F411522

General Info

Members Datasets Scaffolds Average Seq Length
333 174 666 182

Family's Representative Sequence

Representative Sequence 3300048912|Ga0496109_0706155|Ga0496109_0706155_99_689
Length 196
Sequence MDRGARAPAQRGSIVTNKTAAIRYARAVLDVGIKEKADLELIERELTQFADLFTQYPLLEKVLLNPAVPVPRKRAAVAELLAQAKFSPIVSKLLALLADRDRLVLIPDLLASYRERLLEHRHVVRAEVTTAVPLDERRAAAIQRGLASLTGRTVTLATKVDASIIGGLVARIGSTVYDGSVTRQLEKMKERLVESV

Samples

Sample ID Description Type Environment
1 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
121 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
124 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
125 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
131 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
132 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
139 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
144 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
150 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
151 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
158 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
159 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
160 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
161 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
162 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
163 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
164 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
165 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
166 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
167 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
168 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
172 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
173 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
174 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.5
Nodule 0
Rhizoplane 5.11
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 13.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496109_0706155 3300048912 Unclassified 946
2 MBSR1b_contig_13775949 2162886012 Bacteria 1101
3 Ga0065714_10268670 3300005288 Unclassified 743
4 Ga0065712_10084508 3300005290 Bacteria 2758
5 Ga0065715_10035668 3300005293 Bacteria 1216
6 Ga0065715_10132118 3300005293 Bacteria 1996
7 Ga0065707_10361101 3300005295 Bacteria 904
8 Ga0070676_10034553 3300005328 Bacteria 2903
9 Ga0070676_10349700 3300005328 Bacteria 1016
10 Ga0070670_100791705 3300005331 Unclassified 856
11 Ga0068869_100877986 3300005334 Bacteria 775
12 Ga0070666_10058487 3300005335 Bacteria 2607
13 Ga0068868_100025962 3300005338 Bacteria 4461
14 Ga0070689_100421931 3300005340 Bacteria 1131
15 Ga0070691_10000425 3300005341 Bacteria 15505
16 Ga0070687_100171708 3300005343 Bacteria 1291
17 Ga0070692_10388475 3300005345 Bacteria 878
18 Ga0070669_100057865 3300005353 Bacteria 2845
19 Ga0070669_100091248 3300005353 Bacteria 2284
20 Ga0070669_100108526 3300005353 Bacteria 2103
21 Ga0070675_100194310 3300005354 Bacteria 1759
22 Ga0070675_100583354 3300005354 Bacteria 1013
23 Ga0070674_100006653 3300005356 Bacteria 6759
