F411739

General Info

Members Datasets Scaffolds Average Seq Length
334 227 668 154

Family's Representative Sequence

Representative Sequence 3300006880|Ga0075429_100054000|Ga0075429_1000540004
Length 187
Sequence MVLRQLTPRPSREATVPRVTAGVGPTSGARIIMVERKPAVAKKAAKPRKTAPKSRSLLAGGNPQIAKADGDAPVQAYIAAMPGWKRDVGRRLDALIVRTVPGVRKAVKWNSPFYGVEGQGWFLGIHCFTKYVKLAFFRGTSLRPVPLGESKDKNTRYLDIHEDDKLDEAQLAAWVKQASQLPGWGKA

Samples

Sample ID Description Type Environment
1 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
47 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
48 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
109 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
110 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
115 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
116 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
117 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
118 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
119 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
120 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
121 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
122 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
123 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
126 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
127 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
128 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
131 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
132 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
133 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
136 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
142 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
143 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
144 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
145 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
146 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
147 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
159 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
166 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
171 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
172 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
173 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
174 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
175 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
176 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
181 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
182 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
183 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
184 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
185 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
186 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
189 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
190 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
191 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
192 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
193 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
194 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
195 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
198 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
199 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
200 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
201 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
202 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
203 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
204 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
205 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
206 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
