F411722

General Info

Members Datasets Scaffolds Average Seq Length
334 183 307 160

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10035611|Ga0075432_100356113
Length 175
Sequence MSNSLKLSVPEGQPFIEYEREFDFPVADVFRAHKEPELIAQWLGPRRLRMDIDHYDFRTGGSYLYTHTAPDGQSYGFSGIFHTVRDNEFAVQTFEFDGYPDVVSIEYLTFEDLGGGRCRLTGHSVYPSQEARDGMAQSGMEGGMTEGYERLDELLSGAATGTSSTGQPEAGKVTA

Samples

Sample ID Description Type Environment
1 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
2 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
3 2643221572 Leifsonia sp. Root60 Isolate Unclassified
4 2643221649 Leifsonia sp. Root4 Isolate Unclassified
5 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
6 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
7 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
8 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
9 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
10 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
11 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
12 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
13 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
14 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
15 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
16 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
17 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
18 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
19 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
20 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
21 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
22 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
23 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
24 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
25 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
26 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
27 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
31 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
47 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
52 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
55 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
81 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
82 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
94 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
95 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
96 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
97 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
98 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
99 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
100 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
101 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
102 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
103 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
104 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
105 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
106 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
107 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
110 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
111 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
112 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
113 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
114 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
115 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
116 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
117 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
118 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
119 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
120 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
121 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
122 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
123 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
124 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
125 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
126 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
127 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
128 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
129 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
130 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
131 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
132 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
133 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
134 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
135 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
136 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
137 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
138 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
139 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
140 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
153 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
154 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
172 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
173 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
174 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