24 Ga0070674_100386610 3300005356 Unclassified 1140
25 Ga0070673_100959210 3300005364 Unclassified 795
26 Ga0070688_100039390 3300005365 Bacteria 2891
27 Ga0070688_100066194 3300005365 Bacteria 2299
28 Ga0070688_100393644 3300005365 Unclassified 1024
29 Ga0070659_100705153 3300005366 Bacteria 873
30 Ga0070667_100532099 3300005367 Bacteria 1079
31 Ga0070703_10036971 3300005406 Bacteria 1503
32 Ga0070701_10005706 3300005438 Bacteria 5172
33 Ga0070705_100014418 3300005440 Bacteria 4065
34 Ga0070705_100134547 3300005440 Bacteria 1617
35 Ga0070700_100098865 3300005441 Bacteria 1919
36 Ga0070694_100007560 3300005444 Bacteria 6633
37 Ga0070694_100031404 3300005444 Bacteria 3482
38 Ga0070694_100740692 3300005444 Bacteria 802
39 Ga0070678_100101369 3300005456 Bacteria 2232
40 Ga0070678_100473184 3300005456 Bacteria 1101
41 Ga0070662_100551058 3300005457 Bacteria 966
42 Ga0070662_100984496 3300005457 Unclassified 722
43 Ga0068867_100120572 3300005459 Bacteria 2027
44 Ga0068867_100173263 3300005459 Bacteria 1710
45 Ga0068867_100480283 3300005459 Bacteria 1065
46 Ga0070685_10066191 3300005466 Bacteria 2129
47 Ga0070685_10098862 3300005466 Bacteria 1779
48 Ga0070707_100184038 3300005468 Bacteria 2037
49 Ga0070698_100950465 3300005471 Bacteria 806
50 Ga0070699_100048473 3300005518 Bacteria 3677
51 Ga0070699_100112724 3300005518 Bacteria 2389
52 Ga0070699_100381510 3300005518 Bacteria 1272
53 Ga0070684_100426325 3300005535 Bacteria 1225
54 Ga0070697_100642789 3300005536 Bacteria 934
55 Ga0070697_101030420 3300005536 Bacteria 732
56 Ga0070686_100284568 3300005544 Unclassified 1221
57 Ga0070686_100530173 3300005544 Bacteria 918
58 Ga0070686_100570314 3300005544 Bacteria 888
59 Ga0070695_100077431 3300005545 Bacteria 2191
60 Ga0070696_100061615 3300005546 Bacteria 2624
61 Ga0070696_100972732 3300005546 Bacteria 708
62 Ga0070665_100054275 3300005548 Bacteria 4019
63 Ga0070704_100011011 3300005549 Bacteria 5519
64 Ga0070704_100121177 3300005549 Bacteria 2010
65 Ga0070704_100143875 3300005549 Bacteria 1866
66 Ga0070704_101059576 3300005549 Unclassified 735
67 Ga0068854_100062846 3300005578 Bacteria 2694
68 Ga0070702_100004567 3300005615 Bacteria 6336
69 Ga0068859_100092268 3300005617 Bacteria 3080
70 Ga0068859_100672475 3300005617 Bacteria 1127
71 Ga0068859_100741160 3300005617 Bacteria 1072
72 Ga0068866_10245058 3300005718 Bacteria 1094
73 Ga0068861_100012348 3300005719 Bacteria 5955
74 Ga0068861_100249892 3300005719 Bacteria 1512
75 Ga0068861_100611832 3300005719 Bacteria 1001
76 Ga0068861_100712616 3300005719 Bacteria 934
77 Ga0068863_100722120 3300005841 Unclassified 991
78 Ga0068858_100014130 3300005842 Bacteria 7529
79 Ga0068858_100906300 3300005842 Bacteria 862
80 Ga0068858_101132587 3300005842 Bacteria 768
81 Ga0068860_100691180 3300005843 Bacteria 1029
82 Ga0068862_100078731 3300005844 Bacteria 2856
83 Ga0068862_100194261 3300005844 Bacteria 1827
84 Ga0068862_100549186 3300005844 Bacteria 1103
85 Ga0075368_10034430 3300006042 Bacteria 1974
86 Ga0075367_10369889 3300006178 Bacteria 905
87 Ga0075366_10003690 3300006195 Bacteria 8123
