F411758

General Info

Members Datasets Scaffolds Average Seq Length
334 220 332 76

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10406382|Ga0111539_104063822
Length 82
Sequence VVPPQVTITNTIRKLRFEHGEMTQQDLAERVGVTRQTINAIELGKYSPSLEVAFRIAAAFGVRLEDVFQHDGSAQDSRSSPR

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
3 2643221580 Devosia sp. Root635 Isolate Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
149 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
173 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
174 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
175 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
176 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
177 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
178 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
179 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
180 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
190 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
208 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
209 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
210 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0
Isolates 0.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.59
Rhizosphere 94.61
Stem 0
Stem Tuber 0
Unclassified 1.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_4379583 2162886012 Bacteria 878
2 Ga0065714_10493955 3300005288 Bacteria 527
3 Ga0065715_10383402 3300005293 Unclassified 904
4 Ga0070676_10411732 3300005328 Bacteria 943
5 Ga0070676_10448327 3300005328 Bacteria 907
6 Ga0070683_100084124 3300005329 Bacteria 2981
7 Ga0070670_100005278 3300005331 Bacteria 10887
8 Ga0070670_100306371 3300005331 Bacteria 1390
9 Ga0070670_100842456 3300005331 Unclassified 829
10 Ga0068869_102124770 3300005334 Bacteria 505
11 Ga0070666_10071454 3300005335 Unclassified 2362
12 Ga0070680_100090669 3300005336 Bacteria 2531
13 Ga0070680_100488046 3300005336 Bacteria 1053
14 Ga0070682_100033775 3300005337 Bacteria 3110
15 Ga0068868_100011740 3300005338 Bacteria 6383
16 Ga0068868_100481583 3300005338 Bacteria 1084
17 Ga0070689_100005941 3300005340 Bacteria 8401
18 Ga0070687_100119887 3300005343 Bacteria 1503
19 Ga0070687_100241247 3300005343 Bacteria 1118
20 Ga0070661_100013927 3300005344 Bacteria 5652
21 Ga0070668_100804872 3300005347 Bacteria 835
22 Ga0070669_100054858 3300005353 Bacteria 2920
23 Ga0070675_100434749 3300005354 Bacteria 1175
24 Ga0070675_101403541 3300005354 Bacteria 644
25 Ga0070671_100014501 3300005355 Bacteria 6370
26 Ga0070674_100001209 3300005356 Bacteria 13542
27 Ga0070674_101191721 3300005356 Unclassified 676
28 Ga0070674_101774812 3300005356 Bacteria 559
29 Ga0070673_100592807 3300005364 Bacteria 1010
30 Ga0070688_101075513 3300005365 Bacteria 642
31 Ga0070667_100022610 3300005367 Bacteria 5213
32 Ga0070667_101897888 3300005367 Bacteria 561
33 Ga0070703_10080113 3300005406 Bacteria 1110
34 Ga0070713_100026370 3300005436 Bacteria 4561
35 Ga0070713_100184202 3300005436 Unclassified 1878
36 Ga0070713_100800969 3300005436 Bacteria 903
37 Ga0070701_10057008 3300005438 Bacteria 2046
38 Ga0070711_100381223 3300005439 Bacteria 1140
39 Ga0070700_100473282 3300005441 Bacteria 958
40 Ga0070700_100676759 3300005441 Bacteria 817
41 Ga0070694_100132252 3300005444 Bacteria 1804
42 Ga0070694_100993770 3300005444 Bacteria 696
43 Ga0070708_100104216 3300005445 Bacteria 2601
44 Ga0070708_100339393 3300005445 Bacteria 1416
45 Ga0070663_100297340 3300005455 Unclassified 1291
46 Ga0070678_100131515 3300005456 Bacteria 1989
47 Ga0070662_100236417 3300005457 Bacteria 1464
48 Ga0070662_101532365 3300005457 Bacteria 575
49 Ga0070681_11288302 3300005458 Bacteria 653
50 Ga0068867_100763965 3300005459 Bacteria 859
51 Ga0068867_101226928 3300005459 Bacteria 690
52 Ga0070685_10481885 3300005466 Unclassified 874
53 Ga0070685_10805065 3300005466 Bacteria 693
54 Ga0070698_100593626 3300005471 Bacteria 1048
55 Ga0070684_100104576 3300005535 Bacteria 2533
56 Ga0070684_100342701 3300005535 Bacteria 1374
57 Ga0070697_101143838 3300005536 Bacteria 693
58 Ga0070672_100968670 3300005543 Unclassified 753
59 Ga0070672_101604729 3300005543 Unclassified 584
60 Ga0070686_100043176 3300005544 Bacteria 2828
61 Ga0070695_100343807 3300005545 Bacteria 1116
62 Ga0070695_100410787 3300005545 Bacteria 1028
63 Ga0070696_100682763 3300005546 Bacteria 835
64 Ga0070693_100075603 3300005547 Unclassified 1995
65 Ga0070693_100625905 3300005547 Bacteria 780
66 Ga0070665_100233204 3300005548 Bacteria 1841
67 Ga0070665_100394382 3300005548 Bacteria 1392
68 Ga0070665_101876313 3300005548 Unclassified 605
69 Ga0070704_100059858 3300005549 Bacteria 2719
70 Ga0070704_100754955 3300005549 Unclassified 866
71 Ga0070704_100756346 3300005549 Bacteria 866
72 Ga0070704_100787329 3300005549 Bacteria 849
73 Ga0070664_100006275 3300005564 Bacteria 9592
74 Ga0068857_100806358 3300005577 Unclassified 897
75 Ga0068854_100844913 3300005578 Bacteria 801
76 Ga0068856_100645329 3300005614 Bacteria 1079
77 Ga0068856_100690470 3300005614 Bacteria 1041
78 Ga0068852_100560500 3300005616 Bacteria 1144
79 Ga0068859_100006784 3300005617 Bacteria 11632
80 Ga0068859_100683133 3300005617 Bacteria 1118
81 Ga0068864_100013838 3300005618 Bacteria 6685
82 Ga0068866_10727900 3300005718 Unclassified 683
83 Ga0068861_100164787 3300005719 Bacteria 1832
84 Ga0068861_100181208 3300005719 Unclassified 1754
85 Ga0068861_101413346 3300005719 Bacteria 680
86 Ga0068861_102140307 3300005719 Bacteria 560
87 Ga0068870_11224676 3300005840 Bacteria 544
88 Ga0068863_100038671 3300005841 Bacteria 4538
89 Ga0068858_100017853 3300005842 Bacteria 6644
90 Ga0068860_101416318 3300005843 Bacteria 716
91 Ga0068862_100038370 3300005844 Bacteria 4063
92 Ga0068862_100299980 3300005844 Unclassified 1478
