga0097620_100126338 Ga0097620_1001263383 111
17 3300013297 Ga0157378_10148338 Ga0157378_101483384 111
18 3300013306 Ga0163162_10010481 Ga0163162_100104814 111
19 3300013307 Ga0157372_10344021 Ga0157372_103440214 111
20 3300013308 Ga0157375_10150725 Ga0157375_101507254 111
21 3300014326 Ga0157380_10893763 Ga0157380_108937632 111
22 3300025923 Ga0207681_10531666 Ga0207681_105316662 111
23 3300025926 Ga0207659_10601589 Ga0207659_106015892 111
24 3300025933 Ga0207706_10506744 Ga0207706_105067442 111
25 3300025936 Ga0207670_10127404 Ga0207670_101274041 111
26 3300025942 Ga0207689_10104522 Ga0207689_101045223 111
27 3300025972 Ga0207668_10139562 Ga0207668_101395622 111
28 3300026023 Ga0207677_10054706 Ga0207677_100547063 111
29 3300026089 Ga0207648_10079840 Ga0207648_100798403 111
30 iso_pu_bacteria 8036736890 8036739606 111
31 3300013104 Ga0157370_10000771 Ga0157370_1000077128 115
32 3300013306 Ga0163162_10379475 Ga0163162_103794751 115
33 3300017792 Ga0163161_10749615 Ga0163161_107496152 115
34 3300032004 Ga0307414_10243256 Ga0307414_102432562 115
35 3300032005 Ga0307411_10595121 Ga0307411_105951212 115
36 3300042436 Ga0439435_0102208 Ga0439435_0102208_47_397 115
37 3300046513 Ga0495616_0005467 Ga0495616_0005467_4216_4566 115
38 3300046522 Ga0495643_0000067 Ga0495643_0000067_129831_130181 115
39 3300046660 Ga0495625_0028062 Ga0495625_0028062_2557_2907 115
40 3300048918 Ga0496115_0145164 Ga0496115_0145164_937_1287 115
41 3300048928 Ga0496125_0000024 Ga0496125_0000024_38861_39211 115
42 3300048929 Ga0496126_0015607 Ga0496126_0015607_4484_4834 115
43 3300049776 Ga0501280_028684 Ga0501280_028684_460_810 115
44 3300053090 Ga0500646_0021363 Ga0500646_0021363_1239_1589 115
45 3300053096 Ga0500641_0000293 Ga0500641_0000293_10386_10736 115
46 3300053122 Ga0500608_189367 Ga0500608_189367_270_620 115
47 3300053156 Ga0500622_0091373 Ga0500622_0091373_749_1099 115
48 3300005289 Ga0065704_10103191 Ga0065704_101031914 116
49 3300005334 Ga0068869_100008042 Ga0068869_1000080428 116
50 3300005335 Ga0070666_10000030 Ga0070666_1000003021 116
51 3300005338 Ga0068868_100040496 Ga0068868_1000404964 116
52 3300005340 Ga0070689_100491075 Ga0070689_1004910751 116
53 3300005347 Ga0070668_100052844 Ga0070668_1000528443 116
54 3300005355 Ga0070671_100962320 Ga0070671_1009623201 116
55 3300005365 Ga0070688_100118873 Ga0070688_1001188732 116
56 3300005367 Ga0070667_100068775 Ga0070667_1000687752 116
57 3300005548 Ga0070665_101128344 Ga0070665_1011283442 116
58 3300005616 Ga0068852_100019481 Ga0068852_1000194813 116
59 3300005617 Ga0068859_100000003 Ga0068859_100000003359 116
60 3300005618 Ga0068864_100006709 Ga0068864_1000067097 116
61 3300005718 Ga0068866_10697769 Ga0068866_106977691 116
62 3300005834 Ga0068851_10002845 Ga0068851_100028452 116
63 3300005841 Ga0068863_100006964 Ga0068863_1000069646 116
64 3300005842 Ga0068858_100020300 Ga0068858_1000203005 116