88 Ga0075366_10288630 3300006195 Bacteria 1003
89 Ga0097621_100016671 3300006237 Bacteria 5561
90 Ga0097621_100527470 3300006237 Bacteria 1073
91 Ga0097621_100753348 3300006237 Bacteria 900
92 Ga0068871_100033133 3300006358 Bacteria 4088
93 Ga0068871_100223637 3300006358 Bacteria 1632
94 Ga0075428_100001117 3300006844 Bacteria 28618
95 Ga0075428_100027081 3300006844 Bacteria 6347
96 Ga0075428_100028889 3300006844 Bacteria 6137
97 Ga0075430_100000722 3300006846 Bacteria 25248
98 Ga0075430_100024777 3300006846 Bacteria 5103
99 Ga0075431_100012809 3300006847 Bacteria 8466
100 Ga0075431_100068185 3300006847 Bacteria 3671
101 Ga0075431_100182027 3300006847 Bacteria 2156
102 Ga0075433_10063115 3300006852 Bacteria 3245
103 Ga0075433_10070794 3300006852 Bacteria 3066
104 Ga0075433_10119862 3300006852 Bacteria 2335
105 Ga0075433_10495314 3300006852 Bacteria 1076
106 Ga0075434_100073553 3300006871 Bacteria 3410
107 Ga0075434_100573536 3300006871 Bacteria 1148
108 Ga0075434_101344142 3300006871 Bacteria 725
109 Ga0075429_100026040 3300006880 Bacteria 5077
110 Ga0075429_100026713 3300006880 Bacteria 5012
111 Ga0075429_100065563 3300006880 Bacteria 3162
112 Ga0075429_100807280 3300006880 Unclassified 822
113 Ga0068865_100143233 3300006881 Bacteria 1804
114 Ga0068865_100654364 3300006881 Unclassified 893
115 Ga0097620_100092276 3300006931 Bacteria 3080
116 Ga0097620_100672505 3300006931 Bacteria 1127
117 Ga0097620_100741170 3300006931 Bacteria 1072
118 Ga0075435_100041918 3300007076 Bacteria 3660
119 Ga0075435_100046737 3300007076 Bacteria 3473
120 Ga0075435_101414624 3300007076 Bacteria 610
121 Ga0105240_11126008 3300009093 Bacteria 834
122 Ga0111539_10001383 3300009094 Bacteria 32248
123 Ga0111539_10304307 3300009094 Unclassified 1855
124 Ga0105245_10029066 3300009098 Bacteria 4881
125 Ga0105245_10453385 3300009098 Bacteria 1291
126 Ga0105247_10006319 3300009101 Bacteria 7345
127 Ga0114129_10003540 3300009147 Bacteria 21982
128 Ga0114129_10068296 3300009147 Bacteria 4956
129 Ga0114129_10073681 3300009147 Bacteria 4757
130 Ga0114129_10080067 3300009147 Bacteria 4541
131 Ga0114129_10138570 3300009147 Bacteria 3337
132 Ga0114129_10220750 3300009147 Bacteria 2557
133 Ga0114129_10382935 3300009147 Bacteria 1857
134 Ga0114129_11115399 3300009147 Bacteria 987
135 Ga0105243_10183784 3300009148 Bacteria 1820
136 Ga0105243_10306343 3300009148 Unclassified 1442
137 Ga0105242_10006391 3300009176 Bacteria 9073
138 Ga0105242_10023221 3300009176 Bacteria 4889
139 Ga0105242_10048657 3300009176 Bacteria 3446
140 Ga0105242_10111612 3300009176 Bacteria 2332
141 Ga0105248_10031279 3300009177 Bacteria 5949
142 Ga0105248_10066239 3300009177 Bacteria 4056
143 Ga0105248_10139562 3300009177 Bacteria 2734
144 Ga0105248_10197654 3300009177 Bacteria 2266
145 Ga0105248_10455612 3300009177 Unclassified 1442
146 Ga0105248_10707980 3300009177 Bacteria 1136
147 Ga0105248_10715019 3300009177 Bacteria 1130
148 Ga0105249_10060324 3300009553 Bacteria 3479
149 Ga0105249_10988731 3300009553 Bacteria 910
150 Ga0105246_10125924 3300011119 Bacteria 1905