207 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
208 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
209 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
210 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
211 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
212 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
213 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
214 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
215 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
216 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
217 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
218 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
219 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
220 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
221 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
222 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
223 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
224 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
225 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
226 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
227 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 91.02
Metatranscriptomes 0
Isolates 8.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.47
Nodule 8.08
Rhizoplane 4.19
Rhizosphere 69.76
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075429_100054000 3300006880 Bacteria 3495
2 JGI24737J22298_10132520 3300001990 Bacteria 736
3 JGI25406J46586_10026018 3300003203 Bacteria 2263
4 JGI25404J52841_10014302 3300003659 Bacteria 1721
5 Ga0070658_10685841 3300005327 Bacteria 889
6 Ga0070658_11125241 3300005327 Bacteria 683
7 Ga0070683_100239551 3300005329 Bacteria 1725
8 Ga0070670_101223293 3300005331 Bacteria 687
9 Ga0068869_100009913 3300005334 Bacteria 6190
10 Ga0068869_100117833 3300005334 Bacteria 2027
11 Ga0068869_100206665 3300005334 Bacteria 1551
12 Ga0068868_100387355 3300005338 Bacteria 1204
13 Ga0070689_100021234 3300005340 Bacteria 4830
14 Ga0070689_100378529 3300005340 Bacteria 1192
15 Ga0070687_100343800 3300005343 Bacteria 961
16 Ga0070668_100041923 3300005347 Bacteria 3507
17 Ga0070668_100370551 3300005347 Bacteria 1216
18 Ga0070668_100480696 3300005347 Bacteria 1072
19 Ga0070669_100273734 3300005353 Bacteria 1351
20 Ga0070671_101356047 3300005355 Bacteria 628
21 Ga0070673_100989923 3300005364 Bacteria 782
22 Ga0070688_100369193 3300005365 Bacteria 1055
23 Ga0070659_100176047 3300005366 Bacteria 1754
24 Ga0070667_100263959 3300005367 Bacteria 1542
25 Ga0070667_100639791 3300005367 Bacteria 982
26 Ga0070711_100276649 3300005439 Bacteria 1326
27 Ga0070700_100097188 3300005441 Bacteria 1933
28 Ga0070700_100682306 3300005441 Bacteria 815
29 Ga0070700_101052946 3300005441 Bacteria 672
30 Ga0070663_100370763 3300005455 Bacteria 1163
31 Ga0070663_100846748 3300005455 Bacteria 787
32 Ga0070678_100033992 3300005456 Bacteria 3546
33 Ga0070678_100143682 3300005456 Bacteria 1913
34 Ga0070678_100657375 3300005456 Bacteria 941
35 Ga0070662_100397803 3300005457 Bacteria 1136
36 Ga0070662_100615165 3300005457 Bacteria 914
37 Ga0070698_100375675 3300005471 Bacteria 1354
38 Ga0070699_100478229 3300005518 Bacteria 1130
39 Ga0070699_101386957 3300005518 Bacteria 645
40 Ga0070672_100210551 3300005543 Bacteria 1628
41 Ga0070672_100315105 3300005543 Bacteria 1329
42 Ga0070686_100776088 3300005544 Bacteria 771
43 Ga0070695_100544991 3300005545 Bacteria 903
44 Ga0070695_101457140 3300005545 Bacteria 569
45 Ga0070696_100326312 3300005546 Bacteria 1183
46 Ga0070693_101115932 3300005547 Bacteria 602
47 Ga0070665_100894772 3300005548 Bacteria 900
48 Ga0070665_101395758 3300005548 Bacteria 709