65 3300006237 Ga0097621_100000626 Ga0097621_10000062622 116
66 3300006237 Ga0097621_100059386 Ga0097621_1000593863 116
67 3300006358 Ga0068871_100006293 Ga0068871_1000062934 116
68 3300006931 Ga0097620_100000003 Ga0097620_100000003359 116
69 3300009098 Ga0105245_10035757 Ga0105245_100357573 116
70 3300009101 Ga0105247_10001011 Ga0105247_1000101110 116
71 3300009148 Ga0105243_10441876 Ga0105243_104418762 116
72 3300009174 Ga0105241_10003226 Ga0105241_100032266 116
73 3300009176 Ga0105242_10252213 Ga0105242_102522132 116
74 3300009545 Ga0105237_10008019 Ga0105237_100080199 116
75 3300009551 Ga0105238_10488862 Ga0105238_104888621 116
76 3300009553 Ga0105249_10003433 Ga0105249_100034336 116
77 3300011119 Ga0105246_10380073 Ga0105246_103800732 116
78 3300013104 Ga0157370_10685081 Ga0157370_106850811 116
79 3300013297 Ga0157378_10100341 Ga0157378_101003412 116
80 3300013297 Ga0157378_10711633 Ga0157378_107116332 116
81 3300013306 Ga0163162_10000555 Ga0163162_1000055517 116
82 3300013308 Ga0157375_10021981 Ga0157375_100219811 116
83 3300014325 Ga0163163_10373256 Ga0163163_103732563 116
84 3300014968 Ga0157379_10652511 Ga0157379_106525112 116
85 3300014969 Ga0157376_10045594 Ga0157376_100455942 116
86 3300025321 Ga0207656_10046018 Ga0207656_100460182 116
87 3300025893 Ga0207682_10447905 Ga0207682_104479052 116
88 3300025900 Ga0207710_10052513 Ga0207710_100525132 116
89 3300025903 Ga0207680_10000014 Ga0207680_1000001485 116
90 3300025911 Ga0207654_10031704 Ga0207654_100317042 116
91 3300025914 Ga0207671_10003129 Ga0207671_1000312914 116
92 3300025927 Ga0207687_10778880 Ga0207687_107788802 116
93 3300025936 Ga0207670_10235270 Ga0207670_102352702 116
94 3300025942 Ga0207689_10005895 Ga0207689_100058953 116
95 3300025961 Ga0207712_10010801 Ga0207712_100108013 116
96 3300025972 Ga0207668_10082824 Ga0207668_100828242 116
97 3300026023 Ga0207677_10593556 Ga0207677_105935562 116
98 3300026035 Ga0207703_10001353 Ga0207703_100013532 116
99 3300026088 Ga0207641_10000015 Ga0207641_10000015176 116
100 3300026095 Ga0207676_10047101 Ga0207676_100471012 116
101 3300028381 Ga0268264_10001730 Ga0268264_1000173010 116
102 3300032004 Ga0307414_10000824 Ga0307414_100008249 116
103 3300042011 Ga0439454_009581 Ga0439454_009581_624_977 116
104 3300046501 Ga0495607_0039014 Ga0495607_0039014_2439_2792 116
105 3300048909 Ga0496106_0665970 Ga0496106_0665970_146_499 116
106 3300049649 Ga0501198_061825 Ga0501198_061825_12_389 116
107 3300003322 rootL2_10155628 rootL2_101556284 117
108 3300005293 Ga0065715_10421923 Ga0065715_104219232 117
109 3300005328 Ga0070676_10014629 Ga0070676_100146296 117
110 3300005328 Ga0070676_10053862 Ga0070676_100538623 117
111 3300005328 Ga0070676_10528116 Ga0070676_105281162 117
112 3300005330 Ga0070690_100603492 Ga0070690_1006034922 117
113 3300005331 Ga0070670_100031709 Ga0070670_1000317096 117
114 3300005331 Ga0070670_100274072 Ga0070670_1002740721 117
115 3300005333 Ga0070677_10097990 Ga0070677_100979901 117