151 Ga0157374_10135224 3300013296 Bacteria 2389
152 Ga0157374_10483907 3300013296 Bacteria 1241
153 Ga0157378_10105149 3300013297 Bacteria 2581
154 Ga0157378_10278189 3300013297 Bacteria 1612
155 Ga0157378_10676314 3300013297 Bacteria 1050
156 Ga0163162_10874308 3300013306 Unclassified 1013
157 Ga0157375_10111880 3300013308 Bacteria 2830
158 Ga0157375_11486087 3300013308 Bacteria 799
159 Ga0163163_10000001 3300014325 Bacteria 622185
160 Ga0163163_10278722 3300014325 Bacteria 1723
161 Ga0163163_10286790 3300014325 Bacteria 1698
162 Ga0163163_10578179 3300014325 Bacteria 1186
163 Ga0157380_10076289 3300014326 Bacteria 2727
164 Ga0157379_10010535 3300014968 Bacteria 8060
165 Ga0157379_10365531 3300014968 Unclassified 1323
166 Ga0157376_10002539 3300014969 Bacteria 12376
167 Ga0157376_10122391 3300014969 Bacteria 2308
168 Ga0157376_10957994 3300014969 Bacteria 876
169 Ga0207642_10279782 3300025899 Bacteria 959
170 Ga0207680_10099111 3300025903 Bacteria 1869
171 Ga0207680_10138645 3300025903 Bacteria 1611
172 Ga0207693_10385958 3300025915 Bacteria 1095
173 Ga0207681_10121705 3300025923 Bacteria 1914
174 Ga0207681_10134540 3300025923 Bacteria 1832
175 Ga0207650_10196537 3300025925 Bacteria 1614
176 Ga0207659_10672772 3300025926 Archaea 885
177 Ga0207659_10960254 3300025926 Unclassified 735
178 Ga0207687_10210444 3300025927 Bacteria 1525
179 Ga0207687_10298515 3300025927 Unclassified 1297
180 Ga0207687_10309140 3300025927 Bacteria 1276
181 Ga0207706_10311795 3300025933 Bacteria 1370
182 Ga0207686_10004099 3300025934 Bacteria 7817
183 Ga0207686_10547698 3300025934 Unclassified 904
184 Ga0207709_10046311 3300025935 Bacteria 2639
185 Ga0207709_10064154 3300025935 Bacteria 2305
186 Ga0207670_10257522 3300025936 Bacteria 1351
187 Ga0207669_10096456 3300025937 Bacteria 1941
188 Ga0207669_10568303 3300025937 Unclassified 917
189 Ga0207704_10020778 3300025938 Bacteria 3482
190 Ga0207704_11253848 3300025938 Bacteria 633
191 Ga0207691_10202835 3300025940 Bacteria 1725
192 Ga0207691_10295643 3300025940 Bacteria 1392
193 Ga0207711_10091905 3300025941 Bacteria 2670
194 Ga0207711_10399827 3300025941 Bacteria 1276
195 Ga0207711_10438002 3300025941 Bacteria 1216
196 Ga0207711_10489286 3300025941 Bacteria 1146
197 Ga0207711_10996700 3300025941 Unclassified 777
198 Ga0207689_10448187 3300025942 Bacteria 1078
199 Ga0207651_10799618 3300025960 Unclassified 836
200 Ga0207640_11084575 3300025981 Archaea 708
201 Ga0207658_10743997 3300025986 Unclassified 888
202 Ga0207677_10006085 3300026023 Bacteria 6585
203 Ga0207703_10010262 3300026035 Bacteria 7336
204 Ga0207703_10011918 3300026035 Bacteria 6770
205 Ga0207703_10433929 3300026035 Bacteria 1224
206 Ga0207703_10937390 3300026035 Bacteria 830
207 Ga0207639_10249986 3300026041 Bacteria 1546
208 Ga0207708_10064366 3300026075 Bacteria 2801
209 Ga0207708_10249005 3300026075 Unclassified 1431
210 Ga0207641_10555118 3300026088 Bacteria 1120
211 Ga0207641_11445102 3300026088 Bacteria 689
212 Ga0207648_10060032 3300026089 Bacteria 3317
213 Ga0207648_10218162 3300026089 Bacteria 1695
214 Ga0207648_10447129 3300026089 Bacteria 1176