49 Ga0068859_100065651 3300005617 Bacteria 3662
50 Ga0068859_100274188 3300005617 Bacteria 1779
51 Ga0068864_100586542 3300005618 Bacteria 1080
52 Ga0068861_100034978 3300005719 Bacteria 3718
53 Ga0068861_100190131 3300005719 Bacteria 1715
54 Ga0068863_100762918 3300005841 Bacteria 963
55 Ga0068858_100129871 3300005842 Bacteria 2362
56 Ga0068858_100620648 3300005842 Bacteria 1050
57 Ga0068860_100000583 3300005843 Bacteria 43765
58 Ga0068860_100965421 3300005843 Bacteria 870
59 Ga0068862_100239716 3300005844 Bacteria 1648
60 Ga0068862_100647759 3300005844 Bacteria 1019
61 Ga0068862_101442338 3300005844 Bacteria 692
62 Ga0068862_101484528 3300005844 Bacteria 683
63 Ga0081540_1000005 3300005983 Bacteria 227052
64 Ga0081540_1004444 3300005983 Bacteria 10695
65 Ga0081540_1005727 3300005983 Bacteria 9215
66 Ga0081540_1013487 3300005983 Bacteria 5308
67 Ga0081540_1030236 3300005983 Bacteria 3003
68 Ga0081540_1111133 3300005983 Bacteria 1158
69 Ga0081539_10001847 3300005985 Bacteria 33403
70 Ga0075365_10076904 3300006038 Bacteria 2254
71 Ga0075365_10883652 3300006038 Bacteria 630
72 Ga0075363_100137308 3300006048 Bacteria 1375
73 Ga0075363_100199540 3300006048 Bacteria 1143
74 Ga0075364_10437988 3300006051 Bacteria 893
75 Ga0070712_100242037 3300006175 Bacteria 1437
76 Ga0070712_100374192 3300006175 Bacteria 1171
77 Ga0075362_10023752 3300006177 Bacteria 2595
78 Ga0075369_10099843 3300006186 Bacteria 1301
79 Ga0075369_10328909 3300006186 Bacteria 715
80 Ga0075366_10089071 3300006195 Bacteria 1848
81 Ga0075366_10265466 3300006195 Bacteria 1048
82 Ga0075366_10382495 3300006195 Bacteria 865
83 Ga0075366_10477499 3300006195 Bacteria 770
84 Ga0075370_10062550 3300006353 Bacteria 2121
85 Ga0075370_10443896 3300006353 Bacteria 780
86 Ga0075428_100037600 3300006844 Bacteria 5327
87 Ga0075428_100337076 3300006844 Bacteria 1620
88 Ga0075428_100378565 3300006844 Bacteria 1517
89 Ga0075428_100783623 3300006844 Bacteria 1014
90 Ga0075431_100236308 3300006847 Bacteria 1860
91 Ga0075434_100979672 3300006871 Bacteria 860
92 Ga0075434_101039652 3300006871 Bacteria 833
93 Ga0068865_100531139 3300006881 Bacteria 985
94 Ga0068865_100590441 3300006881 Bacteria 937
95 Ga0097620_100065651 3300006931 Bacteria 3662
96 Ga0097620_100274187 3300006931 Bacteria 1779
97 Ga0105250_10096513 3300009092 Bacteria 1205
98 Ga0111539_10118456 3300009094 Bacteria 3104
99 Ga0111539_10790861 3300009094 Bacteria 1104
100 Ga0105247_10125009 3300009101 Bacteria 1671
101 Ga0114129_10612083 3300009147 Bacteria 1410
102 Ga0105243_10347148 3300009148 Bacteria 1361
103 Ga0105242_10735531 3300009176 Bacteria 969
104 Ga0105242_11013048 3300009176 Bacteria 839
105 Ga0105248_10056250 3300009177 Bacteria 4414
106 Ga0105249_10215360 3300009553 Bacteria 1887
107 Ga0099796_10071621 3300010159 Bacteria 1253
108 Ga0105239_10504849 3300010375 Bacteria 1375
109 Ga0105246_10045616 3300011119 Bacteria 2986
110 Ga0105246_10612834 3300011119 Bacteria 942
111 Ga0157373_10325735 3300013100 Bacteria 1093
112 Ga0157374_10675222 3300013296 Bacteria 1045
113 Ga0157378_10576195 3300013297 Bacteria 1134
114 Ga0157378_11027429 3300013297 Bacteria 859
115 Ga0163162_10178294 3300013306 Bacteria 2251
116 Ga0157375_10523181 3300013308 Bacteria 1349
117 Ga0157375_10939077 3300013308 Bacteria 1007
118 Ga0157375_12390983 3300013308 Bacteria 630
119 Ga0163163_10700115 3300014325 Bacteria 1077
120 Ga0163163_10848168 3300014325 Bacteria 977
121 Ga0157380_10027928 3300014326 Bacteria 4297
122 Ga0157380_10606721 3300014326 Bacteria 1084
123 Ga0157380_10818780 3300014326 Bacteria 950
124 Ga0157380_12065475 3300014326 Bacteria 632
125 Ga0157377_10101147 3300014745 Bacteria 1718
126 Ga0157379_10416558 3300014968 Bacteria 1237
127 Ga0163161_10469438 3300017792 Bacteria 1020