182 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
183 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.62
Metatranscriptomes 0.3
Isolates 8.08

Biome Distribution

Category Percentage (%)
Aerial Root 0.3
Bulb 0
Endosphere 3.59
Nodule 0
Rhizoplane 8.08
Rhizosphere 82.93
Stem 0
Stem Tuber 0
Unclassified 5.09

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1008602 3300000549 Bacteria 1238
2 rootH1_10200497 3300003323 Bacteria 1244
3 Ga0065714_10076581 3300005288 Bacteria 2777
4 Ga0065714_10179010 3300005288 Bacteria 968
5 Ga0070676_10028037 3300005328 Bacteria 3197
6 Ga0070670_100490704 3300005331 Bacteria 1091
7 Ga0070677_10028423 3300005333 Bacteria 2112
8 Ga0070666_10094780 3300005335 Bacteria 2054
9 Ga0070668_100078875 3300005347 Bacteria 2577
10 Ga0070669_100420819 3300005353 Bacteria 1096
11 Ga0070674_100020814 3300005356 Bacteria 4200
12 Ga0070673_100079281 3300005364 Bacteria 2658
13 Ga0070673_101050163 3300005364 Bacteria 760
14 Ga0070667_100010065 3300005367 Bacteria 7832
15 Ga0070678_100058083 3300005456 Bacteria 2838
16 Ga0070665_100486640 3300005548 Bacteria 1245
17 Ga0075365_10863620 3300006038 Bacteria 638
18 Ga0075363_100175576 3300006048 Bacteria 1217
19 Ga0075364_10151006 3300006051 Bacteria 1566
20 Ga0075364_10721203 3300006051 Unclassified 680
21 Ga0075432_10035611 3300006058 Bacteria 1729
22 Ga0075432_10092715 3300006058 Bacteria 1107
23 Ga0075362_10044266 3300006177 Bacteria 1973
24 Ga0075362_10217827 3300006177 Bacteria 932
25 Ga0105251_10074653 3300009011 Bacteria 1575
26 Ga0105244_10167367 3300009036 Bacteria 1047
27 Ga0105245_10968617 3300009098 Bacteria 894
28 Ga0114129_10442741 3300009147 Bacteria 1705
29 Ga0105243_11172068 3300009148 Bacteria 780
30 Ga0105248_10085325 3300009177 Bacteria 3553
31 Ga0105238_10368558 3300009551 Bacteria 1426
32 Ga0105246_10011186 3300011119 Bacteria 5563
33 Ga0105246_10524032 3300011119 Bacteria 1011
34 Ga0157373_10076479 3300013100 Bacteria 2362
35 Ga0157371_10002620 3300013102 Bacteria 17080
36 Ga0157369_10116567 3300013105 Bacteria 2836
37 Ga0157369_10263581 3300013105 Bacteria 1797
38 Ga0157369_10464667 3300013105 Bacteria 1310
39 Ga0163162_10172261 3300013306 Bacteria 2289
40 Ga0163162_10523748 3300013306 Bacteria 1315
41 Ga0163162_10569150 3300013306 Bacteria 1260
42 Ga0163162_11205124 3300013306 Bacteria 859
43 Ga0157372_10468280 3300013307 Bacteria 1469
44 Ga0157372_12327839 3300013307 Bacteria 615
45 Ga0157375_10240511 3300013308 Bacteria 1970
46 Ga0182008_10593217 3300014497 Bacteria 621
47 Ga0163161_10031311 3300017792 Bacteria 3789
48 Ga0206350_11268510 3300020080 Bacteria 523
49 Ga0209148_1002289 3300025254 Bacteria 6896
50 Ga0207697_10031404 3300025315 Bacteria 2172
51 Ga0207655_1124813 3300025728 Bacteria 847
52 Ga0207713_1154333 3300025735 Bacteria 738
53 Ga0207645_10029223 3300025907 Bacteria 3554
54 Ga0207681_10210144 3300025923 Bacteria 1499
55 Ga0207659_10414836 3300025926 Bacteria 1128
56 Ga0207644_10220492 3300025931 Bacteria 1503
57 Ga0207709_10057401 3300025935 Bacteria 2414
58 Ga0207669_10112532 3300025937 Bacteria 1828
59 Ga0207691_10004828 3300025940 Bacteria 13038
60 Ga0207711_10954038 3300025941 Bacteria 796
61 Ga0207651_10029714 3300025960 Bacteria 3468
62 Ga0207668_10119489 3300025972 Bacteria 1993
63 Ga0207658_11032624 3300025986 Bacteria 750
64 Ga0207674_10221945 3300026116 Bacteria 1838
65 Ga0207683_10757829 3300026121 Bacteria 901
66 Ga0316183_1124055 3300030742 Bacteria 1215
67 Ga0307408_100010595 3300031548 Bacteria 6080
68 Ga0307408_100020337 3300031548 Bacteria 4478
69 Ga0307408_100021241 3300031548 Bacteria 4391
70 Ga0307408_100065989 3300031548 Bacteria 2656
71 Ga0307408_100072324 3300031548 Bacteria 2552
72 Ga0307408_100143068 3300031548 Bacteria 1879
73 Ga0307408_100257455 3300031548 Bacteria 1442
74 Ga0307408_100576345 3300031548 Bacteria 996
75 Ga0307408_100716915 3300031548 Bacteria 900
76 Ga0307408_100759644 3300031548 Bacteria 876
77 Ga0307408_101313794 3300031548 Bacteria 678
78 Ga0307405_10029969 3300031731 Bacteria 3186
79 Ga0307405_10045196 3300031731 Bacteria 2697
80 Ga0307405_10069228 3300031731 Bacteria 2261
81 Ga0307405_10131415 3300031731 Bacteria 1730
82 Ga0307405_10282790 3300031731 Bacteria 1249
83 Ga0307405_10305048 3300031731 Bacteria 1209
84 Ga0307405_10333174 3300031731 Bacteria 1164
85 Ga0307405_10388876 3300031731 Bacteria 1088
86 Ga0307405_11425002 3300031731 Bacteria 606
87 Ga0307405_11566477 3300031731 Bacteria 580
88 Ga0307413_10012518 3300031824 Bacteria 4225
89 Ga0307413_10040376 3300031824 Bacteria 2722
90 Ga0307413_10074795 3300031824 Bacteria 2147
91 Ga0307413_10123783 3300031824 Bacteria 1756
92 Ga0307413_10443758 3300031824 Bacteria 1028
93 Ga0307413_10548403 3300031824 Bacteria 937
94 Ga0307413_10788426 3300031824 Bacteria 797
95 Ga0307413_10888671 3300031824 Bacteria 756
96 Ga0307410_10011270 3300031852 Bacteria 5105
97 Ga0307410_10122951 3300031852 Bacteria 1895
98 Ga0307410_10132578 3300031852 Bacteria 1832
99 Ga0307410_10176412 3300031852 Bacteria 1614
100 Ga0307410_10303733 3300031852 Bacteria 1260
101 Ga0307410_10492295 3300031852 Bacteria 1007
102 Ga0307410_10638966 3300031852 Bacteria 891
103 Ga0307410_10844414 3300031852 Bacteria 781