215 Ga0207648_10853392 3300026089 Bacteria 849
216 Ga0207676_10029475 3300026095 Bacteria 4110
217 Ga0207676_10364827 3300026095 Bacteria 1340
218 Ga0207676_10413933 3300026095 Bacteria 1263
219 Ga0207675_100074112 3300026118 Bacteria 3185
220 Ga0207675_100085769 3300026118 Bacteria 2956
221 Ga0207675_101596133 3300026118 Unclassified 673
222 Ga0207683_10139053 3300026121 Bacteria 2187
223 Ga0207428_10000531 3300027907 Bacteria 45546
224 Ga0268266_10027027 3300028379 Bacteria 4882
225 Ga0268266_10039738 3300028379 Bacteria 4007
226 Ga0268265_10087832 3300028380 Bacteria 2475
227 Ga0268265_10332196 3300028380 Bacteria 1381
228 Ga0268265_10337703 3300028380 Bacteria 1370
229 Ga0268265_10385331 3300028380 Bacteria 1291
230 Ga0268265_11048149 3300028380 Archaea 807
231 Ga0268264_10442473 3300028381 Unclassified 1258
232 Ga0268264_10490450 3300028381 Bacteria 1196
233 Ga0268264_10898740 3300028381 Unclassified 889
234 Ga0307408_101202347 3300031548 Unclassified 707
235 Ga0316578_10302881 3300031728 Unclassified 955
236 Ga0307405_10370624 3300031731 Bacteria 1111
237 Ga0316577_10054649 3300031733 Bacteria 2228
238 Ga0307416_100284730 3300032002 Bacteria 1632
239 Ga0307416_101844352 3300032002 Bacteria 708
240 Ga0307411_10055833 3300032005 Bacteria 2600
241 Ga0316580_10133371 3300032139 Unclassified 762
242 Ga0373934_0074388 3300035086 Bacteria 1361
243 Ga0373953_0062325 3300035117 Bacteria 1527
244 Ga0373946_0342006 3300035171 Unclassified 747
245 Ga0373924_0027855 3300035410 Bacteria 2249
246 Ga0373937_0050050 3300036401 Bacteria 3826
247 Ga0373937_0300550 3300036401 Unclassified 1517
248 Ga0373937_0382767 3300036401 Bacteria 1334
249 Ga0316582_0098270 3300036647 Bacteria 1936
250 Ga0316584_0084000 3300036712 Bacteria 2385
251 Ga0316584_0639181 3300036712 Unclassified 734
252 Ga0373925_0095024 3300037068 Bacteria 2283
253 Ga0373925_0677799 3300037068 Unclassified 850
254 Ga0439450_047566 3300042008 Unclassified 1011
255 Ga0439455_0044665 3300042012 Bacteria 1144
256 Ga0439435_0033005 3300042436 Bacteria 1415
257 Ga0439464_0000998 3300042439 Bacteria 6436
258 Ga0466963_0222703 3300044694 Unclassified 1321
259 Ga0451576_0070180 3300045051 Bacteria 3646
260 Ga0451576_0124387 3300045051 Bacteria 2687
261 Ga0495592_0321095 3300046454 Bacteria 1001
262 Ga0495629_0237551 3300046459 Bacteria 1255
263 Ga0495629_0259849 3300046459 Bacteria 1194
264 Ga0495582_0312426 3300046473 Bacteria 904
265 Ga0495664_0426893 3300046477 Bacteria 795
266 Ga0495628_0179366 3300046516 Bacteria 1603
267 Ga0495628_0217559 3300046516 Bacteria 1436
268 Ga0495586_0047025 3300046535 Bacteria 2328
269 Ga0495586_0222178 3300046535 Bacteria 1074
270 Ga0495645_0002325 3300046543 Bacteria 12895
271 Ga0495635_0012681 3300046663 Bacteria 5912
272 Ga0495647_0241638 3300046681 Unclassified 802
273 Ga0495658_0039987 3300046683 Bacteria 2605
274 Ga0495658_0228762 3300046683 Bacteria 1166
275 Ga0495613_0554939 3300046689 Unclassified 768
276 Ga0495613_0733080 3300046689 Unclassified 649
277 Ga0495680_0052077 3300047322 Bacteria 3193