93 Ga0081455_10399578 3300005937 Bacteria 954
94 Ga0068871_100095654 3300006358 Bacteria 2481
95 Ga0075428_100003744 3300006844 Bacteria 16672
96 Ga0075430_100119792 3300006846 Bacteria 2194
97 Ga0075430_100510359 3300006846 Bacteria 992
98 Ga0075431_100135775 3300006847 Bacteria 2536
99 Ga0075433_10033349 3300006852 Bacteria 4414
100 Ga0075433_10405803 3300006852 Unclassified 1202
101 Ga0075434_101259301 3300006871 Bacteria 751
102 Ga0075434_102316149 3300006871 Bacteria 540
103 Ga0075429_100063079 3300006880 Bacteria 3229
104 Ga0068865_100600226 3300006881 Unclassified 930
105 Ga0097620_100006782 3300006931 Bacteria 11632
106 Ga0097620_100683087 3300006931 Bacteria 1118
107 Ga0105240_10162357 3300009093 Bacteria 2653
108 Ga0105240_10549272 3300009093 Unclassified 1278
109 Ga0111539_10024584 3300009094 Bacteria 7389
110 Ga0111539_10406382 3300009094 Bacteria 1586
111 Ga0111539_10458872 3300009094 Unclassified 1484
112 Ga0111539_12448795 3300009094 Bacteria 605
113 Ga0105245_10006867 3300009098 Bacteria 9982
114 Ga0105245_10395538 3300009098 Bacteria 1380
115 Ga0105245_11709535 3300009098 Bacteria 682
116 Ga0105247_10006049 3300009101 Bacteria 7530
117 Ga0105247_10728773 3300009101 Bacteria 749
118 Ga0114129_10254350 3300009147 Bacteria 2357
119 Ga0105243_10246362 3300009148 Bacteria 1593
120 Ga0105243_10333714 3300009148 Bacteria 1386
121 Ga0105241_12158106 3300009174 Bacteria 552
122 Ga0105242_10559676 3300009176 Bacteria 1098
123 Ga0105242_11391550 3300009176 Bacteria 729
124 Ga0105242_12244559 3300009176 Bacteria 591
125 Ga0105248_10029086 3300009177 Bacteria 6160
126 Ga0105248_13288733 3300009177 Bacteria 514
127 Ga0105237_10439173 3300009545 Bacteria 1311
128 Ga0105238_10091126 3300009551 Bacteria 3036
129 Ga0105238_10951754 3300009551 Bacteria 879
130 Ga0105249_10395573 3300009553 Bacteria 1411
131 Ga0105249_10611837 3300009553 Bacteria 1145
132 Ga0105239_10027265 3300010375 Bacteria 6289
133 Ga0105239_12602539 3300010375 Bacteria 590
134 Ga0105246_10018263 3300011119 Bacteria 4469
135 Ga0157374_10014754 3300013296 Bacteria 6842
136 Ga0157374_10364373 3300013296 Bacteria 1438
137 Ga0157374_11325561 3300013296 Bacteria 742
138 Ga0157378_10976348 3300013297 Bacteria 880
139 Ga0157378_11426279 3300013297 Bacteria 736
140 Ga0163162_10005267 3300013306 Bacteria 12476
141 Ga0157372_10640778 3300013307 Bacteria 1238
142 Ga0157375_10021411 3300013308 Bacteria 5927
143 Ga0157375_12228628 3300013308 Unclassified 653
144 Ga0157375_13821017 3300013308 Bacteria 500
145 Ga0163163_10003654 3300014325 Bacteria 13080
146 Ga0157380_10001387 3300014326 Bacteria 15804
147 Ga0157380_10055125 3300014326 Bacteria 3156
148 Ga0157380_10065923 3300014326 Bacteria 2912
149 Ga0157380_10216188 3300014326 Unclassified 1712
150 Ga0157380_10688901 3300014326 Bacteria 1025
151 Ga0157380_10713685 3300014326 Bacteria 1009
152 Ga0157380_10854700 3300014326 Bacteria 932
153 Ga0157377_10082731 3300014745 Bacteria 1879
154 Ga0157377_10945696 3300014745 Bacteria 648
155 Ga0157379_10017962 3300014968 Bacteria 6233
156 Ga0157379_10578804 3300014968 Bacteria 1046
157 Ga0157376_11094229 3300014969 Unclassified 822
158 Ga0207656_10385955 3300025321 Bacteria 703
159 Ga0207682_10302862 3300025893 Bacteria 749
160 Ga0207710_10171183 3300025900 Bacteria 1062
161 Ga0207710_10591344 3300025900 Bacteria 579
162 Ga0207680_10028339 3300025903 Unclassified 3132
163 Ga0207680_10319684 3300025903 Bacteria 1085
164 Ga0207699_11225564 3300025906 Unclassified 556
165 Ga0207645_10024514 3300025907 Unclassified 3909
166 Ga0207684_11068094 3300025910 Bacteria 673
167 Ga0207695_10614434 3300025913 Bacteria 968
168 Ga0207663_10917583 3300025916 Bacteria 701
169 Ga0207660_10035228 3300025917 Bacteria 3474
170 Ga0207660_10667702 3300025917 Bacteria 848
171 Ga0207660_10888996 3300025917 Bacteria 727
172 Ga0207662_10063402 3300025918 Bacteria 2222
173 Ga0207662_10183924 3300025918 Bacteria 1346
174 Ga0207649_10013999 3300025920 Bacteria 4489
175 Ga0207694_10631696 3300025924 Bacteria 902
176 Ga0207694_10832388 3300025924 Bacteria 780
177 Ga0207650_10474648 3300025925 Bacteria 1043
178 Ga0207650_10534849 3300025925 Unclassified 982
179 Ga0207650_10692067 3300025925 Bacteria 861
180 Ga0207659_11423527 3300025926 Bacteria 594
181 Ga0207687_10022209 3300025927 Bacteria 4220
182 Ga0207700_10293075 3300025928 Unclassified 1403
183 Ga0207664_10014937 3300025929 Bacteria 5622
184 Ga0207644_10009273 3300025931 Bacteria 6456
185 Ga0207706_10063849 3300025933 Bacteria 3242
186 Ga0207706_10624915 3300025933 Unclassified 924
187 Ga0207709_10296681 3300025935 Bacteria 1200
188 Ga0207709_10307526 3300025935 Bacteria 1181
189 Ga0207670_10006944 3300025936 Bacteria 6301
190 Ga0207669_10001685 3300025937 Bacteria 9392
191 Ga0207669_11106839 3300025937 Bacteria 669
192 Ga0207669_11320422 3300025937 Bacteria 613
193 Ga0207704_10537748 3300025938 Unclassified 948
194 Ga0207704_10663776 3300025938 Bacteria 860
195 Ga0207691_10353510 3300025940 Bacteria 1257
196 Ga0207691_10672310 3300025940 Unclassified 874
197 Ga0207711_10011713 3300025941 Bacteria 7283
198 Ga0207689_10112380 3300025942 Bacteria 2239
199 Ga0207689_11198000 3300025942 Bacteria 639
200 Ga0207689_11416974 3300025942 Bacteria 582
201 Ga0207661_10282439 3300025944 Bacteria 1484
202 Ga0207661_10344212 3300025944 Bacteria 1344
203 Ga0207679_10034515 3300025945 Bacteria 3570
204 Ga0207667_11656072 3300025949 Bacteria 607
205 Ga0207651_10516533 3300025960 Bacteria 1034
206 Ga0207712_10798908 3300025961 Bacteria 829
207 Ga0207640_10725331 3300025981 Bacteria 855
208 Ga0207658_11187776 3300025986 Bacteria 697
209 Ga0207658_11337065 3300025986 Bacteria 655
210 Ga0207677_10528417 3300026023 Unclassified 1024
211 Ga0207703_10011720 3300026035 Bacteria 6823
212 Ga0207678_11629464 3300026067 Bacteria 568