128 Ga0207710_10450228 3300025900 Bacteria 665
129 Ga0207688_10037167 3300025901 Bacteria 2700
130 Ga0207647_10123762 3300025904 Bacteria 1523
131 Ga0207695_10927339 3300025913 Bacteria 750
132 Ga0207693_10054785 3300025915 Bacteria 3128
133 Ga0207662_10277110 3300025918 Bacteria 1109
134 Ga0207657_10047455 3300025919 Bacteria 3755
135 Ga0207681_10543725 3300025923 Bacteria 955
136 Ga0207659_10080968 3300025926 Bacteria 2400
137 Ga0207690_10641231 3300025932 Bacteria 870
138 Ga0207706_10248984 3300025933 Bacteria 1552
139 Ga0207706_10273653 3300025933 Bacteria 1473
140 Ga0207706_10688902 3300025933 Bacteria 874
141 Ga0207709_10453800 3300025935 Bacteria 991
142 Ga0207670_10173902 3300025936 Bacteria 1617
143 Ga0207670_11733389 3300025936 Bacteria 531
144 Ga0207704_10703606 3300025938 Bacteria 837
145 Ga0207691_10214403 3300025940 Bacteria 1671
146 Ga0207691_10275277 3300025940 Bacteria 1449
147 Ga0207691_10581098 3300025940 Bacteria 949
148 Ga0207711_11296600 3300025941 Bacteria 670
149 Ga0207689_10014077 3300025942 Bacteria 6808
150 Ga0207689_10035623 3300025942 Bacteria 4133
151 Ga0207689_10100470 3300025942 Bacteria 2376
152 Ga0207679_10821396 3300025945 Bacteria 848
153 Ga0207712_10021817 3300025961 Bacteria 4208
154 Ga0207712_10325563 3300025961 Bacteria 1270
155 Ga0207668_10157666 3300025972 Bacteria 1765
156 Ga0207668_10173919 3300025972 Bacteria 1691
157 Ga0207668_10526605 3300025972 Bacteria 1021
158 Ga0207658_10324391 3300025986 Bacteria 1334
159 Ga0207677_10450745 3300026023 Bacteria 1102
160 Ga0207703_10079329 3300026035 Bacteria 2731
161 Ga0207703_10958292 3300026035 Bacteria 820
162 Ga0207678_10097879 3300026067 Bacteria 2507
163 Ga0207678_10100830 3300026067 Bacteria 2466
164 Ga0207678_10463061 3300026067 Bacteria 1103
165 Ga0207708_10819435 3300026075 Bacteria 802
166 Ga0207641_10119398 3300026088 Bacteria 2350
167 Ga0207641_10136916 3300026088 Bacteria 2205
168 Ga0207676_10044579 3300026095 Bacteria 3422
169 Ga0207676_10604550 3300026095 Bacteria 1054
170 Ga0207676_10878597 3300026095 Bacteria 878
171 Ga0207675_100151164 3300026118 Bacteria 2210
172 Ga0207683_10152076 3300026121 Bacteria 2089
173 Ga0207683_10524469 3300026121 Bacteria 1095
174 Ga0207683_10672685 3300026121 Bacteria 959
175 Ga0207428_10033478 3300027907 Bacteria 4221
176 Ga0207428_10184197 3300027907 Bacteria 1576
177 Ga0268266_10028326 3300028379 Bacteria 4761
178 Ga0268265_10051674 3300028380 Bacteria 3103
179 Ga0268265_10092489 3300028380 Bacteria 2421
180 Ga0268265_10125322 3300028380 Bacteria 2124
181 Ga0268265_10930334 3300028380 Bacteria 855
182 Ga0268265_11180173 3300028380 Bacteria 762
183 Ga0268265_12454554 3300028380 Bacteria 527
184 Ga0268265_12683495 3300028380 Bacteria 503
185 Ga0268264_10000046 3300028381 Bacteria 364597
186 Ga0268264_10411255 3300028381 Bacteria 1302
187 Ga0268264_10421220 3300028381 Bacteria 1288
188 Ga0268264_11429999 3300028381 Bacteria 702
189 Ga0307517_10142204 3300028786 Bacteria 1680
190 Ga0307513_10602036 3300031456 Bacteria 808
191 Ga0307409_101460978 3300031995 Bacteria 711
192 Ga0307416_101207129 3300032002 Bacteria 862
193 Ga0307415_100416772 3300032126 Bacteria 1151
194 Ga0307510_10055864 3300033180 Bacteria 4119
195 Ga0395905_0138794 3300037471 Bacteria 2287
196 Ga0451787_269794 3300041441 Bacteria 661
197 Ga0451800_1320097 3300041459 Bacteria 622
198 Ga0451855_0171244 3300041511 Bacteria 576
199 Ga0451853_0479238 3300041512 Bacteria 1451
200 Ga0451853_1428909 3300041512 Bacteria 604
201 Ga0439445_0086914 3300042004 Bacteria 878
202 Ga0439448_0001875 3300042005 Bacteria 5584
203 Ga0439450_005315 3300042008 Bacteria 2259
204 Ga0439455_0007425 3300042012 Bacteria 2317
205 Ga0439460_0269207 3300042461 Bacteria 591