104 Ga0307410_11294189 3300031852 Bacteria 637
105 Ga0307406_10040561 3300031901 Bacteria 2895
106 Ga0307406_10607681 3300031901 Bacteria 902
107 Ga0307406_10655420 3300031901 Bacteria 872
108 Ga0307406_10677895 3300031901 Bacteria 858
109 Ga0307407_10007057 3300031903 Bacteria 5057
110 Ga0307407_10008443 3300031903 Bacteria 4730
111 Ga0307407_10038566 3300031903 Bacteria 2649
112 Ga0307407_10076938 3300031903 Bacteria 2005
113 Ga0307407_10080390 3300031903 Bacteria 1969
114 Ga0307407_10119207 3300031903 Bacteria 1670
115 Ga0307407_10192887 3300031903 Bacteria 1359
116 Ga0307407_10206793 3300031903 Bacteria 1319
117 Ga0307412_10034548 3300031911 Bacteria 3222
118 Ga0307412_10047628 3300031911 Bacteria 2816
119 Ga0307412_10049718 3300031911 Bacteria 2763
120 Ga0307412_10056891 3300031911 Bacteria 2608
121 Ga0307412_10064353 3300031911 Bacteria 2477
122 Ga0307412_10164354 3300031911 Bacteria 1653
123 Ga0307412_10182302 3300031911 Bacteria 1580
124 Ga0307412_10184209 3300031911 Bacteria 1573
125 Ga0307412_10223958 3300031911 Bacteria 1444
126 Ga0307412_10283159 3300031911 Bacteria 1302
127 Ga0307412_10371710 3300031911 Bacteria 1154
128 Ga0307412_11262832 3300031911 Bacteria 663
129 Ga0307409_100021286 3300031995 Bacteria 4442
130 Ga0307409_100047475 3300031995 Bacteria 3259
131 Ga0307409_100055893 3300031995 Bacteria 3050
132 Ga0307409_100082770 3300031995 Bacteria 2599
133 Ga0307409_100089856 3300031995 Bacteria 2512
134 Ga0307409_100108181 3300031995 Bacteria 2324
135 Ga0307409_100326399 3300031995 Bacteria 1438
136 Ga0307409_100339520 3300031995 Bacteria 1413
137 Ga0307409_100464299 3300031995 Bacteria 1225
138 Ga0307409_100873144 3300031995 Bacteria 911
139 Ga0307416_100007605 3300032002 Bacteria 6910
140 Ga0307416_100093570 3300032002 Bacteria 2589
141 Ga0307416_100095489 3300032002 Bacteria 2567
142 Ga0307416_100120808 3300032002 Bacteria 2334
143 Ga0307416_100151833 3300032002 Bacteria 2125
144 Ga0307416_100162529 3300032002 Bacteria 2066
145 Ga0307416_100328002 3300032002 Bacteria 1536
146 Ga0307416_100502409 3300032002 Bacteria 1277
147 Ga0307416_100556224 3300032002 Bacteria 1221
148 Ga0307416_100610646 3300032002 Bacteria 1171
149 Ga0307416_100621212 3300032002 Bacteria 1162
150 Ga0307416_100641950 3300032002 Bacteria 1145
151 Ga0307416_100662973 3300032002 Bacteria 1129
152 Ga0307416_100796346 3300032002 Bacteria 1040
153 Ga0307416_100953669 3300032002 Bacteria 960
154 Ga0307416_102668261 3300032002 Bacteria 597
155 Ga0307414_10250377 3300032004 Bacteria 1472
156 Ga0307414_10642977 3300032004 Bacteria 955
157 Ga0307414_10693586 3300032004 Bacteria 921
158 Ga0307411_10008344 3300032005 Bacteria 5359
159 Ga0307411_10033735 3300032005 Bacteria 3177
160 Ga0307411_10168917 3300032005 Bacteria 1647
161 Ga0307411_10954735 3300032005 Bacteria 765
162 Ga0307411_11649924 3300032005 Bacteria 592
163 Ga0307415_100073874 3300032126 Bacteria 2407
164 Ga0307415_100084477 3300032126 Bacteria 2278
165 Ga0307415_100253081 3300032126 Bacteria 1432
166 Ga0307415_100958409 3300032126 Bacteria 792
167 Ga0395899_0100279 3300037312 Bacteria 2091
168 Ga0395899_0310261 3300037312 Bacteria 1065
169 Ga0395900_0331761 3300037418 Bacteria 1499
170 Ga0395900_0402682 3300037418 Bacteria 1332
171 Ga0395898_0339892 3300037466 Bacteria 1432
172 Ga0395898_0395247 3300037466 Bacteria 1318
173 Ga0395901_0022982 3300038443 Bacteria 6391
174 Ga0395901_0384318 3300038443 Bacteria 1444
175 Ga0439436_0065330 3300041404 Bacteria 1016
176 Ga0439461_0018899 3300041410 Bacteria 1353
177 Ga0439466_0126556 3300041411 Bacteria 787
178 Ga0439466_0154131 3300041411 Bacteria 703
179 Ga0439433_0018790 3300041999 Bacteria 1539
180 Ga0439433_0076863 3300041999 Bacteria 808
181 Ga0439442_000078 3300042002 Bacteria 23033
182 Ga0439442_002586 3300042002 Bacteria 3550
183 Ga0439442_003319 3300042002 Bacteria 3183
184 Ga0439442_019280 3300042002 Bacteria 1411
185 Ga0439449_0001566 3300042007 Bacteria 8965
186 Ga0439449_0020450 3300042007 Bacteria 2480
187 Ga0439449_0046126 3300042007 Bacteria 1614
188 Ga0439449_0259531 3300042007 Bacteria 654
189 Ga0439457_000878 3300042014 Bacteria 9076
190 Ga0439462_0008876 3300042015 Bacteria 2541
191 Ga0450920_011614 3300042122 Bacteria 1643
192 Ga0450920_037788 3300042122 Bacteria 959
193 Ga0439434_0011154 3300042435 Bacteria 2654
194 Ga0439434_0051098 3300042435 Bacteria 1281
195 Ga0466965_0214146 3300044683 Bacteria 1025
196 Ga0466967_0468575 3300045976 Bacteria 1233
197 Ga0495629_0496592 3300046459 Bacteria 823
198 Ga0495653_0041411 3300046463 Bacteria 3595
199 Ga0495580_0044356 3300046472 Bacteria 3163
200 Ga0495582_0195009 3300046473 Bacteria 1156
201 Ga0495639_0293632 3300046475 Bacteria 809
202 Ga0495662_0069853 3300046476 Bacteria 1702
203 Ga0495664_0088577 3300046477 Bacteria 1860
204 Ga0495594_0111295 3300046499 Bacteria 1544
205 Ga0495630_0492533 3300046517 Bacteria 940
206 Ga0495631_0158182 3300046518 Bacteria 972
207 Ga0495642_0160340 3300046528 Bacteria 975
208 Ga0495665_0149027 3300046531 Bacteria 1221
209 Ga0495665_0392714 3300046531 Bacteria 704
210 Ga0495586_0011384 3300046535 Bacteria 4731
211 Ga0495586_0054693 3300046535 Bacteria 2164
212 Ga0495586_0103210 3300046535 Bacteria 1583