213 Ga0207678_11970288 3300026067 Bacteria 509
214 Ga0207708_10374917 3300026075 Bacteria 1172
215 Ga0207708_10647384 3300026075 Bacteria 899
216 Ga0207641_10028761 3300026088 Bacteria 4595
217 Ga0207648_10080380 3300026089 Unclassified 2844
218 Ga0207676_10031582 3300026095 Bacteria 3983
219 Ga0207676_12104531 3300026095 Bacteria 563
220 Ga0207674_10643107 3300026116 Unclassified 1024
221 Ga0207675_100010567 3300026118 Bacteria 8649
222 Ga0207675_100403095 3300026118 Unclassified 1348
223 Ga0207683_10340027 3300026121 Bacteria 1376
224 Ga0207698_10349695 3300026142 Bacteria 1396
225 Ga0209968_1048411 3300027526 Bacteria 735
226 Ga0209966_1043387 3300027695 Bacteria 943
227 Ga0207428_10843814 3300027907 Bacteria 649
228 Ga0268266_10414282 3300028379 Bacteria 1276
229 Ga0268266_10751968 3300028379 Bacteria 941
230 Ga0268266_11584090 3300028379 Unclassified 630
231 Ga0268265_10068298 3300028380 Bacteria 2755
232 Ga0268265_10121231 3300028380 Unclassified 2155
233 Ga0268264_10037141 3300028381 Bacteria 4015
234 Ga0265338_10025332 3300028800 Bacteria 6025
235 Ga0265332_10191783 3300031238 Bacteria 850
236 Ga0265325_10000083 3300031241 Bacteria 66086
237 Ga0265325_10031648 3300031241 Bacteria 2829
238 Ga0265339_10001775 3300031249 Bacteria 15873
239 Ga0265339_10522401 3300031249 Unclassified 547
240 Ga0265316_10043574 3300031344 Bacteria 3575
241 Ga0307408_100290664 3300031548 Unclassified 1365
242 Ga0307408_100667418 3300031548 Bacteria 931
243 Ga0307408_102494230 3300031548 Bacteria 503
244 Ga0265313_10003229 3300031595 Bacteria 13400
245 Ga0307413_11220411 3300031824 Bacteria 655
246 Ga0307413_11927717 3300031824 Bacteria 531
247 Ga0307413_11992980 3300031824 Bacteria 523
248 Ga0307410_10077989 3300031852 Bacteria 2318
249 Ga0307410_10593165 3300031852 Bacteria 923
250 Ga0307409_101741594 3300031995 Bacteria 652
251 Ga0307416_102472787 3300032002 Bacteria 618
252 Ga0307414_10322921 3300032004 Bacteria 1315
253 Ga0307414_11702101 3300032004 Bacteria 588
254 Ga0307411_10045829 3300032005 Bacteria 2815
255 Ga0307415_100329518 3300032126 Bacteria 1277
256 Ga0307415_100532455 3300032126 Bacteria 1033
257 Ga0373923_0221838 3300035111 Unclassified 879
258 Ga0373923_0678696 3300035111 Bacteria 511
259 Ga0373953_0327728 3300035117 Bacteria 670
260 Ga0373955_0363725 3300035172 Bacteria 877
261 Ga0373962_0394418 3300035242 Unclassified 508
262 Ga0373931_0222297 3300035691 Unclassified 1137
263 Ga0373933_0048767 3300035724 Bacteria 2523
264 Ga0373933_0356227 3300035724 Bacteria 951
265 Ga0373947_0839403 3300035725 Archaea 627
266 Ga0373937_0246543 3300036401 Bacteria 1684
267 Ga0373937_0931553 3300036401 Bacteria 817
268 Ga0373925_0663240 3300037068 Bacteria 860
269 Ga0436364_0580480 3300037853 Bacteria 889
270 Ga0436364_1080877 3300037853 Unclassified 739
271 Ga0436365_1457679 3300039437 Bacteria 694
272 Ga0436365_1495687 3300039437 Unclassified 880
273 Ga0439447_126517 3300041407 Bacteria 586
274 Ga0439465_0324687 3300041413 Bacteria 579
275 Ga0451789_0387878 3300041443 Bacteria 630
276 Ga0451800_0305102 3300041459 Bacteria 584
277 Ga0439441_115134 3300042001 Bacteria 613
278 Ga0450917_005447 3300042120 Bacteria 947
279 Ga0450896_040783 3300042133 Bacteria 722
280 Ga0450896_064753 3300042133 Bacteria 599
281 Ga0439435_0006276 3300042436 Bacteria 2665
282 Ga0439435_0262448 3300042436 Bacteria 584
283 Ga0450916_010195 3300042530 Bacteria 1171
284 Ga0466963_0232091 3300044694 Unclassified 1293
285 Ga0451576_0041440 3300045051 Bacteria 4868
286 Ga0466967_0206335 3300045976 Bacteria 1863
287 Ga0495603_0174347 3300046455 Bacteria 1245
288 Ga0495650_0001810 3300046471 Bacteria 19245
289 Ga0495580_0043277 3300046472 Bacteria 3205
290 Ga0495580_0253051 3300046472 Archaea 1206
291 Ga0495594_0005246 3300046499 Bacteria 6663
292 Ga0495586_0364964 3300046535 Bacteria 830
293 Ga0495659_0180963 3300046664 Bacteria 858
294 Ga0495588_0008308 3300046674 Bacteria 4757
295 Ga0495636_0251689 3300047318 Unclassified 817
296 Ga0496100_0148365 3300048903 Bacteria 1670
297 Ga0496102_1039328 3300048905 Bacteria 739
298 Ga0496104_0555943 3300048907 Bacteria 1058
299 Ga0496106_0420515 3300048909 Bacteria 1074
300 Ga0496107_0420963 3300048910 Bacteria 993
301 Ga0496109_0040582 3300048912 Bacteria 4215
302 Ga0496112_0422089 3300048915 Bacteria 1272
303 Ga0496113_0430839 3300048916 Bacteria 1059
304 Ga0496114_0014840 3300048917 Bacteria 6261
305 Ga0496115_0084414 3300048918 Bacteria 2589
306 Ga0501036_1343948 3300049572 Bacteria 580
307 Ga0501040_0705580 3300049576 Bacteria 730
308 Ga0501040_1003773 3300049576 Bacteria 605
309 Ga0501041_0383921 3300049577 Bacteria 889
310 Ga0501048_0631228 3300049582 Bacteria 769
311 Ga0501068_0492570 3300049584 Bacteria 795
312 Ga0501071_0144917 3300049587 Bacteria 1770
313 Ga0501071_0888214 3300049587 Bacteria 688
314 Ga0501072_0449967 3300049588 Bacteria 1020
315 Ga0501072_0607942 3300049588 Bacteria 862
316 Ga0501072_0714448 3300049588 Unclassified 787
317 Ga0501075_0223616 3300049591 Bacteria 1436
318 Ga0501076_0851747 3300049592 Bacteria 752
319 Ga0501081_0593267 3300049743 Bacteria 829
320 Ga0501081_1122034 3300049743 Bacteria 595
321 Ga0501083_0023993 3300049744 Bacteria 4229
322 nmdc:mga05p37_102180_c1 3300050507 Bacteria 3530
323 nmdc:mga0qj67_109124_c1 3300050509 Bacteria 2233
324 nmdc:mga0qj67_505560_c1 3300050509 Bacteria 971
325 nmdc:mga06r32_170912_c1 3300050510 Bacteria 2157
326 nmdc:mga08y16_214962_c1 3300050511 Bacteria 1991
327 nmdc:mga0n895_1169733_c1 3300050512 Bacteria 744
328 nmdc:mga0rr50_1408610_c1 3300050513 Bacteria 590
329 nmdc:mga0rr50_1743615_c1 3300050513 Bacteria 524
330 nmdc:mga0a205_819516_c1 3300050515 Bacteria 778
331 nmdc:mga0a205_9961_c1 3300050515 Bacteria 7439
332 Ga0501084_1448671 3300054114 Bacteria 575