278 Ga0495680_0423033 3300047322 Bacteria 916
279 Ga0495684_0123810 3300047471 Bacteria 1946
280 Ga0496101_0269867 3300048904 Bacteria 1328
281 Ga0496102_0179419 3300048905 Bacteria 1995
282 Ga0496103_0313054 3300048906 Bacteria 1010
283 Ga0496104_0010482 3300048907 Bacteria 8280
284 Ga0496104_0244015 3300048907 Bacteria 1709
285 Ga0496104_0302472 3300048907 Bacteria 1512
286 Ga0496108_0053550 3300048911 Bacteria 3384
287 Ga0496109_0330917 3300048912 Bacteria 1438
288 Ga0496109_0481876 3300048912 Unclassified 1171
289 Ga0496112_0007942 3300048915 Bacteria 9460
290 Ga0496112_0116459 3300048915 Bacteria 2643
291 Ga0496114_0092901 3300048917 Bacteria 2564
292 Ga0496114_0264910 3300048917 Bacteria 1514
293 Ga0496114_0497921 3300048917 Bacteria 1078
294 Ga0496114_0498560 3300048917 Bacteria 1077
295 Ga0496115_0064100 3300048918 Bacteria 2966
296 Ga0501075_0432830 3300049591 Bacteria 1003
297 Ga0501076_0824942 3300049592 Bacteria 765
298 Ga0501235_060280 3300049669 Unclassified 888
299 Ga0501268_039439 3300049765 Bacteria 884
300 nmdc:mga0k408_11909_c1 3300050493 Bacteria 4745
301 nmdc:mga05p37_1511310_c1 3300050507 Unclassified 668
302 nmdc:mga05p37_2516_c1 3300050507 Bacteria 21303
303 nmdc:mga05p37_314578_c1 3300050507 Bacteria 1855
304 nmdc:mga05p37_3977_c1 3300050507 Bacteria 17303
305 nmdc:mga05p37_49937_c1 3300050507 Bacteria 5145
306 nmdc:mga05p37_90181_c1 3300050507 Bacteria 3778
307 nmdc:mga09592_24027_c1 3300050508 Bacteria 5038
308 nmdc:mga09592_440948_c1 3300050508 Unclassified 1124
309 nmdc:mga09592_87782_c1 3300050508 Bacteria 2655
310 nmdc:mga09592_8947_c1 3300050508 Bacteria 8142
311 nmdc:mga0qj67_10426_c1 3300050509 Bacteria 6944
312 nmdc:mga0qj67_19523_c1 3300050509 Bacteria 5179
313 nmdc:mga06r32_133358_c1 3300050510 Bacteria 2458
314 nmdc:mga06r32_28538_c1 3300050510 Bacteria 5224
315 nmdc:mga06r32_86893_c1 3300050510 Bacteria 3051
316 nmdc:mga08y16_6908_c1 3300050511 Bacteria 11900
317 nmdc:mga08y16_97315_c1 3300050511 Bacteria 3065
318 nmdc:mga0n895_1054705_c1 3300050512 Bacteria 792
319 nmdc:mga0rr50_13330_c1 3300050513 Bacteria 3947
320 nmdc:mga0rr50_27361_c1 3300050513 Bacteria 3992
321 nmdc:mga08x19_15791_c1 3300050514 Bacteria 4117
322 nmdc:mga08x19_19533_c1 3300050514 Bacteria 4160
323 nmdc:mga08x19_89690_c1 3300050514 Bacteria 2028
324 nmdc:mga0a205_151744_c1 3300050515 Bacteria 2216
325 nmdc:mga0a205_164642_c1 3300050515 Bacteria 2113
326 nmdc:mga0a205_281044_c1 3300050515 Bacteria 1540
327 nmdc:mga0a205_319965_c1 3300050515 Bacteria 1422
328 Ga0495601_0234412 3300053077 Bacteria 1198
329 Ga0495595_0052238 3300053084 Bacteria 1896
330 Ga0495619_0028429 3300053085 Bacteria 3607
331 Ga0495619_0164907 3300053085 Bacteria 1531
332 Ga0495619_0661117 3300053085 Unclassified 712
333 Ga0501082_0490334 3300060353 Bacteria 1074
334 Ga0496109_0706155
335 MBSR1b_contig_13775949
336 Ga0065714_10268670
337 Ga0065712_10084508
338 Ga0065715_10035668
339 Ga0065715_10132118
340 Ga0065707_10361101
341 Ga0070676_10034553
342 Ga0070676_10349700
343 Ga0070670_100791705
344 Ga0068869_100877986
345 Ga0070666_10058487
346 Ga0068868_100025962