116 3300005334 Ga0068869_100049750 Ga0068869_1000497503 117
117 3300005335 Ga0070666_10006828 Ga0070666_100068282 117
118 3300005338 Ga0068868_100002753 Ga0068868_10000275312 117
119 3300005338 Ga0068868_100988521 Ga0068868_1009885211 117
120 3300005340 Ga0070689_100827819 Ga0070689_1008278191 117
121 3300005344 Ga0070661_100327880 Ga0070661_1003278802 117
122 3300005347 Ga0070668_101493742 Ga0070668_1014937421 117
123 3300005353 Ga0070669_100005901 Ga0070669_1000059015 117
124 3300005353 Ga0070669_100053830 Ga0070669_1000538305 117
125 3300005354 Ga0070675_100017234 Ga0070675_10001723410 117
126 3300005354 Ga0070675_100338475 Ga0070675_1003384752 117
127 3300005355 Ga0070671_100094713 Ga0070671_1000947131 117
128 3300005356 Ga0070674_100053540 Ga0070674_1000535403 117
129 3300005364 Ga0070673_100001872 Ga0070673_1000018725 117
130 3300005365 Ga0070688_100048194 Ga0070688_1000481943 117
131 3300005367 Ga0070667_100048393 Ga0070667_1000483933 117
132 3300005438 Ga0070701_10061332 Ga0070701_100613322 117
133 3300005441 Ga0070700_100068523 Ga0070700_1000685233 117
134 3300005456 Ga0070678_100020649 Ga0070678_1000206492 117
135 3300005457 Ga0070662_100008765 Ga0070662_1000087653 117
136 3300005457 Ga0070662_100152874 Ga0070662_1001528742 117
137 3300005459 Ga0068867_100259775 Ga0068867_1002597752 117
138 3300005459 Ga0068867_101260862 Ga0068867_1012608621 117
139 3300005471 Ga0070698_100003501 Ga0070698_1000035012 117
140 3300005471 Ga0070698_100004308 Ga0070698_10000430811 117
141 3300005471 Ga0070698_100008096 Ga0070698_10000809610 117
142 3300005539 Ga0068853_100161562 Ga0068853_1001615622 117
143 3300005543 Ga0070672_100004307 Ga0070672_1000043075 117
144 3300005548 Ga0070665_100268565 Ga0070665_1002685653 117
145 3300005549 Ga0070704_100294129 Ga0070704_1002941292 117
146 3300005549 Ga0070704_101021406 Ga0070704_1010214061 117
147 3300005577 Ga0068857_100156956 Ga0068857_1001569563 117
148 3300005577 Ga0068857_100577184 Ga0068857_1005771842 117
149 3300005578 Ga0068854_100058775 Ga0068854_1000587753 117
150 3300005617 Ga0068859_100006324 Ga0068859_1000063244 117
151 3300005617 Ga0068859_100031415 Ga0068859_1000314158 117
152 3300005617 Ga0068859_100112396 Ga0068859_1001123962 117
153 3300005617 Ga0068859_103116275 Ga0068859_1031162752 117
154 3300005618 Ga0068864_102549594 Ga0068864_1025495941 117
155 3300005718 Ga0068866_10010035 Ga0068866_100100355 117
156 3300005718 Ga0068866_11306748 Ga0068866_113067481 117
157 3300005719 Ga0068861_100003873 Ga0068861_1000038736 117
158 3300005719 Ga0068861_100122018 Ga0068861_1001220182 117
159 3300005719 Ga0068861_102237011 Ga0068861_1022370111 117
160 3300005840 Ga0068870_10084639 Ga0068870_100846393 117
161 3300005843 Ga0068860_100045970 Ga0068860_1000459705 117
162 3300005844 Ga0068862_100003760 Ga0068862_1000037605 117
163 3300005844 Ga0068862_100215834 Ga0068862_1002158342 117