213 Ga0495586_0216795 3300046535 Bacteria 1087
214 Ga0495587_0016424 3300046536 Bacteria 4604
215 Ga0495597_0287973 3300046542 Bacteria 639
216 Ga0495645_0024462 3300046543 Bacteria 4382
217 Ga0495667_0031962 3300046559 Bacteria 3529
218 Ga0495656_0002490 3300046615 Bacteria 6128
219 Ga0495668_0209744 3300046616 Bacteria 1067
220 Ga0495635_0456140 3300046663 Bacteria 845
221 Ga0495659_0065058 3300046664 Bacteria 1355
222 Ga0495588_0017198 3300046674 Bacteria 3506
223 Ga0495588_0087637 3300046674 Bacteria 1628
224 Ga0495588_0285525 3300046674 Bacteria 869
225 Ga0495670_0006354 3300046691 Bacteria 5803
226 Ga0495670_0026047 3300046691 Bacteria 2895
227 Ga0495670_0165112 3300046691 Bacteria 1165
228 Ga0495600_0055003 3300046809 Bacteria 2599
229 Ga0495600_0466415 3300046809 Bacteria 779
230 Ga0495600_0809989 3300046809 Bacteria 557
231 Ga0495660_0305393 3300046810 Bacteria 720
232 Ga0495581_0310865 3300047315 Bacteria 921
233 Ga0495672_0293676 3300047320 Bacteria 772
234 Ga0495680_0611637 3300047322 Bacteria 728
235 Ga0495675_0003852 3300047444 Bacteria 9086
236 Ga0495677_0079193 3300047445 Bacteria 1230
237 Ga0495684_0082463 3300047471 Bacteria 2440
238 Ga0495593_0020653 3300047673 Bacteria 3686
239 Ga0496100_0111569 3300048903 Bacteria 1900
240 Ga0496101_0105333 3300048904 Bacteria 2116
241 Ga0496101_0156729 3300048904 Bacteria 1744
242 Ga0496101_0862014 3300048904 Bacteria 713
243 Ga0496102_0315685 3300048905 Bacteria 1472
244 Ga0496102_0450458 3300048905 Bacteria 1207
245 Ga0496102_0607694 3300048905 Bacteria 1016
246 Ga0496102_0869410 3300048905 Bacteria 823
247 Ga0496103_0271715 3300048906 Bacteria 1090
248 Ga0496103_0487258 3300048906 Bacteria 789
249 Ga0496104_0245897 3300048907 Bacteria 1701
250 Ga0496106_0005583 3300048909 Bacteria 9314
251 Ga0496106_0548563 3300048909 Bacteria 927
252 Ga0496107_0054369 3300048910 Bacteria 2889
253 Ga0496107_0576510 3300048910 Bacteria 832
254 Ga0496108_0477424 3300048911 Bacteria 1089
255 Ga0496109_0732781 3300048912 Bacteria 926
256 Ga0496110_0221498 3300048913 Bacteria 1720
257 Ga0496110_0579638 3300048913 Bacteria 1018
258 Ga0496110_1144702 3300048913 Bacteria 686
259 Ga0496111_0714015 3300048914 Bacteria 728
260 Ga0496113_0181495 3300048916 Bacteria 1668
261 Ga0496113_0376719 3300048916 Bacteria 1139
262 Ga0496113_0635823 3300048916 Bacteria 854
263 Ga0496113_0809385 3300048916 Bacteria 744
264 Ga0496114_0085626 3300048917 Bacteria 2669
265 Ga0496115_1047470 3300048918 Bacteria 621
266 Ga0496124_0312896 3300048927 Bacteria 1128
267 Ga0496126_0000003 3300048929 Bacteria 961576
268 Ga0501032_0002711 3300049569 Bacteria 13809
269 Ga0501032_0023986 3300049569 Bacteria 4214
270 Ga0501033_0127502 3300049570 Bacteria 1845
271 Ga0501033_0651638 3300049570 Bacteria 719
272 Ga0501034_0086010 3300049571 Bacteria 3145
273 Ga0501036_0077095 3300049572 Bacteria 2820
274 Ga0501037_0070090 3300049573 Bacteria 2551
275 Ga0501038_0031837 3300049574 Bacteria 4658
276 Ga0501038_0058608 3300049574 Bacteria 3301
277 Ga0501038_0065316 3300049574 Bacteria 3100
278 Ga0501039_0009621 3300049575 Bacteria 7368
279 Ga0501039_0113938 3300049575 Bacteria 2115
280 Ga0501039_0203295 3300049575 Bacteria 1557
281 Ga0501039_0571494 3300049575 Bacteria 887
282 Ga0501040_0016763 3300049576 Bacteria 4857
283 Ga0501043_0197717 3300049579 Bacteria 1561
284 Ga0501043_0739791 3300049579 Bacteria 716
285 Ga0501046_0122435 3300049580 Bacteria 1978
286 Ga0501047_0071008 3300049581 Bacteria 3352
287 Ga0501047_0401865 3300049581 Bacteria 1203
288 Ga0501048_0505772 3300049582 Bacteria 866
289 Ga0501048_0613347 3300049582 Bacteria 781
290 Ga0501070_0600519 3300049586 Bacteria 877
291 Ga0501070_0916234 3300049586 Bacteria 683
292 Ga0501071_0145388 3300049587 Bacteria 1767
293 Ga0501214_046580 3300049659 Bacteria 647
294 Ga0501250_096900 3300049680 Bacteria 521
295 Ga0501251_059208 3300049681 Bacteria 627
296 Ga0501079_0130565 3300049741 Bacteria 1955
297 Ga0501083_0088177 3300049744 Bacteria 2051
298 Ga0501279_005069 3300049775 Bacteria 1727
299 Ga0501035_0241265 3300049822 Bacteria 1537
300 nmdc:mga03683_193018_c1 3300050489 Bacteria 932
301 nmdc:mga03683_22402_c1 3300050489 Bacteria 2449
302 nmdc:mga03n38_826734_c1 3300050490 Bacteria 541
303 nmdc:mga00v17_617517_c1 3300050491 Unclassified 698
304 nmdc:mga00v17_658957_c1 3300050491 Bacteria 673
305 Ga0501084_0433707 3300054114 Bacteria 1111
306 Ga0501082_0125538 3300060353 Bacteria 2226
307 Ga0501082_0386912 3300060353 Bacteria 1220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049570 Ga0501033_0127502 Ga0501033_0127502_925_1398 149
2 3300049576 Ga0501040_0016763 Ga0501040_0016763_4056_4529 149
3 3300049587 Ga0501071_0145388 Ga0501071_0145388_1096_1572 150
4 iso_pu_bacteria 2929212328 2929215329 153
5 iso_pu_bacteria 2643221572 2643876612 154
6 iso_pu_bacteria 2643221669 2644383667 154
7 iso_pu_bacteria 2895660088 2895660820 154
8 iso_pu_bacteria 2939660829 2939662150 155
9 iso_pu_bacteria 2974315732 2974318326 155
10 iso_pu_bacteria 2984523437 2984526536 155
11 iso_pu_bacteria 2690315906 2691512798 156
12 iso_pu_bacteria 2775506735 2775658472 156
13 iso_pu_bacteria 2808606357 2808830087 156
14 iso_pu_bacteria 2808606360 2808851263 156