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005293 Ga0065715_10383402 Ga0065715_103834022 68
2 3300005547 Ga0070693_100075603 Ga0070693_1000756033 68
3 3300005548 Ga0070665_101876313 Ga0070665_1018763131 68
4 3300013308 Ga0157375_12228628 Ga0157375_122286281 68
5 3300028379 Ga0268266_11584090 Ga0268266_115840902 68
6 3300031241 Ga0265325_10031648 Ga0265325_100316483 68
7 3300031249 Ga0265339_10522401 Ga0265339_105224012 68
8 3300037853 Ga0436364_0580480 Ga0436364_0580480_184_390 68
9 3300039437 Ga0436365_1495687 Ga0436365_1495687_46_255 68
10 3300005328 Ga0070676_10448327 Ga0070676_104483272 69
11 3300005548 Ga0070665_100394382 Ga0070665_1003943822 69
12 3300009098 Ga0105245_11709535 Ga0105245_117095351 69
13 3300014326 Ga0157380_10688901 Ga0157380_106889013 69
14 3300025949 Ga0207667_11656072 Ga0207667_116560722 69
15 3300028379 Ga0268266_10751968 Ga0268266_107519682 69
16 3300028800 Ga0265338_10025332 Ga0265338_100253322 69
17 3300031238 Ga0265332_10191783 Ga0265332_101917832 69
18 3300031241 Ga0265325_10000083 Ga0265325_1000008349 69
19 3300031249 Ga0265339_10001775 Ga0265339_100017754 69
20 3300031344 Ga0265316_10043574 Ga0265316_100435743 69
21 3300031595 Ga0265313_10003229 Ga0265313_1000322910 69
22 3300037853 Ga0436364_1080877 Ga0436364_1080877_114_323 69
23 3300049587 Ga0501071_0888214 Ga0501071_0888214_372_584 69
24 3300009094 Ga0111539_12448795 Ga0111539_124487952 70
25 3300010375 Ga0105239_12602539 Ga0105239_126025392 70
26 3300025937 Ga0207669_11320422 Ga0207669_113204222 70
27 3300026121 Ga0207683_10340027 Ga0207683_103400272 70
28 iso_pu_bacteria 2524023250 2524609832 70
29 3300005337 Ga0070682_100033775 Ga0070682_1000337753 71
30 3300005471 Ga0070698_100593626 Ga0070698_1005936263 71
31 3300009098 Ga0105245_10395538 Ga0105245_103955383 71
32 3300013297 Ga0157378_11426279 Ga0157378_114262792 71
33 3300031824 Ga0307413_11927717 Ga0307413_119277171 71
34 3300032004 Ga0307414_11702101 Ga0307414_117021012 71
35 3300042001 Ga0439441_115134 Ga0439441_115134_233_451 71
36 3300042120 Ga0450917_005447 Ga0450917_005447_259_477 71
37 3300042133 Ga0450896_064753 Ga0450896_064753_201_419 71
38 3300042436 Ga0439435_0006276 Ga0439435_0006276_919_1137 71
39 3300042530 Ga0450916_010195 Ga0450916_010195_16_234 71
40 3300049576 Ga0501040_0705580 Ga0501040_0705580_238_456 71
41 3300049743 Ga0501081_0593267 Ga0501081_0593267_274_492 71
42 3300005328 Ga0070676_10411732 Ga0070676_104117322 72
43 3300005335 Ga0070666_10071454 Ga0070666_100714541 72
44 3300005353 Ga0070669_100054858 Ga0070669_1000548582 72
45 3300005354 Ga0070675_101403541 Ga0070675_1014035412 72
46 3300005356 Ga0070674_100001209 Ga0070674_10000120912 72
47 3300005356 Ga0070674_101191721 Ga0070674_1011917211 72
48 3300005455 Ga0070663_100297340 Ga0070663_1002973402 72
49 3300005459 Ga0068867_101226928 Ga0068867_1012269282 72
50 3300005543 Ga0070672_100968670 Ga0070672_1009686702 72
51 3300005577 Ga0068857_100806358 Ga0068857_1008063582 72
52 3300005719 Ga0068861_100181208 Ga0068861_1001812082 72
53 3300006846 Ga0075430_100510359 Ga0075430_1005103591 72
54 3300006847 Ga0075431_100135775 Ga0075431_1001357752 72
55 3300009176 Ga0105242_12244559 Ga0105242_122445592 72
56 3300013308 Ga0157375_13821017 Ga0157375_138210171 72
57 3300014326 Ga0157380_10001387 Ga0157380_1000138711 72
58 3300014326 Ga0157380_10065923 Ga0157380_100659235 72
59 3300014326 Ga0157380_10854700 Ga0157380_108547003 72
60 3300014745 Ga0157377_10945696 Ga0157377_109456962 72
61 3300025893 Ga0207682_10302862 Ga0207682_103028622 72
62 3300025903 Ga0207680_10028339 Ga0207680_100283395 72
63 3300025907 Ga0207645_10024514 Ga0207645_100245144 72
64 3300025926 Ga0207659_11423527 Ga0207659_114235271 72
65 3300025933 Ga0207706_10063849 Ga0207706_100638493 72
66 3300025937 Ga0207669_10001685 Ga0207669_100016855 72
67 3300025940 Ga0207691_10672310 Ga0207691_106723102 72
68 3300025986 Ga0207658_11337065 Ga0207658_113370652 72
69 3300026067 Ga0207678_11970288 Ga0207678_119702882 72
70 3300026116 Ga0207674_10643107 Ga0207674_106431072 72
71 3300026118 Ga0207675_100403095 Ga0207675_1004030952 72
72 3300041459 Ga0451800_0305102 Ga0451800_0305102_350_571 72
73 3300044694 Ga0466963_0232091 Ga0466963_0232091_756_983 72
74 3300045976 Ga0466967_0206335 Ga0466967_0206335_164_391 72
75 3300046472 Ga0495580_0043277 Ga0495580_0043277_2091_2309 72
76 3300049584 Ga0501068_0492570 Ga0501068_0492570_118_345 72
77 3300049588 Ga0501072_0714448 Ga0501072_0714448_432_653 72
78 3300050509 nmdc:mga0qj67_505560_c1 nmdc:mga0qj67_505560_c1_689_910 72
79 3300050510 nmdc:mga06r32_170912_c1 nmdc:mga06r32_170912_c1_513_734 72
80 3300005536 Ga0070697_101143838 Ga0070697_1011438381 73
81 3300014326 Ga0157380_10055125 Ga0157380_100551254 73
82 3300031824 Ga0307413_11992980 Ga0307413_119929801 73
83 3300032004 Ga0307414_10322921 Ga0307414_103229212 73
84 3300032126 Ga0307415_100329518 Ga0307415_1003295183 73
85 3300032126 Ga0307415_100532455 Ga0307415_1005324552 73