206 Ga0495605_0104824 3300046474 Bacteria 1296
207 Ga0495584_0068573 3300046491 Bacteria 1782
208 Ga0495594_0311366 3300046499 Bacteria 897
209 Ga0495583_0329703 3300046506 Bacteria 604
210 Ga0495606_0270297 3300046507 Bacteria 934
211 Ga0495616_0176006 3300046513 Bacteria 954
212 Ga0495620_0066494 3300046515 Bacteria 1485
213 Ga0495620_0106052 3300046515 Bacteria 1117
214 Ga0495631_0251860 3300046518 Bacteria 753
215 Ga0495632_0080022 3300046519 Bacteria 1559
216 Ga0495632_0276163 3300046519 Bacteria 749
217 Ga0495643_0530763 3300046522 Bacteria 503
218 Ga0495648_0027033 3300046524 Bacteria 3850
219 Ga0495587_0526547 3300046536 Bacteria 653
220 Ga0495598_0076331 3300046537 Bacteria 1066
221 Ga0495622_0052971 3300046557 Bacteria 1883
222 Ga0495656_0099101 3300046615 Bacteria 1345
223 Ga0495668_0179037 3300046616 Bacteria 1161
224 Ga0495625_0658958 3300046660 Bacteria 622
225 Ga0495671_0029503 3300046692 Bacteria 2816
226 Ga0495671_0121820 3300046692 Bacteria 1272
227 Ga0495671_0428530 3300046692 Bacteria 633
228 Ga0495649_0243782 3300046694 Bacteria 925
229 Ga0495589_0378048 3300046794 Bacteria 651
230 Ga0495672_0037305 3300047320 Bacteria 2975
231 Ga0495686_0491151 3300047472 Bacteria 648
232 Ga0496102_0049963 3300048905 Bacteria 3807
233 Ga0496102_0132952 3300048905 Bacteria 2330
234 Ga0496102_0197318 3300048905 Bacteria 1897
235 Ga0496104_0196562 3300048907 Bacteria 1929
236 Ga0496104_0694585 3300048907 Bacteria 925
237 Ga0496105_0739293 3300048908 Bacteria 752
238 Ga0496106_0298043 3300048909 Bacteria 1293
239 Ga0496108_0557294 3300048911 Bacteria 1000
240 Ga0496109_0325036 3300048912 Bacteria 1452
241 Ga0496110_0050771 3300048913 Bacteria 3643
242 Ga0496110_0381068 3300048913 Bacteria 1285
243 Ga0496112_0592072 3300048915 Bacteria 1041
244 Ga0496118_0256610 3300048921 Bacteria 990
245 Ga0496121_0053609 3300048924 Bacteria 3377
246 Ga0496121_0195770 3300048924 Bacteria 1445
247 Ga0496124_0565643 3300048927 Bacteria 747
248 Ga0496125_0155074 3300048928 Bacteria 1566
249 Ga0496126_0122245 3300048929 Bacteria 2256
250 Ga0496126_0214515 3300048929 Bacteria 1619
251 Ga0495682_0109934 3300049460 Bacteria 988
252 Ga0501032_0778772 3300049569 Bacteria 605
253 Ga0501034_0043035 3300049571 Bacteria 4571
254 Ga0501046_0187759 3300049580 Bacteria 1543
255 Ga0501048_0104503 3300049582 Bacteria 1999
256 Ga0501070_0035911 3300049586 Bacteria 4139
257 Ga0501071_0052012 3300049587 Bacteria 2953
258 Ga0501074_0752904 3300049590 Bacteria 687
259 Ga0501077_0321414 3300049593 Bacteria 987
260 Ga0501035_0056597 3300049822 Bacteria 3498
261 Ga0501044_0162823 3300049823 Bacteria 2206
262 nmdc:mga03683_118780_c1 3300050489 Bacteria 1174
263 nmdc:mga03683_144530_c1 3300050489 Bacteria 1071
264 nmdc:mga03683_512431_c1 3300050489 Bacteria 582
265 nmdc:mga03n38_16046_c1 3300050490 Bacteria 2906
266 nmdc:mga03n38_292836_c1 3300050490 Bacteria 872
267 nmdc:mga0yw44_16659_c1 3300050492 Bacteria 3978
268 nmdc:mga0yw44_6853_c1 3300050492 Bacteria 1511
269 nmdc:mga0k408_371389_c1 3300050493 Bacteria 852
270 nmdc:mga0k408_88306_c1 3300050493 Bacteria 1821
271 nmdc:mga06z11_1472_c1 3300050494 Bacteria 8770
272 nmdc:mga07m45_168440_c2 3300050496 Bacteria 1078
273 nmdc:mga07m45_239902_c1 3300050496 Bacteria 1055
274 nmdc:mga07m45_41120_c1 3300050496 Bacteria 2588
275 nmdc:mga05p37_384174_c1 3300050507 Bacteria 1644
276 nmdc:mga05p37_43322_c1 3300050507 Bacteria 5537
277 nmdc:mga05p37_449426_c1 3300050507 Bacteria 1492
278 nmdc:mga05p37_60656_c1 3300050507 Bacteria 4656
279 nmdc:mga06r32_1911255_c1 3300050510 Bacteria 528
280 nmdc:mga06r32_425218_c1 3300050510 Bacteria 1309
281 nmdc:mga08y16_167783_c1 3300050511 Bacteria 2281
282 nmdc:mga08y16_331440_c1 3300050511 Bacteria 1565
283 nmdc:mga0n895_590184_c1 3300050512 Bacteria 1114