15 iso_pu_bacteria 2808606366 2808876212 156
16 iso_pu_bacteria 2808606370 2808894331 156
17 iso_pu_bacteria 2808606371 2808897714 156
18 iso_pu_bacteria 2811994871 2812318137 156
19 iso_pu_bacteria 2939598168 2939599391 156
20 iso_pu_bacteria 2945916053 2945920235 156
21 iso_pu_bacteria 2945920336 2945923896 156
22 iso_pu_bacteria 2945941187 2945944445 156
23 iso_pu_bacteria 2946037020 2946040360 156
24 iso_pu_bacteria 2953998280 2954001628 156
25 iso_pu_bacteria 2974302888 2974303794 156
26 3300003323 rootH1_10200497 rootH1_102004972 157
27 3300006038 Ga0075365_10863620 Ga0075365_108636201 157
28 3300006051 Ga0075364_10721203 Ga0075364_107212031 157
29 3300006058 Ga0075432_10092715 Ga0075432_100927151 157
30 3300006177 Ga0075362_10217827 Ga0075362_102178272 157
31 3300009147 Ga0114129_10442741 Ga0114129_104427411 157
32 3300013102 Ga0157371_10002620 Ga0157371_1000262018 157
33 3300014497 Ga0182008_10593217 Ga0182008_105932172 157
34 3300026116 Ga0207674_10221945 Ga0207674_102219452 157
35 3300031548 Ga0307408_100576345 Ga0307408_1005763452 157
36 3300031731 Ga0307405_10131415 Ga0307405_101314152 157
37 3300031824 Ga0307413_10123783 Ga0307413_101237832 157
38 3300031824 Ga0307413_10548403 Ga0307413_105484032 157
39 3300031852 Ga0307410_10011270 Ga0307410_100112703 157
40 3300031852 Ga0307410_10132578 Ga0307410_101325784 157
41 3300031903 Ga0307407_10206793 Ga0307407_102067932 157
42 3300031911 Ga0307412_10164354 Ga0307412_101643542 157
43 3300031911 Ga0307412_10182302 Ga0307412_101823023 157
44 3300031995 Ga0307409_100873144 Ga0307409_1008731442 157
45 3300032002 Ga0307416_100151833 Ga0307416_1001518332 157
46 3300032002 Ga0307416_100328002 Ga0307416_1003280023 157
47 3300032005 Ga0307411_11649924 Ga0307411_116499241 157
48 3300032126 Ga0307415_100073874 Ga0307415_1000738743 157
49 3300041404 Ga0439436_0065330 Ga0439436_0065330_262_735 157
50 3300041411 Ga0439466_0154131 Ga0439466_0154131_31_504 157
51 3300042007 Ga0439449_0046126 Ga0439449_0046126_1017_1490 157
52 3300047320 Ga0495672_0293676 Ga0495672_0293676_270_743 157
53 3300049659 Ga0501214_046580 Ga0501214_046580_98_571 157
54 3300049681 Ga0501251_059208 Ga0501251_059208_49_522 157
55 3300050489 nmdc:mga03683_193018_c1 nmdc:mga03683_193018_c1_121_594 157
56 3300050491 nmdc:mga00v17_617517_c1 nmdc:mga00v17_617517_c1_156_629 157
57 iso_pu_bacteria 2537561592 2537897480 157
58 iso_pu_bacteria 2585428094 2587863466 157
59 iso_pu_bacteria 2643221649 2644278065 157
60 3300006048 Ga0075363_100175576 Ga0075363_1001755763 158
61 3300006051 Ga0075364_10151006 Ga0075364_101510061 158
62 3300006177 Ga0075362_10044266 Ga0075362_100442664 158
63 3300032005 Ga0307411_10954735 Ga0307411_109547352 158
64 3300049575 Ga0501039_0113938 Ga0501039_0113938_758_1234 158
65 3300049741 Ga0501079_0130565 Ga0501079_0130565_583_1059 158
66 3300050489 nmdc:mga03683_22402_c1 nmdc:mga03683_22402_c1_1339_1815 158
67 3300050490 nmdc:mga03n38_826734_c1 nmdc:mga03n38_826734_c1_38_514 158
68 3300050491 nmdc:mga00v17_658957_c1 nmdc:mga00v17_658957_c1_155_631 158
69 iso_pu_bacteria 2946059875 2946063952 158
70 3300013306 Ga0163162_10172261 Ga0163162_101722612 159
71 3300048929 Ga0496126_0000003 Ga0496126_0000003_478196_478675 159
72 3300005288 Ga0065714_10076581 Ga0065714_100765814 160
73 3300005288 Ga0065714_10179010 Ga0065714_101790102 160
74 3300005328 Ga0070676_10028037 Ga0070676_100280372 160
75 3300005331 Ga0070670_100490704 Ga0070670_1004907042 160
76 3300005333 Ga0070677_10028423 Ga0070677_100284232 160
77 3300005335 Ga0070666_10094780 Ga0070666_100947802 160
78 3300005347 Ga0070668_100078875 Ga0070668_1000788753 160
79 3300005353 Ga0070669_100420819 Ga0070669_1004208191 160
80 3300005356 Ga0070674_100020814 Ga0070674_1000208141 160
81 3300005364 Ga0070673_100079281 Ga0070673_1000792813 160
82 3300005367 Ga0070667_100010065 Ga0070667_1000100654 160
83 3300005456 Ga0070678_100058083 Ga0070678_1000580832 160
84 3300005548 Ga0070665_100486640 Ga0070665_1004866403 160
85 3300009011 Ga0105251_10074653 Ga0105251_100746533 160
86 3300009036 Ga0105244_10167367 Ga0105244_101673672 160
87 3300009098 Ga0105245_10968617 Ga0105245_109686172 160
88 3300009148 Ga0105243_11172068 Ga0105243_111720681 160
89 3300009177 Ga0105248_10085325 Ga0105248_100853253 160
90 3300009551 Ga0105238_10368558 Ga0105238_103685582 160
91 3300011119 Ga0105246_10011186 Ga0105246_100111861 160
92 3300011119 Ga0105246_10524032 Ga0105246_105240322 160
93 3300013100 Ga0157373_10076479 Ga0157373_100764792 160
94 3300013105 Ga0157369_10116567 Ga0157369_101165673 160
95 3300013105 Ga0157369_10464667 Ga0157369_104646672 160
96 3300013306 Ga0163162_10523748 Ga0163162_105237483 160
97 3300013306 Ga0163162_10569150 Ga0163162_105691501 160
98 3300013306 Ga0163162_11205124 Ga0163162_112051242 160
99 3300013308 Ga0157375_10240511 Ga0157375_102405113 160
100 3300017792 Ga0163161_10031311 Ga0163161_100313114 160
101 3300020080 Ga0206350_11268510 Ga0206350_112685101 160
102 3300025254 Ga0209148_1002289 Ga0209148_10022895 160
103 3300025315 Ga0207697_10031404 Ga0207697_100314042 160
104 3300025728 Ga0207655_1124813 Ga0207655_11248132 160
105 3300025735 Ga0207713_1154333 Ga0207713_11543331 160