86 3300035172 Ga0373955_0363725 Ga0373955_0363725_337_561 73
87 3300035724 Ga0373933_0356227 Ga0373933_0356227_588_812 73
88 3300036401 Ga0373937_0931553 Ga0373937_0931553_152_376 73
89 3300041413 Ga0439465_0324687 Ga0439465_0324687_270_500 73
90 3300046471 Ga0495650_0001810 Ga0495650_0001810_5651_5875 73
91 3300005331 Ga0070670_100306371 Ga0070670_1003063714 74
92 3300005331 Ga0070670_100842456 Ga0070670_1008424562 74
93 3300005338 Ga0068868_100481583 Ga0068868_1004815832 74
94 3300005356 Ga0070674_101774812 Ga0070674_1017748122 74
95 3300005436 Ga0070713_100800969 Ga0070713_1008009692 74
96 3300005457 Ga0070662_101532365 Ga0070662_1015323651 74
97 3300005535 Ga0070684_100342701 Ga0070684_1003427012 74
98 3300005549 Ga0070704_100059858 Ga0070704_1000598584 74
99 3300005719 Ga0068861_102140307 Ga0068861_1021403072 74
100 3300005843 Ga0068860_101416318 Ga0068860_1014163182 74
101 3300006844 Ga0075428_100003744 Ga0075428_10000374414 74
102 3300006871 Ga0075434_101259301 Ga0075434_1012593012 74
103 3300009147 Ga0114129_10254350 Ga0114129_102543503 74
104 3300009551 Ga0105238_10951754 Ga0105238_109517542 74
105 3300013296 Ga0157374_11325561 Ga0157374_113255612 74
106 3300025924 Ga0207694_10631696 Ga0207694_106316962 74
107 3300025925 Ga0207650_10692067 Ga0207650_106920672 74
108 3300025937 Ga0207669_11106839 Ga0207669_111068392 74
109 3300025944 Ga0207661_10282439 Ga0207661_102824392 74
110 3300026023 Ga0207677_10528417 Ga0207677_105284172 74
111 3300026095 Ga0207676_12104531 Ga0207676_121045311 74
112 3300027907 Ga0207428_10843814 Ga0207428_108438141 74
113 3300035111 Ga0373923_0678696 Ga0373923_0678696_121_348 74
114 3300035724 Ga0373933_0048767 Ga0373933_0048767_2164_2391 74
115 3300041443 Ga0451789_0387878 Ga0451789_0387878_110_337 74
116 3300046535 Ga0495586_0364964 Ga0495586_0364964_104_331 74
117 3300050507 nmdc:mga05p37_102180_c1 nmdc:mga05p37_102180_c1_2206_2433 74
118 3300050512 nmdc:mga0n895_1169733_c1 nmdc:mga0n895_1169733_c1_80_307 74
119 iso_pu_bacteria 2643221580 2643910573 74
120 3300005329 Ga0070683_100084124 Ga0070683_1000841244 75
121 3300005331 Ga0070670_100005278 Ga0070670_1000052785 75
122 3300005334 Ga0068869_102124770 Ga0068869_1021247701 75
123 3300005336 Ga0070680_100488046 Ga0070680_1004880462 75
124 3300005338 Ga0068868_100011740 Ga0068868_1000117402 75
125 3300005340 Ga0070689_100005941 Ga0070689_1000059413 75
126 3300005343 Ga0070687_100241247 Ga0070687_1002412472 75
127 3300005344 Ga0070661_100013927 Ga0070661_1000139272 75
128 3300005354 Ga0070675_100434749 Ga0070675_1004347492 75
129 3300005355 Ga0070671_100014501 Ga0070671_1000145016 75
130 3300005364 Ga0070673_100592807 Ga0070673_1005928071 75
131 3300005367 Ga0070667_100022610 Ga0070667_1000226104 75
132 3300005367 Ga0070667_101897888 Ga0070667_1018978881 75
133 3300005436 Ga0070713_100026370 Ga0070713_1000263704 75
134 3300005436 Ga0070713_100184202 Ga0070713_1001842024 75
135 3300005439 Ga0070711_100381223 Ga0070711_1003812231 75
136 3300005456 Ga0070678_100131515 Ga0070678_1001315151 75
137 3300005466 Ga0070685_10805065 Ga0070685_108050652 75
138 3300005535 Ga0070684_100104576 Ga0070684_1001045762 75
139 3300005544 Ga0070686_100043176 Ga0070686_1000431763 75
140 3300005547 Ga0070693_100625905 Ga0070693_1006259052 75
141 3300005548 Ga0070665_100233204 Ga0070665_1002332043 75
142 3300005549 Ga0070704_100754955 Ga0070704_1007549552 75
143 3300005564 Ga0070664_100006275 Ga0070664_1000062754 75
144 3300005614 Ga0068856_100645329 Ga0068856_1006453293 75
145 3300005614 Ga0068856_100690470 Ga0068856_1006904702 75
146 3300005616 Ga0068852_100560500 Ga0068852_1005605002 75
147 3300005617 Ga0068859_100006784 Ga0068859_1000067848 75
148 3300005618 Ga0068864_100013838 Ga0068864_1000138384 75
149 3300005719 Ga0068861_101413346 Ga0068861_1014133462 75
150 3300005840 Ga0068870_11224676 Ga0068870_112246761 75
151 3300005841 Ga0068863_100038671 Ga0068863_1000386715 75
152 3300005842 Ga0068858_100017853 Ga0068858_1000178538 75
153 3300006358 Ga0068871_100095654 Ga0068871_1000956541 75
154 3300006871 Ga0075434_102316149 Ga0075434_1023161492 75
155 3300006931 Ga0097620_100006782 Ga0097620_1000067828 75
156 3300009093 Ga0105240_10162357 Ga0105240_101623574 75
157 3300009093 Ga0105240_10549272 Ga0105240_105492723 75
158 3300009098 Ga0105245_10006867 Ga0105245_100068672 75
159 3300009101 Ga0105247_10006049 Ga0105247_100060493 75
160 3300009101 Ga0105247_10728773 Ga0105247_107287732 75
161 3300009148 Ga0105243_10246362 Ga0105243_102463623 75
162 3300009174 Ga0105241_12158106 Ga0105241_121581061 75
163 3300009176 Ga0105242_10559676 Ga0105242_105596762 75
164 3300009176 Ga0105242_11391550 Ga0105242_113915502 75
165 3300009177 Ga0105248_10029086 Ga0105248_100290861 75
166 3300009177 Ga0105248_13288733 Ga0105248_132887332 75
167 3300009545 Ga0105237_10439173 Ga0105237_104391732 75
168 3300009551 Ga0105238_10091126 Ga0105238_100911264 75