347 Ga0070689_100421931
348 Ga0070691_10000425
349 Ga0070687_100171708
350 Ga0070692_10388475
351 Ga0070669_100057865
352 Ga0070669_100091248
353 Ga0070669_100108526
354 Ga0070675_100194310
355 Ga0070675_100583354
356 Ga0070674_100006653
357 Ga0070674_100386610
358 Ga0070673_100959210
359 Ga0070688_100039390
360 Ga0070688_100066194
361 Ga0070688_100393644
362 Ga0070659_100705153
363 Ga0070667_100532099
364 Ga0070703_10036971
365 Ga0070701_10005706
366 Ga0070705_100014418
367 Ga0070705_100134547
368 Ga0070700_100098865
369 Ga0070694_100007560
370 Ga0070694_100031404
371 Ga0070694_100740692
372 Ga0070678_100101369
373 Ga0070678_100473184
374 Ga0070662_100551058
375 Ga0070662_100984496
376 Ga0068867_100120572
377 Ga0068867_100173263
378 Ga0068867_100480283
379 Ga0070685_10066191
380 Ga0070685_10098862
381 Ga0070707_100184038
382 Ga0070698_100950465
383 Ga0070699_100048473
384 Ga0070699_100112724
385 Ga0070699_100381510
386 Ga0070684_100426325
387 Ga0070697_100642789
388 Ga0070697_101030420
389 Ga0070686_100284568
390 Ga0070686_100530173
391 Ga0070686_100570314
392 Ga0070695_100077431
393 Ga0070696_100061615
394 Ga0070696_100972732
395 Ga0070665_100054275
396 Ga0070704_100011011
397 Ga0070704_100121177
398 Ga0070704_100143875
399 Ga0070704_101059576
400 Ga0068854_100062846
401 Ga0070702_100004567
402 Ga0068859_100092268
403 Ga0068859_100672475
404 Ga0068859_100741160
405 Ga0068866_10245058
406 Ga0068861_100012348
407 Ga0068861_100249892
408 Ga0068861_100611832
409 Ga0068861_100712616
410 Ga0068863_100722120
411 Ga0068858_100014130
412 Ga0068858_100906300
413 Ga0068858_101132587
414 Ga0068860_100691180
415 Ga0068862_100078731
416 Ga0068862_100194261
417 Ga0068862_100549186
418 Ga0075368_10034430
419 Ga0075367_10369889
420 Ga0075366_10003690
421 Ga0075366_10288630
422 Ga0097621_100016671
423 Ga0097621_100527470
424 Ga0097621_100753348
425 Ga0068871_100033133
426 Ga0068871_100223637
427 Ga0075428_100001117
428 Ga0075428_100027081
429 Ga0075428_100028889
430 Ga0075430_100000722
431 Ga0075430_100024777
432 Ga0075431_100012809
433 Ga0075431_100068185
434 Ga0075431_100182027
435 Ga0075433_10063115
436 Ga0075433_10070794
437 Ga0075433_10119862
438 Ga0075433_10495314
439 Ga0075434_100073553
440 Ga0075434_100573536
441 Ga0075434_101344142
442 Ga0075429_100026040
443 Ga0075429_100026713
444 Ga0075429_100065563
445 Ga0075429_100807280
446 Ga0068865_100143233
447 Ga0068865_100654364
448 Ga0097620_100092276
449 Ga0097620_100672505
450 Ga0097620_100741170
451 Ga0075435_100041918
452 Ga0075435_100046737
453 Ga0075435_101414624
454 Ga0105240_11126008
455 Ga0111539_10001383
456 Ga0111539_10304307
457 Ga0105245_10029066
458 Ga0105245_10453385
459 Ga0105247_10006319
460 Ga0114129_10003540
461 Ga0114129_10068296
462 Ga0114129_10073681
463 Ga0114129_10080067
464 Ga0114129_10138570
465 Ga0114129_10220750
466 Ga0114129_10382935
467 Ga0114129_11115399
468 Ga0105243_10183784
469 Ga0105243_10306343
470 Ga0105242_10006391
471 Ga0105242_10023221
472 Ga0105242_10048657
473 Ga0105242_10111612
474 Ga0105248_10031279
475 Ga0105248_10066239
476 Ga0105248_10139562