106 3300025907 Ga0207645_10029223 Ga0207645_100292234 160
107 3300025923 Ga0207681_10210144 Ga0207681_102101442 160
108 3300025926 Ga0207659_10414836 Ga0207659_104148362 160
109 3300025931 Ga0207644_10220492 Ga0207644_102204923 160
110 3300025935 Ga0207709_10057401 Ga0207709_100574013 160
111 3300025937 Ga0207669_10112532 Ga0207669_101125321 160
112 3300025940 Ga0207691_10004828 Ga0207691_100048287 160
113 3300025941 Ga0207711_10954038 Ga0207711_109540382 160
114 3300025960 Ga0207651_10029714 Ga0207651_100297144 160
115 3300025972 Ga0207668_10119489 Ga0207668_101194893 160
116 3300025986 Ga0207658_11032624 Ga0207658_110326241 160
117 3300026121 Ga0207683_10757829 Ga0207683_107578292 160
118 3300031548 Ga0307408_100010595 Ga0307408_1000105952 160
119 3300031548 Ga0307408_100020337 Ga0307408_1000203376 160
120 3300031548 Ga0307408_100021241 Ga0307408_1000212415 160
121 3300031548 Ga0307408_100065989 Ga0307408_1000659892 160
122 3300031548 Ga0307408_100257455 Ga0307408_1002574553 160
123 3300031548 Ga0307408_100716915 Ga0307408_1007169151 160
124 3300031548 Ga0307408_100759644 Ga0307408_1007596441 160
125 3300031548 Ga0307408_101313794 Ga0307408_1013137942 160
126 3300031731 Ga0307405_10029969 Ga0307405_100299692 160
127 3300031731 Ga0307405_10069228 Ga0307405_100692283 160
128 3300031731 Ga0307405_10282790 Ga0307405_102827902 160
129 3300031731 Ga0307405_10305048 Ga0307405_103050481 160
130 3300031731 Ga0307405_10333174 Ga0307405_103331742 160
131 3300031731 Ga0307405_10388876 Ga0307405_103888762 160
132 3300031731 Ga0307405_11425002 Ga0307405_114250021 160
133 3300031731 Ga0307405_11566477 Ga0307405_115664771 160
134 3300031824 Ga0307413_10012518 Ga0307413_100125183 160
135 3300031824 Ga0307413_10040376 Ga0307413_100403764 160
136 3300031824 Ga0307413_10074795 Ga0307413_100747952 160
137 3300031824 Ga0307413_10788426 Ga0307413_107884261 160
138 3300031824 Ga0307413_10888671 Ga0307413_108886711 160
139 3300031852 Ga0307410_10176412 Ga0307410_101764121 160
140 3300031852 Ga0307410_10303733 Ga0307410_103037332 160
141 3300031852 Ga0307410_10492295 Ga0307410_104922951 160
142 3300031852 Ga0307410_10638966 Ga0307410_106389662 160
143 3300031901 Ga0307406_10040561 Ga0307406_100405612 160
144 3300031901 Ga0307406_10677895 Ga0307406_106778952 160
145 3300031903 Ga0307407_10007057 Ga0307407_100070572 160
146 3300031903 Ga0307407_10008443 Ga0307407_100084435 160
147 3300031903 Ga0307407_10076938 Ga0307407_100769382 160
148 3300031903 Ga0307407_10080390 Ga0307407_100803903 160
149 3300031903 Ga0307407_10119207 Ga0307407_101192072 160
150 3300031903 Ga0307407_10192887 Ga0307407_101928871 160
151 3300031911 Ga0307412_10034548 Ga0307412_100345485 160
152 3300031911 Ga0307412_10047628 Ga0307412_100476284 160
153 3300031911 Ga0307412_10049718 Ga0307412_100497184 160
154 3300031911 Ga0307412_10056891 Ga0307412_100568913 160
155 3300031911 Ga0307412_10064353 Ga0307412_100643531 160
156 3300031911 Ga0307412_10283159 Ga0307412_102831591 160
157 3300031911 Ga0307412_10371710 Ga0307412_103717102 160
158 3300031911 Ga0307412_11262832 Ga0307412_112628321 160
159 3300031995 Ga0307409_100021286 Ga0307409_1000212863 160
160 3300031995 Ga0307409_100082770 Ga0307409_1000827702 160
161 3300031995 Ga0307409_100089856 Ga0307409_1000898564 160
162 3300031995 Ga0307409_100108181 Ga0307409_1001081813 160
163 3300031995 Ga0307409_100326399 Ga0307409_1003263991 160
164 3300031995 Ga0307409_100339520 Ga0307409_1003395202 160
165 3300031995 Ga0307409_100464299 Ga0307409_1004642992 160
166 3300032002 Ga0307416_100093570 Ga0307416_1000935704 160
167 3300032002 Ga0307416_100095489 Ga0307416_1000954892 160
168 3300032002 Ga0307416_100120808 Ga0307416_1001208082 160
169 3300032002 Ga0307416_100162529 Ga0307416_1001625292 160
170 3300032002 Ga0307416_100502409 Ga0307416_1005024092 160
171 3300032002 Ga0307416_100556224 Ga0307416_1005562242 160
172 3300032002 Ga0307416_100610646 Ga0307416_1006106463 160
173 3300032002 Ga0307416_100621212 Ga0307416_1006212121 160
174 3300032002 Ga0307416_100662973 Ga0307416_1006629732 160
175 3300032002 Ga0307416_100796346 Ga0307416_1007963462 160
176 3300032002 Ga0307416_100953669 Ga0307416_1009536692 160
177 3300032002 Ga0307416_102668261 Ga0307416_1026682611 160
178 3300032004 Ga0307414_10250377 Ga0307414_102503773 160
179 3300032004 Ga0307414_10642977 Ga0307414_106429772 160
180 3300032005 Ga0307411_10008344 Ga0307411_100083442 160
181 3300032005 Ga0307411_10033735 Ga0307411_100337352 160
182 3300032005 Ga0307411_10168917 Ga0307411_101689172 160
183 3300032126 Ga0307415_100084477 Ga0307415_1000844772 160
184 3300032126 Ga0307415_100958409 Ga0307415_1009584092 160
185 3300037312 Ga0395899_0100279 Ga0395899_0100279_128_610 160
186 3300037418 Ga0395900_0331761 Ga0395900_0331761_267_749 160
187 3300037466 Ga0395898_0395247 Ga0395898_0395247_419_901 160
188 3300038443 Ga0395901_0384318 Ga0395901_0384318_585_1067 160
189 3300041999 Ga0439433_0076863 Ga0439433_0076863_278_760 160
190 3300042002 Ga0439442_000078 Ga0439442_000078_21500_21982 160
191 3300042002 Ga0439442_003319 Ga0439442_003319_59_541 160
192 3300042002 Ga0439442_019280 Ga0439442_019280_181_663 160
193 3300042007 Ga0439449_0020450 Ga0439449_0020450_1841_2323 160