169 3300009553 Ga0105249_10395573 Ga0105249_103955732 75
170 3300010375 Ga0105239_10027265 Ga0105239_100272652 75
171 3300011119 Ga0105246_10018263 Ga0105246_100182634 75
172 3300013296 Ga0157374_10014754 Ga0157374_100147545 75
173 3300013296 Ga0157374_10364373 Ga0157374_103643732 75
174 3300013297 Ga0157378_10976348 Ga0157378_109763482 75
175 3300013306 Ga0163162_10005267 Ga0163162_1000526712 75
176 3300013307 Ga0157372_10640778 Ga0157372_106407782 75
177 3300013308 Ga0157375_10021411 Ga0157375_100214114 75
178 3300014325 Ga0163163_10003654 Ga0163163_100036542 75
179 3300014745 Ga0157377_10082731 Ga0157377_100827313 75
180 3300014968 Ga0157379_10017962 Ga0157379_100179624 75
181 3300014968 Ga0157379_10578804 Ga0157379_105788042 75
182 3300014969 Ga0157376_11094229 Ga0157376_110942292 75
183 3300025321 Ga0207656_10385955 Ga0207656_103859552 75
184 3300025900 Ga0207710_10171183 Ga0207710_101711831 75
185 3300025900 Ga0207710_10591344 Ga0207710_105913442 75
186 3300025903 Ga0207680_10319684 Ga0207680_103196842 75
187 3300025906 Ga0207699_11225564 Ga0207699_112255642 75
188 3300025913 Ga0207695_10614434 Ga0207695_106144342 75
189 3300025916 Ga0207663_10917583 Ga0207663_109175831 75
190 3300025917 Ga0207660_10888996 Ga0207660_108889962 75
191 3300025918 Ga0207662_10183924 Ga0207662_101839242 75
192 3300025920 Ga0207649_10013999 Ga0207649_100139992 75
193 3300025924 Ga0207694_10832388 Ga0207694_108323881 75
194 3300025925 Ga0207650_10474648 Ga0207650_104746481 75
195 3300025927 Ga0207687_10022209 Ga0207687_100222091 75
196 3300025928 Ga0207700_10293075 Ga0207700_102930752 75
197 3300025929 Ga0207664_10014937 Ga0207664_100149376 75
198 3300025931 Ga0207644_10009273 Ga0207644_100092732 75
199 3300025935 Ga0207709_10296681 Ga0207709_102966812 75
200 3300025936 Ga0207670_10006944 Ga0207670_100069446 75
201 3300025940 Ga0207691_10353510 Ga0207691_103535101 75
202 3300025941 Ga0207711_10011713 Ga0207711_100117132 75
203 3300025944 Ga0207661_10344212 Ga0207661_103442122 75
204 3300025945 Ga0207679_10034515 Ga0207679_100345153 75
205 3300025960 Ga0207651_10516533 Ga0207651_105165331 75
206 3300025986 Ga0207658_11187776 Ga0207658_111877762 75
207 3300026035 Ga0207703_10011720 Ga0207703_100117205 75
208 3300026067 Ga0207678_11629464 Ga0207678_116294641 75
209 3300026088 Ga0207641_10028761 Ga0207641_100287612 75
210 3300026095 Ga0207676_10031582 Ga0207676_100315822 75
211 3300026142 Ga0207698_10349695 Ga0207698_103496952 75
212 3300028379 Ga0268266_10414282 Ga0268266_104142823 75
213 3300028381 Ga0268264_10037141 Ga0268264_100371414 75
214 3300035111 Ga0373923_0221838 Ga0373923_0221838_81_311 75
215 3300035117 Ga0373953_0327728 Ga0373953_0327728_197_427 75
216 3300035242 Ga0373962_0394418 Ga0373962_0394418_163_393 75
217 3300035691 Ga0373931_0222297 Ga0373931_0222297_856_1086 75
218 3300036401 Ga0373937_0246543 Ga0373937_0246543_901_1131 75
219 3300037068 Ga0373925_0663240 Ga0373925_0663240_263_493 75
220 3300045051 Ga0451576_0041440 Ga0451576_0041440_2991_3221 75
221 3300048903 Ga0496100_0148365 Ga0496100_0148365_219_449 75
222 3300048905 Ga0496102_1039328 Ga0496102_1039328_432_662 75
223 3300048907 Ga0496104_0555943 Ga0496104_0555943_171_401 75
224 3300048909 Ga0496106_0420515 Ga0496106_0420515_123_353 75
225 3300048910 Ga0496107_0420963 Ga0496107_0420963_413_643 75
226 3300048912 Ga0496109_0040582 Ga0496109_0040582_3872_4102 75
227 3300048915 Ga0496112_0422089 Ga0496112_0422089_277_507 75
228 3300048916 Ga0496113_0430839 Ga0496113_0430839_186_416 75
229 3300048917 Ga0496114_0014840 Ga0496114_0014840_2121_2351 75
230 3300048918 Ga0496115_0084414 Ga0496115_0084414_536_766 75
231 3300049576 Ga0501040_1003773 Ga0501040_1003773_286_516 75
232 3300049587 Ga0501071_0144917 Ga0501071_0144917_632_862 75
233 3300049588 Ga0501072_0449967 Ga0501072_0449967_228_458 75
234 3300049591 Ga0501075_0223616 Ga0501075_0223616_281_511 75
235 3300049592 Ga0501076_0851747 Ga0501076_0851747_423_653 75
236 3300054114 Ga0501084_1448671 Ga0501084_1448671_167_400 75
237 3300005288 Ga0065714_10493955 Ga0065714_104939551 76
238 3300005347 Ga0070668_100804872 Ga0070668_1008048722 76
239 3300005617 Ga0068859_100683133 Ga0068859_1006831332 76
240 3300005844 Ga0068862_100299980 Ga0068862_1002999802 76
241 3300005937 Ga0081455_10399578 Ga0081455_103995782 76
242 3300006846 Ga0075430_100119792 Ga0075430_1001197922 76
243 3300006852 Ga0075433_10405803 Ga0075433_104058032 76
244 3300006880 Ga0075429_100063079 Ga0075429_1000630794 76
245 3300006931 Ga0097620_100683087 Ga0097620_1006830872 76
246 3300009094 Ga0111539_10024584 Ga0111539_100245845 76
247 3300009094 Ga0111539_10458872 Ga0111539_104588722 76
248 3300014326 Ga0157380_10713685 Ga0157380_107136852 76
249 3300025917 Ga0207660_10667702 Ga0207660_106677021 76
250 3300025938 Ga0207704_10663776 Ga0207704_106637762 76
251 3300025942 Ga0207689_11198000 Ga0207689_111980002 76
252 3300027526 Ga0209968_1048411 Ga0209968_10484112 76