284 nmdc:mga0a205_560326_c1 3300050515 Bacteria 997
285 Ga0500643_083719 3300053087 Bacteria 874
286 Ga0500641_0011912 3300053096 Bacteria 3165
287 Ga0500562_045892 3300053108 Bacteria 1165
288 Ga0500562_064400 3300053108 Bacteria 986
289 Ga0500592_030514 3300053116 Bacteria 870
290 Ga0500595_004588 3300053119 Bacteria 6163
291 Ga0500642_0029949 3300053130 Bacteria 2261
292 Ga0500658_0104541 3300053134 Bacteria 1240
293 Ga0500658_0329445 3300053134 Bacteria 702
294 Ga0500561_0028391 3300053137 Bacteria 1388
295 Ga0500568_0045677 3300053139 Bacteria 1742
296 Ga0500589_055289 3300053147 Bacteria 1832
297 Ga0500604_0011237 3300053151 Bacteria 2402
298 Ga0500616_0000758 3300053153 Bacteria 37186
299 Ga0500622_0048675 3300053156 Bacteria 2187
300 Ga0500622_0058920 3300053156 Bacteria 1961
301 Ga0500627_0234902 3300053158 Bacteria 815
302 Ga0500634_0262684 3300053161 Bacteria 709
303 Ga0501082_0320471 3300060353 Bacteria 1350
304 Ga0530510_0249046 3300061734 Bacteria 1324
305 2510894805 2510461076 Bacteria 8618824
306 2511171334 2510917026 Bacteria 7046020
307 2514021739 2513237162 Bacteria 7468464
308 2515632733 2515154113 Bacteria 7807172
309 2515639881 2515154114 Bacteria 7848616
310 2515662015 2515154116 Bacteria 7552979
311 2585994726 2585427633 Bacteria 6413184
312 2585999208 2585427634 Bacteria 6455027
313 2723844990 2721755755 Bacteria 8322773
314 2838682117 2838680041 Bacteria 6545511
315 2838696689 2838694306 Bacteria 6853137
316 2838710072 2838707686 Bacteria 6619912
317 2842078245 2842077413 Bacteria 6508645
318 2842119247 2842118031 Bacteria 7033875
319 2842239484 2842237096 Bacteria 6620661
320 2842291907 2842291075 Bacteria 7076806
321 2842304400 2842304105 Bacteria 7023636
322 2842372684 2842370503 Bacteria 7038661
323 2842378303 2842377471 Bacteria 7140707
324 2842385756 2842384541 Bacteria 7057858
325 2842511347 2842509118 Bacteria 6850950
326 2869164951 2869162929 Bacteria 6399702
327 2874605298 2874604998 Bacteria 7834745
328 2919171827 2919171160 Bacteria 6499771
329 2922365449 2922361189 Bacteria 7436256
330 2933571674 2933570622 Bacteria 7023390
331 2935897456 2935894831 Bacteria 6620579
332 8006965841 8006964411 Bacteria 8966052
333 8006995937 8006994254 Bacteria 8309700
334 8046774922 8046767195 Bacteria 7547379
335 Ga0075429_100054000
336 JGI24737J22298_10132520
337 JGI25406J46586_10026018
338 JGI25404J52841_10014302
339 Ga0070658_10685841
340 Ga0070658_11125241
341 Ga0070683_100239551
342 Ga0070670_101223293
343 Ga0068869_100009913
344 Ga0068869_100117833
345 Ga0068869_100206665
346 Ga0068868_100387355
347 Ga0070689_100021234
348 Ga0070689_100378529
349 Ga0070687_100343800
350 Ga0070668_100041923
351 Ga0070668_100370551
352 Ga0070668_100480696
353 Ga0070669_100273734
354 Ga0070671_101356047
355 Ga0070673_100989923
356 Ga0070688_100369193
357 Ga0070659_100176047
358 Ga0070667_100263959
359 Ga0070667_100639791
360 Ga0070711_100276649
361 Ga0070700_100097188
362 Ga0070700_100682306
363 Ga0070700_101052946
364 Ga0070663_100370763
365 Ga0070663_100846748
366 Ga0070678_100033992
367 Ga0070678_100143682
368 Ga0070678_100657375
369 Ga0070662_100397803
370 Ga0070662_100615165
371 Ga0070698_100375675
372 Ga0070699_100478229
373 Ga0070699_101386957
374 Ga0070672_100210551
375 Ga0070672_100315105
376 Ga0070686_100776088
377 Ga0070695_100544991
378 Ga0070695_101457140
379 Ga0070696_100326312
380 Ga0070693_101115932
381 Ga0070665_100894772
382 Ga0070665_101395758
383 Ga0068859_100065651
384 Ga0068859_100274188
385 Ga0068864_100586542
386 Ga0068861_100034978
387 Ga0068861_100190131
388 Ga0068863_100762918
389 Ga0068858_100129871
390 Ga0068858_100620648
391 Ga0068860_100000583
392 Ga0068860_100965421
393 Ga0068862_100239716
394 Ga0068862_100647759