194 3300042007 Ga0439449_0259531 Ga0439449_0259531_28_510 160
195 3300042122 Ga0450920_011614 Ga0450920_011614_10_492 160
196 3300042122 Ga0450920_037788 Ga0450920_037788_131_613 160
197 3300042435 Ga0439434_0051098 Ga0439434_0051098_25_507 160
198 3300046459 Ga0495629_0496592 Ga0495629_0496592_21_503 160
199 3300046463 Ga0495653_0041411 Ga0495653_0041411_1569_2051 160
200 3300046472 Ga0495580_0044356 Ga0495580_0044356_393_875 160
201 3300046473 Ga0495582_0195009 Ga0495582_0195009_368_850 160
202 3300046475 Ga0495639_0293632 Ga0495639_0293632_284_766 160
203 3300046476 Ga0495662_0069853 Ga0495662_0069853_540_1022 160
204 3300046477 Ga0495664_0088577 Ga0495664_0088577_1359_1841 160
205 3300046499 Ga0495594_0111295 Ga0495594_0111295_746_1228 160
206 3300046517 Ga0495630_0492533 Ga0495630_0492533_328_810 160
207 3300046518 Ga0495631_0158182 Ga0495631_0158182_337_819 160
208 3300046528 Ga0495642_0160340 Ga0495642_0160340_197_679 160
209 3300046531 Ga0495665_0149027 Ga0495665_0149027_638_1120 160
210 3300046531 Ga0495665_0392714 Ga0495665_0392714_52_534 160
211 3300046535 Ga0495586_0011384 Ga0495586_0011384_3260_3742 160
212 3300046535 Ga0495586_0103210 Ga0495586_0103210_1006_1488 160
213 3300046535 Ga0495586_0216795 Ga0495586_0216795_581_1063 160
214 3300046536 Ga0495587_0016424 Ga0495587_0016424_29_511 160
215 3300046542 Ga0495597_0287973 Ga0495597_0287973_15_497 160
216 3300046543 Ga0495645_0024462 Ga0495645_0024462_62_544 160
217 3300046559 Ga0495667_0031962 Ga0495667_0031962_394_876 160
218 3300046615 Ga0495656_0002490 Ga0495656_0002490_5634_6116 160
219 3300046616 Ga0495668_0209744 Ga0495668_0209744_291_773 160
220 3300046663 Ga0495635_0456140 Ga0495635_0456140_340_822 160
221 3300046664 Ga0495659_0065058 Ga0495659_0065058_582_1064 160
222 3300046674 Ga0495588_0017198 Ga0495588_0017198_2624_3106 160
223 3300046674 Ga0495588_0087637 Ga0495588_0087637_704_1186 160
224 3300046674 Ga0495588_0285525 Ga0495588_0285525_94_576 160
225 3300046691 Ga0495670_0006354 Ga0495670_0006354_3942_4424 160
226 3300046691 Ga0495670_0026047 Ga0495670_0026047_1565_2047 160
227 3300046691 Ga0495670_0165112 Ga0495670_0165112_607_1089 160
228 3300046809 Ga0495600_0055003 Ga0495600_0055003_667_1149 160
229 3300046809 Ga0495600_0466415 Ga0495600_0466415_261_743 160
230 3300046809 Ga0495600_0809989 Ga0495600_0809989_39_521 160
231 3300046810 Ga0495660_0305393 Ga0495660_0305393_186_668 160
232 3300047315 Ga0495581_0310865 Ga0495581_0310865_141_623 160
233 3300047322 Ga0495680_0611637 Ga0495680_0611637_182_664 160
234 3300047444 Ga0495675_0003852 Ga0495675_0003852_6876_7358 160
235 3300047445 Ga0495677_0079193 Ga0495677_0079193_321_803 160
236 3300047471 Ga0495684_0082463 Ga0495684_0082463_416_898 160
237 3300047673 Ga0495593_0020653 Ga0495593_0020653_200_682 160
238 3300048903 Ga0496100_0111569 Ga0496100_0111569_1371_1853 160
239 3300048904 Ga0496101_0105333 Ga0496101_0105333_1082_1564 160
240 3300048904 Ga0496101_0156729 Ga0496101_0156729_1224_1706 160
241 3300048904 Ga0496101_0862014 Ga0496101_0862014_54_536 160
242 3300048905 Ga0496102_0315685 Ga0496102_0315685_38_520 160
243 3300048905 Ga0496102_0450458 Ga0496102_0450458_404_886 160
244 3300048905 Ga0496102_0607694 Ga0496102_0607694_181_663 160
245 3300048905 Ga0496102_0869410 Ga0496102_0869410_288_770 160
246 3300048906 Ga0496103_0271715 Ga0496103_0271715_398_880 160
247 3300048906 Ga0496103_0487258 Ga0496103_0487258_21_503 160
248 3300048907 Ga0496104_0245897 Ga0496104_0245897_512_994 160
249 3300048909 Ga0496106_0005583 Ga0496106_0005583_486_968 160
250 3300048909 Ga0496106_0548563 Ga0496106_0548563_165_647 160
251 3300048910 Ga0496107_0054369 Ga0496107_0054369_1581_2063 160
252 3300048910 Ga0496107_0576510 Ga0496107_0576510_15_497 160
253 3300048911 Ga0496108_0477424 Ga0496108_0477424_261_743 160
254 3300048912 Ga0496109_0732781 Ga0496109_0732781_126_608 160
255 3300048913 Ga0496110_0221498 Ga0496110_0221498_718_1200 160
256 3300048913 Ga0496110_0579638 Ga0496110_0579638_183_665 160
257 3300048913 Ga0496110_1144702 Ga0496110_1144702_142_624 160
258 3300048914 Ga0496111_0714015 Ga0496111_0714015_136_618 160
259 3300048916 Ga0496113_0181495 Ga0496113_0181495_891_1373 160
260 3300048916 Ga0496113_0376719 Ga0496113_0376719_124_606 160
261 3300048916 Ga0496113_0635823 Ga0496113_0635823_271_753 160
262 3300048917 Ga0496114_0085626 Ga0496114_0085626_1371_1853 160
263 3300048918 Ga0496115_1047470 Ga0496115_1047470_17_499 160
264 3300048927 Ga0496124_0312896 Ga0496124_0312896_76_558 160
265 3300049569 Ga0501032_0002711 Ga0501032_0002711_12167_12649 160
266 3300049573 Ga0501037_0070090 Ga0501037_0070090_80_562 160
267 3300049574 Ga0501038_0058608 Ga0501038_0058608_160_642 160
268 3300049574 Ga0501038_0065316 Ga0501038_0065316_1827_2309 160
269 3300049575 Ga0501039_0009621 Ga0501039_0009621_4509_4991 160
270 3300049575 Ga0501039_0203295 Ga0501039_0203295_1065_1547 160
271 3300049579 Ga0501043_0197717 Ga0501043_0197717_693_1175 160
272 3300049581 Ga0501047_0401865 Ga0501047_0401865_169_651 160
273 3300049586 Ga0501070_0916234 Ga0501070_0916234_115_597 160
274 3300049680 Ga0501250_096900 Ga0501250_096900_14_496 160
275 3300049775 Ga0501279_005069 Ga0501279_005069_29_511 160