253 3300028380 Ga0268265_10121231 Ga0268265_101212312 76
254 3300031548 Ga0307408_100290664 Ga0307408_1002906643 76
255 3300031548 Ga0307408_100667418 Ga0307408_1006674182 76
256 3300031548 Ga0307408_102494230 Ga0307408_1024942301 76
257 3300032002 Ga0307416_102472787 Ga0307416_1024727872 76
258 3300035725 Ga0373947_0839403 Ga0373947_0839403_175_411 76
259 3300039437 Ga0436365_1457679 Ga0436365_1457679_13_249 76
260 3300042436 Ga0439435_0262448 Ga0439435_0262448_322_558 76
261 3300046455 Ga0495603_0174347 Ga0495603_0174347_102_338 76
262 3300046472 Ga0495580_0253051 Ga0495580_0253051_669_905 76
263 3300046499 Ga0495594_0005246 Ga0495594_0005246_5050_5286 76
264 3300046664 Ga0495659_0180963 Ga0495659_0180963_46_282 76
265 3300046674 Ga0495588_0008308 Ga0495588_0008308_4339_4575 76
266 3300049577 Ga0501041_0383921 Ga0501041_0383921_223_456 76
267 3300050509 nmdc:mga0qj67_109124_c1 nmdc:mga0qj67_109124_c1_400_639 76
268 3300050511 nmdc:mga08y16_214962_c1 nmdc:mga08y16_214962_c1_467_706 76
269 3300050515 nmdc:mga0a205_819516_c1 nmdc:mga0a205_819516_c1_243_482 76
270 3300005336 Ga0070680_100090669 Ga0070680_1000906693 77
271 3300005343 Ga0070687_100119887 Ga0070687_1001198873 77
272 3300005365 Ga0070688_101075513 Ga0070688_1010755131 77
273 3300005406 Ga0070703_10080113 Ga0070703_100801132 77
274 3300005438 Ga0070701_10057008 Ga0070701_100570082 77
275 3300005441 Ga0070700_100473282 Ga0070700_1004732822 77
276 3300005441 Ga0070700_100676759 Ga0070700_1006767592 77
277 3300005444 Ga0070694_100132252 Ga0070694_1001322522 77
278 3300005458 Ga0070681_11288302 Ga0070681_112883022 77
279 3300005459 Ga0068867_100763965 Ga0068867_1007639652 77
280 3300005545 Ga0070695_100343807 Ga0070695_1003438072 77
281 3300005545 Ga0070695_100410787 Ga0070695_1004107872 77
282 3300005549 Ga0070704_100756346 Ga0070704_1007563462 77
283 3300005578 Ga0068854_100844913 Ga0068854_1008449132 77
284 3300005718 Ga0068866_10727900 Ga0068866_107279002 77
285 3300005719 Ga0068861_100164787 Ga0068861_1001647873 77
286 3300005844 Ga0068862_100038370 Ga0068862_1000383703 77
287 3300006852 Ga0075433_10033349 Ga0075433_100333492 77
288 3300006881 Ga0068865_100600226 Ga0068865_1006002262 77
289 3300009094 Ga0111539_10406382 Ga0111539_104063822 77
290 3300009148 Ga0105243_10333714 Ga0105243_103337143 77
291 3300009553 Ga0105249_10611837 Ga0105249_106118373 77
292 3300014326 Ga0157380_10216188 Ga0157380_102161882 77
293 3300025917 Ga0207660_10035228 Ga0207660_100352283 77
294 3300025918 Ga0207662_10063402 Ga0207662_100634022 77
295 3300025933 Ga0207706_10624915 Ga0207706_106249152 77
296 3300025935 Ga0207709_10307526 Ga0207709_103075263 77
297 3300025938 Ga0207704_10537748 Ga0207704_105377482 77
298 3300025942 Ga0207689_11416974 Ga0207689_114169742 77
299 3300025961 Ga0207712_10798908 Ga0207712_107989082 77
300 3300025981 Ga0207640_10725331 Ga0207640_107253312 77
301 3300026075 Ga0207708_10374917 Ga0207708_103749172 77
302 3300026075 Ga0207708_10647384 Ga0207708_106473842 77
303 3300026089 Ga0207648_10080380 Ga0207648_100803803 77
304 3300026118 Ga0207675_100010567 Ga0207675_1000105672 77
305 3300027695 Ga0209966_1043387 Ga0209966_10433872 77
306 3300028380 Ga0268265_10068298 Ga0268265_100682983 77
307 3300050515 nmdc:mga0a205_9961_c1 nmdc:mga0a205_9961_c1_6034_6276 77
308 3300005445 Ga0070708_100339393 Ga0070708_1003393932 78
309 3300005457 Ga0070662_100236417 Ga0070662_1002364173 78
310 3300005466 Ga0070685_10481885 Ga0070685_104818852 78
311 3300005543 Ga0070672_101604729 Ga0070672_1016047292 78
312 3300025925 Ga0207650_10534849 Ga0207650_105348493 78
313 3300025942 Ga0207689_10112380 Ga0207689_101123803 78
314 3300031824 Ga0307413_11220411 Ga0307413_112204112 78
315 3300031852 Ga0307410_10077989 Ga0307410_100779893 78
316 3300031852 Ga0307410_10593165 Ga0307410_105931652 78
317 3300031995 Ga0307409_101741594 Ga0307409_1017415942 78
318 3300032005 Ga0307411_10045829 Ga0307411_100458292 78
319 3300041407 Ga0439447_126517 Ga0439447_126517_283_525 78
320 3300042133 Ga0450896_040783 Ga0450896_040783_385_627 78
321 3300049582 Ga0501048_0631228 Ga0501048_0631228_428_670 78
322 3300049588 Ga0501072_0607942 Ga0501072_0607942_291_533 78
323 3300049743 Ga0501081_1122034 Ga0501081_1122034_152_394 78
324 2162886012 MBSR1b_contig_4379583 MBSR1b_0456.00001820 79
325 3300005444 Ga0070694_100993770 Ga0070694_1009937702 79
326 3300005445 Ga0070708_100104216 Ga0070708_1001042164 79
327 3300005546 Ga0070696_100682763 Ga0070696_1006827632 79
328 3300005549 Ga0070704_100787329 Ga0070704_1007873292 79
329 3300025910 Ga0207684_11068094 Ga0207684_110680942 79
330 3300047318 Ga0495636_0251689 Ga0495636_0251689_172_414 79
331 3300049572 Ga0501036_1343948 Ga0501036_1343948_222_464 79
332 3300049744 Ga0501083_0023993 Ga0501083_0023993_3624_3875 79
333 3300050513 nmdc:mga0rr50_1408610_c1 nmdc:mga0rr50_1408610_c1_15_254 79
334 3300050513 nmdc:mga0rr50_1743615_c1 nmdc:mga0rr50_1743615_c1_245_487 79