395 Ga0068862_101442338
396 Ga0068862_101484528
397 Ga0081540_1000005
398 Ga0081540_1004444
399 Ga0081540_1005727
400 Ga0081540_1013487
401 Ga0081540_1030236
402 Ga0081540_1111133
403 Ga0081539_10001847
404 Ga0075365_10076904
405 Ga0075365_10883652
406 Ga0075363_100137308
407 Ga0075363_100199540
408 Ga0075364_10437988
409 Ga0070712_100242037
410 Ga0070712_100374192
411 Ga0075362_10023752
412 Ga0075369_10099843
413 Ga0075369_10328909
414 Ga0075366_10089071
415 Ga0075366_10265466
416 Ga0075366_10382495
417 Ga0075366_10477499
418 Ga0075370_10062550
419 Ga0075370_10443896
420 Ga0075428_100037600
421 Ga0075428_100337076
422 Ga0075428_100378565
423 Ga0075428_100783623
424 Ga0075431_100236308
425 Ga0075434_100979672
426 Ga0075434_101039652
427 Ga0068865_100531139
428 Ga0068865_100590441
429 Ga0097620_100065651
430 Ga0097620_100274187
431 Ga0105250_10096513
432 Ga0111539_10118456
433 Ga0111539_10790861
434 Ga0105247_10125009
435 Ga0114129_10612083
436 Ga0105243_10347148
437 Ga0105242_10735531
438 Ga0105242_11013048
439 Ga0105248_10056250
440 Ga0105249_10215360
441 Ga0099796_10071621
442 Ga0105239_10504849
443 Ga0105246_10045616
444 Ga0105246_10612834
445 Ga0157373_10325735
446 Ga0157374_10675222
447 Ga0157378_10576195
448 Ga0157378_11027429
449 Ga0163162_10178294
450 Ga0157375_10523181
451 Ga0157375_10939077
452 Ga0157375_12390983
453 Ga0163163_10700115
454 Ga0163163_10848168
455 Ga0157380_10027928
456 Ga0157380_10606721
457 Ga0157380_10818780
458 Ga0157380_12065475
459 Ga0157377_10101147
460 Ga0157379_10416558
461 Ga0163161_10469438
462 Ga0207710_10450228
463 Ga0207688_10037167
464 Ga0207647_10123762
465 Ga0207695_10927339
466 Ga0207693_10054785
467 Ga0207662_10277110
468 Ga0207657_10047455
469 Ga0207681_10543725
470 Ga0207659_10080968
471 Ga0207690_10641231
472 Ga0207706_10248984
473 Ga0207706_10273653
474 Ga0207706_10688902
475 Ga0207709_10453800
476 Ga0207670_10173902
477 Ga0207670_11733389
478 Ga0207704_10703606
479 Ga0207691_10214403
480 Ga0207691_10275277
481 Ga0207691_10581098
482 Ga0207711_11296600
483 Ga0207689_10014077
484 Ga0207689_10035623
485 Ga0207689_10100470
486 Ga0207679_10821396
487 Ga0207712_10021817
488 Ga0207712_10325563
489 Ga0207668_10157666
490 Ga0207668_10173919
491 Ga0207668_10526605
492 Ga0207658_10324391
493 Ga0207677_10450745
494 Ga0207703_10079329
495 Ga0207703_10958292
496 Ga0207678_10097879
497 Ga0207678_10100830
498 Ga0207678_10463061
499 Ga0207708_10819435
500 Ga0207641_10119398
501 Ga0207641_10136916
502 Ga0207676_10044579
503 Ga0207676_10604550
504 Ga0207676_10878597
505 Ga0207675_100151164
506 Ga0207683_10152076
507 Ga0207683_10524469
508 Ga0207683_10672685
509 Ga0207428_10033478
510 Ga0207428_10184197
511 Ga0268266_10028326
512 Ga0268265_10051674
513 Ga0268265_10092489
514 Ga0268265_10125322
515 Ga0268265_10930334
516 Ga0268265_11180173
517 Ga0268265_12454554
518 Ga0268265_12683495
519 Ga0268264_10000046
520 Ga0268264_10411255
521 Ga0268264_10421220
522 Ga0268264_11429999
523 Ga0307517_10142204
524 Ga0307513_10602036
525 Ga0307409_101460978
526 Ga0307416_101207129
527 Ga0307415_100416772
528 Ga0307510_10055864
529 Ga0395905_0138794
530 Ga0451787_269794
531 Ga0451800_1320097
532 Ga0451855_0171244
533 Ga0451853_0479238
534 Ga0451853_1428909
535 Ga0439445_0086914
536 Ga0439448_0001875
537 Ga0439450_005315
538 Ga0439455_0007425
539 Ga0439460_0269207
540 Ga0495605_0104824
541 Ga0495584_0068573
542 Ga0495594_0311366
543 Ga0495583_0329703
544 Ga0495606_0270297
545 Ga0495616_0176006
546 Ga0495620_0066494
547 Ga0495620_0106052
548 Ga0495631_0251860
549 Ga0495632_0080022
550 Ga0495632_0276163
551 Ga0495643_0530763
552 Ga0495648_0027033
553 Ga0495587_0526547
554 Ga0495598_0076331
555 Ga0495622_0052971
556 Ga0495656_0099101
557 Ga0495668_0179037