276 3300013307 Ga0157372_12327839 Ga0157372_123278391 161
277 3300031548 Ga0307408_100143068 Ga0307408_1001430682 161
278 3300031824 Ga0307413_10443758 Ga0307413_104437582 161
279 3300031852 Ga0307410_10844414 Ga0307410_108444142 161
280 3300031901 Ga0307406_10607681 Ga0307406_106076811 161
281 3300031911 Ga0307412_10223958 Ga0307412_102239582 161
282 3300031995 Ga0307409_100055893 Ga0307409_1000558932 161
283 3300032002 Ga0307416_100641950 Ga0307416_1006419502 161
284 3300044683 Ga0466965_0214146 Ga0466965_0214146_422_907 161
285 3300045976 Ga0466967_0468575 Ga0466967_0468575_291_776 161
286 iso_pu_bacteria 8054107350 8054109123 161
287 3300013105 Ga0157369_10263581 Ga0157369_102635813 162
288 3300037312 Ga0395899_0310261 Ga0395899_0310261_466_954 162
289 3300037418 Ga0395900_0402682 Ga0395900_0402682_171_659 162
290 3300038443 Ga0395901_0022982 Ga0395901_0022982_2412_2900 162
291 3300046535 Ga0495586_0054693 Ga0495586_0054693_1099_1587 162
292 3300048916 Ga0496113_0809385 Ga0496113_0809385_58_546 162
293 3300013307 Ga0157372_10468280 Ga0157372_104682802 163
294 3300049570 Ga0501033_0651638 Ga0501033_0651638_199_690 163
295 3300049574 Ga0501038_0031837 Ga0501038_0031837_3538_4029 163
296 3300049575 Ga0501039_0571494 Ga0501039_0571494_366_857 163
297 3300049579 Ga0501043_0739791 Ga0501043_0739791_126_617 163
298 3300049581 Ga0501047_0071008 Ga0501047_0071008_262_753 163
299 3300049582 Ga0501048_0613347 Ga0501048_0613347_247_738 163
300 3300049822 Ga0501035_0241265 Ga0501035_0241265_471_962 163
301 3300060353 Ga0501082_0125538 Ga0501082_0125538_1214_1705 163
302 3300049569 Ga0501032_0023986 Ga0501032_0023986_3511_4005 164
303 3300049571 Ga0501034_0086010 Ga0501034_0086010_863_1357 164
304 3300049572 Ga0501036_0077095 Ga0501036_0077095_567_1061 164
305 3300049580 Ga0501046_0122435 Ga0501046_0122435_649_1143 164
306 3300049582 Ga0501048_0505772 Ga0501048_0505772_200_694 164
307 3300049586 Ga0501070_0600519 Ga0501070_0600519_157_651 164
308 3300049744 Ga0501083_0088177 Ga0501083_0088177_505_999 164
309 3300054114 Ga0501084_0433707 Ga0501084_0433707_484_978 164
310 3300060353 Ga0501082_0386912 Ga0501082_0386912_536_1030 164
311 3300030742 Ga0316183_1124055 Ga0316183_11240552 165
312 3300037466 Ga0395898_0339892 Ga0395898_0339892_885_1388 166
313 3300041410 Ga0439461_0018899 Ga0439461_0018899_48_557 166
314 3300041411 Ga0439466_0126556 Ga0439466_0126556_82_591 166
315 3300041999 Ga0439433_0018790 Ga0439433_0018790_721_1230 166
316 3300042007 Ga0439449_0001566 Ga0439449_0001566_654_1163 166
317 3300042014 Ga0439457_000878 Ga0439457_000878_3670_4179 166
318 3300042015 Ga0439462_0008876 Ga0439462_0008876_1523_2032 166
319 3300042435 Ga0439434_0011154 Ga0439434_0011154_388_897 166
320 3300031852 Ga0307410_11294189 Ga0307410_112941892 167
321 3300005364 Ga0070673_101050163 Ga0070673_1010501631 168
322 3300000549 LJQas_1008602 LJQas_10086023 170
323 3300006058 Ga0075432_10035611 Ga0075432_100356113 170
324 3300031548 Ga0307408_100072324 Ga0307408_1000723242 170
325 3300031731 Ga0307405_10045196 Ga0307405_100451963 170
326 3300031852 Ga0307410_10122951 Ga0307410_101229512 170
327 3300031901 Ga0307406_10655420 Ga0307406_106554201 170
328 3300031903 Ga0307407_10038566 Ga0307407_100385663 170
329 3300031911 Ga0307412_10184209 Ga0307412_101842093 170
330 3300031995 Ga0307409_100047475 Ga0307409_1000474753 170
331 3300032002 Ga0307416_100007605 Ga0307416_1000076052 170
332 3300032004 Ga0307414_10693586 Ga0307414_106935862 170
333 3300032126 Ga0307415_100253081 Ga0307415_1002530812 170
334 3300042002 Ga0439442_002586 Ga0439442_002586_388_939 170

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

23

156

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9497 5 162
3pu2-assembly4.cif.gz_D crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9172 5 157
1xuv-assembly2.cif.gz_B-2 x-ray crystal structure of protein mm0500 from methanosarcina mazei. northeast structural genomics consortium target mar10. 0.9159 5 162
3pu2-assembly2.cif.gz_B crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9156 4 157
3pu2-assembly7.cif.gz_G crystal structure of the q3j4m4_rhos4 protein from rhodobacter sphaeroides. northeast structural genomics consortium target rhr263. 0.9142 6 157
ID Description Score Start End Superfamily
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9278 5 161 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9054 5 161 3.30.530.20
af_Q2G1U9_1_155_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8968 6 155 3.30.530.20
2ldkA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8824 6 157 3.30.530.20
3uidB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8772 6 158 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A846RW82-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.966 1 158
AF-A0A1S2GIB1-F1-model_v4 deleted 0.9608 1 157
AF-A0A542E4W0-F1-model_v4 Uncharacterized protein YndB with AHSA1/START domain 0.9599 1 155
AF-A0A347AK52-F1-model_v4 ATPase 0.9595 3 159
AF-A0A089ZVD4-F1-model_v4 Activator of Hsp90 ATPase 1 family protein (SRPBCC family protein) 0.9593 5 159

Feature Viewer

pLDDT pTM Quality
92.37 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map