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01381

HTH_3

Helix-turn-helix

12

67

0.91

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

11

72

0.91

PF13560

HTH_31

Helix-turn-helix domain

9

69

0.9

PF12844

HTH_19

Helix-turn-helix domain

9

73

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xj3-assembly1.cif.gz_A high resolution structure of the t55c mutant of cylr2. 0.9475 5 67
2xi8-assembly1.cif.gz_A high resolution structure of native cylr2 0.9466 5 67
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9414 9 61
1x57-assembly1.cif.gz_A solution structures of the hth domain of human edf-1 protein 0.9398 9 57
3u3w-assembly1.cif.gz_B crystal structure of bacillus thuringiensis plcr in complex with the peptide papr7 and dna 0.9361 9 61
ID Description Score Start End Superfamily
af_Q57720_1_65_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.975 6 67 1.10.260.40
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9414 9 61 1.10.260.40
1x57A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9398 9 57 1.10.260.40
3u3wB01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9361 9 61 1.10.260.40
af_Q58006_80_170_1.10.260.40 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9318 9 61 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A6C1PC08-F1-model_v4 Transcriptional regulator 1.01 6 67 GO:0003677
AF-A0A6S6FY68-F1-model_v4 XRE family transcriptional regulator 1.009 5 69 GO:0003677
AF-A0A1I0DGC6-F1-model_v4 Putative transcriptional regulator 1.008 5 67 GO:0003677
AF-A0A5C6TS33-F1-model_v4 Helix-turn-helix transcriptional regulator 1.007 5 67 GO:0003677
AF-A0A7Y8IAC0-F1-model_v4 Helix-turn-helix transcriptional regulator 1.007 5 65 GO:0003677

Feature Viewer

pLDDT pTM Quality
88.25 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map