164 3300006237 Ga0097621_100105070 Ga0097621_1001050704 117
165 3300006358 Ga0068871_100025480 Ga0068871_1000254806 117
166 3300006881 Ga0068865_100004942 Ga0068865_1000049428 117
167 3300006881 Ga0068865_100152788 Ga0068865_1001527881 117
168 3300006881 Ga0068865_100281164 Ga0068865_1002811642 117
169 3300006931 Ga0097620_100006324 Ga0097620_1000063244 117
170 3300006931 Ga0097620_100031416 Ga0097620_1000314162 117
171 3300006931 Ga0097620_100112396 Ga0097620_1001123962 117
172 3300006931 Ga0097620_103115954 Ga0097620_1031159542 117
173 3300009094 Ga0111539_10010902 Ga0111539_100109026 117
174 3300009098 Ga0105245_10962265 Ga0105245_109622651 117
175 3300009176 Ga0105242_10042100 Ga0105242_100421003 117
176 3300009177 Ga0105248_10433034 Ga0105248_104330342 117
177 3300009553 Ga0105249_10038612 Ga0105249_100386123 117
178 3300009553 Ga0105249_10338488 Ga0105249_103384882 117
179 3300009553 Ga0105249_11011101 Ga0105249_110111012 117
180 3300011119 Ga0105246_10002310 Ga0105246_100023105 117
181 3300013104 Ga0157370_10377128 Ga0157370_103771282 117
182 3300013104 Ga0157370_11380290 Ga0157370_113802901 117
183 3300013296 Ga0157374_10005326 Ga0157374_100053269 117
184 3300013297 Ga0157378_10064451 Ga0157378_100644513 117
185 3300013306 Ga0163162_10108007 Ga0163162_101080072 117
186 3300013306 Ga0163162_10349107 Ga0163162_103491072 117
187 3300013308 Ga0157375_10014730 Ga0157375_100147305 117
188 3300013308 Ga0157375_10052622 Ga0157375_100526224 117
189 3300013308 Ga0157375_10171461 Ga0157375_101714614 117
190 3300013308 Ga0157375_12565770 Ga0157375_125657702 117
191 3300014325 Ga0163163_10012755 Ga0163163_100127558 117
192 3300014325 Ga0163163_10144372 Ga0163163_101443723 117
193 3300014326 Ga0157380_10000477 Ga0157380_1000047723 117
194 3300014745 Ga0157377_10003110 Ga0157377_100031105 117
195 3300014968 Ga0157379_11221875 Ga0157379_112218752 117
196 3300014969 Ga0157376_10143248 Ga0157376_101432482 117
197 3300025315 Ga0207697_10029052 Ga0207697_100290523 117
198 3300025321 Ga0207656_10681745 Ga0207656_106817451 117
199 3300025321 Ga0207656_10687876 Ga0207656_106878761 117
200 3300025893 Ga0207682_10096209 Ga0207682_100962091 117
201 3300025899 Ga0207642_10025419 Ga0207642_100254193 117
202 3300025899 Ga0207642_10494968 Ga0207642_104949682 117
203 3300025901 Ga0207688_10002062 Ga0207688_100020629 117
204 3300025903 Ga0207680_10107791 Ga0207680_101077911 117
205 3300025907 Ga0207645_10000050 Ga0207645_1000005040 117
206 3300025907 Ga0207645_10030927 Ga0207645_100309274 117
207 3300025908 Ga0207643_10035298 Ga0207643_100352983 117
208 3300025923 Ga0207681_10006289 Ga0207681_100062893 117
209 3300025923 Ga0207681_10347522 Ga0207681_103475223 117
210 3300025925 Ga0207650_10042570 Ga0207650_100425703 117
211 3300025926 Ga0207659_10021337 Ga0207659_100213375 117
212 3300025927 Ga0207687_11637399 Ga0207687_116373991 117
213 3300025931 Ga0207644_10586599 Ga0207644_105865992 117