558 Ga0495625_0658958
559 Ga0495671_0029503
560 Ga0495671_0121820
561 Ga0495671_0428530
562 Ga0495649_0243782
563 Ga0495589_0378048
564 Ga0495672_0037305
565 Ga0495686_0491151
566 Ga0496102_0049963
567 Ga0496102_0132952
568 Ga0496102_0197318
569 Ga0496104_0196562
570 Ga0496104_0694585
571 Ga0496105_0739293
572 Ga0496106_0298043
573 Ga0496108_0557294
574 Ga0496109_0325036
575 Ga0496110_0050771
576 Ga0496110_0381068
577 Ga0496112_0592072
578 Ga0496118_0256610
579 Ga0496121_0053609
580 Ga0496121_0195770
581 Ga0496124_0565643
582 Ga0496125_0155074
583 Ga0496126_0122245
584 Ga0496126_0214515
585 Ga0495682_0109934
586 Ga0501032_0778772
587 Ga0501034_0043035
588 Ga0501046_0187759
589 Ga0501048_0104503
590 Ga0501070_0035911
591 Ga0501071_0052012
592 Ga0501074_0752904
593 Ga0501077_0321414
594 Ga0501035_0056597
595 Ga0501044_0162823
596 nmdc:mga03683_118780_c1
597 nmdc:mga03683_144530_c1
598 nmdc:mga03683_512431_c1
599 nmdc:mga03n38_16046_c1
600 nmdc:mga03n38_292836_c1
601 nmdc:mga0yw44_16659_c1
602 nmdc:mga0yw44_6853_c1
603 nmdc:mga0k408_371389_c1
604 nmdc:mga0k408_88306_c1
605 nmdc:mga06z11_1472_c1
606 nmdc:mga07m45_168440_c2
607 nmdc:mga07m45_239902_c1
608 nmdc:mga07m45_41120_c1
609 nmdc:mga05p37_384174_c1
610 nmdc:mga05p37_43322_c1
611 nmdc:mga05p37_449426_c1
612 nmdc:mga05p37_60656_c1
613 nmdc:mga06r32_1911255_c1
614 nmdc:mga06r32_425218_c1
615 nmdc:mga08y16_167783_c1
616 nmdc:mga08y16_331440_c1
617 nmdc:mga0n895_590184_c1
618 nmdc:mga0a205_560326_c1
619 Ga0500643_083719
620 Ga0500641_0011912
621 Ga0500562_045892
622 Ga0500562_064400
623 Ga0500592_030514
624 Ga0500595_004588
625 Ga0500642_0029949
626 Ga0500658_0104541
627 Ga0500658_0329445
628 Ga0500561_0028391
629 Ga0500568_0045677
630 Ga0500589_055289
631 Ga0500604_0011237
632 Ga0500616_0000758
633 Ga0500622_0048675
634 Ga0500622_0058920
635 Ga0500627_0234902
636 Ga0500634_0262684
637 Ga0501082_0320471
638 Ga0530510_0249046
639 2510894805
640 2511171334
641 2514021739
642 2515632733
643 2515639881
644 2515662015
645 2585994726
646 2585999208
647 2723844990
648 2838682117
649 2838696689
650 2838710072
651 2842078245
652 2842119247
653 2842239484
654 2842291907
655 2842304400
656 2842372684
657 2842378303
658 2842385756
659 2842511347
660 2869164951
661 2874605298
662 2919171827
663 2922365449
664 2933571674
665 2935897456
666 8006965841
667 8006995937
668 8046774922

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08818

DUF1801

Domain of unknown function (DU1801)

85

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.7249 43 151
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.6435 43 151
5ohy-assembly2.cif.gz_B a gh31 family sulfoquinovosidase in complex with aza-sugar inhibitor ifgsq 0.6325 71 103
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.62 43 138
2a1v-assembly1.cif.gz_A crystal structure of deinococcus radiodurans protein dr2400, pfam domain duf419 0.6115 59 145
ID Description Score Start End Superfamily
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.8158 37 145 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7769 37 145 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7566 43 140 3.90.1150.200
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6632 43 140 3.90.1150.200
af_P0AF50_1_117_3.90.1150.30 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6583 57 147 3.90.1150.30
ID Description Score Start End GO Terms
AF-A0A348PHX7-F1-model_v4 Histidine kinase 0.9997 28 151 GO:0016301
AF-A0A527XZ27-F1-model_v4 DUF1801 domain-containing protein 0.9996 63 153
AF-A0A135HS04-F1-model_v4 Histidine kinase 0.9981 32 153 GO:0016301
AF-A0A7Y5C6U8-F1-model_v4 DUF1801 domain-containing protein 0.9979 55 151
AF-A0A352UV98-F1-model_v4 Histidine kinase 0.9967 22 151 GO:0016301

Map