214 3300025933 Ga0207706_10030130 Ga0207706_100301305 117
215 3300025933 Ga0207706_10118853 Ga0207706_101188533 117
216 3300025936 Ga0207670_10990225 Ga0207670_109902251 117
217 3300025937 Ga0207669_10139673 Ga0207669_101396732 117
218 3300025937 Ga0207669_11836064 Ga0207669_118360641 117
219 3300025938 Ga0207704_10204528 Ga0207704_102045283 117
220 3300025938 Ga0207704_10690326 Ga0207704_106903262 117
221 3300025940 Ga0207691_10002788 Ga0207691_100027885 117
222 3300025942 Ga0207689_10002235 Ga0207689_100022354 117
223 3300025942 Ga0207689_10026298 Ga0207689_100262983 117
224 3300025942 Ga0207689_11282335 Ga0207689_112823351 117
225 3300025960 Ga0207651_10049218 Ga0207651_100492183 117
226 3300025961 Ga0207712_10046917 Ga0207712_100469173 117
227 3300025981 Ga0207640_10097828 Ga0207640_100978283 117
228 3300025981 Ga0207640_10152575 Ga0207640_101525753 117
229 3300025986 Ga0207658_11265604 Ga0207658_112656042 117
230 3300026023 Ga0207677_10110039 Ga0207677_101100393 117
231 3300026041 Ga0207639_10268208 Ga0207639_102682082 117
232 3300026075 Ga0207708_10042195 Ga0207708_100421954 117
233 3300026089 Ga0207648_10000464 Ga0207648_1000046413 117
234 3300026116 Ga0207674_10092109 Ga0207674_100921095 117
235 3300026116 Ga0207674_10719888 Ga0207674_107198882 117
236 3300026118 Ga0207675_100000790 Ga0207675_10000079024 117
237 3300026118 Ga0207675_100083477 Ga0207675_1000834775 117
238 3300026121 Ga0207683_10000736 Ga0207683_1000073610 117
239 3300027682 Ga0209971_1039134 Ga0209971_10391341 117
240 3300027907 Ga0207428_10009780 Ga0207428_100097804 117
241 3300028379 Ga0268266_11286921 Ga0268266_112869212 117
242 3300028380 Ga0268265_10079817 Ga0268265_100798172 117
243 3300028380 Ga0268265_10355543 Ga0268265_103555433 117
244 3300028380 Ga0268265_10553454 Ga0268265_105534542 117
245 3300028381 Ga0268264_10015348 Ga0268264_100153483 117
246 3300028381 Ga0268264_11849256 Ga0268264_118492561 117
247 3300031595 Ga0265313_10101107 Ga0265313_101011072 117
248 3300031901 Ga0307406_11576841 Ga0307406_115768412 117
249 3300036401 Ga0373937_0839232 Ga0373937_0839232_447_815 117
250 3300042124 Ga0450922_003593 Ga0450922_003593_413_769 117
251 3300044656 Ga0466969_0091163 Ga0466969_0091163_828_1181 117
252 3300046648 Ga0495611_0576202 Ga0495611_0576202_146_499 117
253 3300047320 Ga0495672_0220656 Ga0495672_0220656_285_638 117
254 3300047320 Ga0495672_0558952 Ga0495672_0558952_129_482 117
255 3300049520 Ga0501297_012126 Ga0501297_012126_570_923 117
256 3300049523 Ga0501300_072752 Ga0501300_072752_29_382 117
257 3300049588 Ga0501072_0040101 Ga0501072_0040101_3271_3624 117
258 3300049654 Ga0501207_053488 Ga0501207_053488_285_638 117
259 3300049661 Ga0501217_077568 Ga0501217_077568_466_819 117
260 3300049742 Ga0501080_0616193 Ga0501080_0616193_162_515 117
261 3300049763 Ga0501266_072020 Ga0501266_072020_29_382 117
262 3300050493 nmdc:mga0k408_19751_c1 nmdc:mga0k408_19751_c1_1518_1871 117
263 3300050511 nmdc:mga08y16_19206_c1 nmdc:mga08y16_19206_c1_5019_5372 117
264 3300053096 Ga0500641_0001147 Ga0500641_0001147_12_365 117
265 3300053139 Ga0500568_0000088 Ga0500568_0000088_68072_68431 117
266 3300005328 Ga0070676_10544341 Ga0070676_105443411 118
267 3300005333 Ga0070677_10111615 Ga0070677_101116152 118
268 3300005334 Ga0068869_100078357 Ga0068869_1000783573 118
269 3300005334 Ga0068869_100111220 Ga0068869_1001112204 118
270 3300005347 Ga0070668_100098551 Ga0070668_1000985513 118
271 3300005353 Ga0070669_100078286 Ga0070669_1000782863 118
272 3300005354 Ga0070675_100079425 Ga0070675_1000794253 118
273 3300005364 Ga0070673_101052173 Ga0070673_1010521732 118
274 3300005441 Ga0070700_100177854 Ga0070700_1001778542 118
275 3300005459 Ga0068867_101518408 Ga0068867_1015184081 118
276 3300005466 Ga0070685_10135704 Ga0070685_101357042 118
277 3300005539 Ga0068853_100983209 Ga0068853_1009832092 118
278 3300005564 Ga0070664_100068791 Ga0070664_1000687913 118
279 3300005578 Ga0068854_100484214 Ga0068854_1004842142 118
280 3300005578 Ga0068854_101529055 Ga0068854_1015290551 118
281 3300005618 Ga0068864_101504014 Ga0068864_1015040142 118
282 3300005719 Ga0068861_100183997 Ga0068861_1001839972 118
283 3300005719 Ga0068861_100223210 Ga0068861_1002232102 118
284 3300005843 Ga0068860_101717526 Ga0068860_1017175262 118
285 3300005844 Ga0068862_100047358 Ga0068862_1000473583 118
286 3300006237 Ga0097621_100861449 Ga0097621_1008614491 118
287 3300009094 Ga0111539_12132003 Ga0111539_121320031 118
288 3300009174 Ga0105241_10719258 Ga0105241_107192581 118
289 3300009176 Ga0105242_10376567 Ga0105242_103765672 118
290 3300009553 Ga0105249_13229159 Ga0105249_132291591 118
291 3300011119 Ga0105246_11067183 Ga0105246_110671831 118
292 3300013297 Ga0157378_10005392 Ga0157378_1000539210 118
293 3300013306 Ga0163162_10130035 Ga0163162_101300352 118
294 3300013308 Ga0157375_10042020 Ga0157375_100420205 118
295 3300014745 Ga0157377_10032427 Ga0157377_100324272 118
296 3300014968 Ga0157379_10829295 Ga0157379_108292952 118
297 3300025901 Ga0207688_10066968 Ga0207688_100669682 118
298 3300025934 Ga0207686_10519943 Ga0207686_105199431 118
299 3300025938 Ga0207704_10093830 Ga0207704_100938303 118
300 3300025940 Ga0207691_10263226 Ga0207691_102632262 118
301 3300025942 Ga0207689_10010116 Ga0207689_1001011612 118
302 3300025942 Ga0207689_10046255 Ga0207689_100462552 118
303 3300025972 Ga0207668_10713085 Ga0207668_107130851 118
304 3300025981 Ga0207640_10449420 Ga0207640_104494202 118
305 3300026041 Ga0207639_10814450 Ga0207639_108144502 118
306 3300026075 Ga0207708_10926164 Ga0207708_109261641 118
307 3300026088 Ga0207641_10234637 Ga0207641_102346373 118
308 3300026089 Ga0207648_10740386 Ga0207648_107403862 118
309 3300026095 Ga0207676_10108716 Ga0207676_101087164 118
310 3300026118 Ga0207675_100006113 Ga0207675_1000061136 118
311 3300026118 Ga0207675_100226557 Ga0207675_1002265572 118
312 3300028381 Ga0268264_10037956 Ga0268264_100379563 118
313 3300046471 Ga0495650_0009833 Ga0495650_0009833_5011_5367 118
314 3300050511 nmdc:mga08y16_1836790_c1 nmdc:mga08y16_1836790_c1_124_480 118
315 3300005331 Ga0070670_100187192 Ga0070670_1001871922 119
316 3300005334 Ga0068869_100801699 Ga0068869_1008016992 119
317 3300005338 Ga0068868_101934799 Ga0068868_1019347991 119
318 3300005456 Ga0070678_100042818 Ga0070678_1000428183 119
319 3300006358 Ga0068871_100986428 Ga0068871_1009864282 119
320 3300009101 Ga0105247_10000331 Ga0105247_100003313 119
321 3300009553 Ga0105249_10010692 Ga0105249_100106926 119
322 3300013297 Ga0157378_11595978 Ga0157378_115959781 119
323 3300013306 Ga0163162_10571796 Ga0163162_105717962 119
324 3300014326 Ga0157380_10270107 Ga0157380_102701071 119
325 3300014968 Ga0157379_10369969 Ga0157379_103699692 119
326 3300017792 Ga0163161_11500166 Ga0163161_115001661 119
327 3300025900 Ga0207710_10001266 Ga0207710_100012668 119
328 3300025925 Ga0207650_10127819 Ga0207650_101278192 119
329 3300025961 Ga0207712_11269922 Ga0207712_112699222 119
330 3300026088 Ga0207641_10014083 Ga0207641_100140836 119
331 3300026118 Ga0207675_100105260 Ga0207675_1001052602 119
332 3300026121 Ga0207683_10012032 Ga0207683_100120323 119
333 3300000545 CNXas_1001653 CNXas_10016532 120
334 3300014325 Ga0163163_10171560 Ga0163163_101715603 120

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03960

ArsC

ArsC family

5

112

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f0i-assembly2.cif.gz_B arsenate reductase from vibrio cholerae. 0.8446 2 112
3rdw-assembly2.cif.gz_B putative arsenate reductase from yersinia pestis 0.8426 1 111
3gkx-assembly3.cif.gz_B crystal structure of putative arsc family related protein from bacteroides fragilis 0.8409 2 113
3gkx-assembly2.cif.gz_A crystal structure of putative arsc family related protein from bacteroides fragilis 0.8354 2 113
1sd8-assembly1.cif.gz_A arsenate reductase r60k mutant from e. coli 0.8353 1 117
ID Description Score Start End Superfamily
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8425 1 111 3.40.30.10
3gkxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8295 1 113 3.40.30.10
af_P24178_1_117_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8269 1 112 3.40.30.10
3rdwB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8165 1 111 3.40.30.10
3gkxA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8107 1 113 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A348Y4H1-F1-model_v4 deleted 0.9965 25 117
AF-A0A7Y1TR63-F1-model_v4 Arsenate reductase 0.9955 37 117
AF-A0A3D9HHC3-F1-model_v4 Arsenate reductase 0.9939 30 114
AF-A0A0N0CFI5-F1-model_v4 ArsC family protein 0.9936 26 117
AF-A0A1L7I4X7-F1-model_v4 Arsenate reductase 0.9925 2 117 GO:0016020

Feature Viewer

pLDDT pTM Quality
88.82 0.75 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map