477 Ga0105248_10197654
478 Ga0105248_10455612
479 Ga0105248_10707980
480 Ga0105248_10715019
481 Ga0105249_10060324
482 Ga0105249_10988731
483 Ga0105246_10125924
484 Ga0157374_10135224
485 Ga0157374_10483907
486 Ga0157378_10105149
487 Ga0157378_10278189
488 Ga0157378_10676314
489 Ga0163162_10874308
490 Ga0157375_10111880
491 Ga0157375_11486087
492 Ga0163163_10000001
493 Ga0163163_10278722
494 Ga0163163_10286790
495 Ga0163163_10578179
496 Ga0157380_10076289
497 Ga0157379_10010535
498 Ga0157379_10365531
499 Ga0157376_10002539
500 Ga0157376_10122391
501 Ga0157376_10957994
502 Ga0207642_10279782
503 Ga0207680_10099111
504 Ga0207680_10138645
505 Ga0207693_10385958
506 Ga0207681_10121705
507 Ga0207681_10134540
508 Ga0207650_10196537
509 Ga0207659_10672772
510 Ga0207659_10960254
511 Ga0207687_10210444
512 Ga0207687_10298515
513 Ga0207687_10309140
514 Ga0207706_10311795
515 Ga0207686_10004099
516 Ga0207686_10547698
517 Ga0207709_10046311
518 Ga0207709_10064154
519 Ga0207670_10257522
520 Ga0207669_10096456
521 Ga0207669_10568303
522 Ga0207704_10020778
523 Ga0207704_11253848
524 Ga0207691_10202835
525 Ga0207691_10295643
526 Ga0207711_10091905
527 Ga0207711_10399827
528 Ga0207711_10438002
529 Ga0207711_10489286
530 Ga0207711_10996700
531 Ga0207689_10448187
532 Ga0207651_10799618
533 Ga0207640_11084575
534 Ga0207658_10743997
535 Ga0207677_10006085
536 Ga0207703_10010262
537 Ga0207703_10011918
538 Ga0207703_10433929
539 Ga0207703_10937390
540 Ga0207639_10249986
541 Ga0207708_10064366
542 Ga0207708_10249005
543 Ga0207641_10555118
544 Ga0207641_11445102
545 Ga0207648_10060032
546 Ga0207648_10218162
547 Ga0207648_10447129
548 Ga0207648_10853392
549 Ga0207676_10029475
550 Ga0207676_10364827
551 Ga0207676_10413933
552 Ga0207675_100074112
553 Ga0207675_100085769
554 Ga0207675_101596133
555 Ga0207683_10139053
556 Ga0207428_10000531
557 Ga0268266_10027027
558 Ga0268266_10039738
559 Ga0268265_10087832
560 Ga0268265_10332196
561 Ga0268265_10337703
562 Ga0268265_10385331
563 Ga0268265_11048149
564 Ga0268264_10442473
565 Ga0268264_10490450
566 Ga0268264_10898740
567 Ga0307408_101202347
568 Ga0316578_10302881
569 Ga0307405_10370624
570 Ga0316577_10054649
571 Ga0307416_100284730
572 Ga0307416_101844352
573 Ga0307411_10055833
574 Ga0316580_10133371
575 Ga0373934_0074388
576 Ga0373953_0062325
577 Ga0373946_0342006
578 Ga0373924_0027855
579 Ga0373937_0050050
580 Ga0373937_0300550
581 Ga0373937_0382767
582 Ga0316582_0098270
583 Ga0316584_0084000
584 Ga0316584_0639181
585 Ga0373925_0095024
586 Ga0373925_0677799
587 Ga0439450_047566
588 Ga0439455_0044665
589 Ga0439435_0033005
590 Ga0439464_0000998
591 Ga0466963_0222703
592 Ga0451576_0070180
593 Ga0451576_0124387
594 Ga0495592_0321095
595 Ga0495629_0237551
596 Ga0495629_0259849
597 Ga0495582_0312426
598 Ga0495664_0426893
599 Ga0495628_0179366
600 Ga0495628_0217559
601 Ga0495586_0047025
602 Ga0495586_0222178
603 Ga0495645_0002325
604 Ga0495635_0012681
605 Ga0495647_0241638
606 Ga0495658_0039987
607 Ga0495658_0228762
608 Ga0495613_0554939
609 Ga0495613_0733080
610 Ga0495680_0052077
611 Ga0495680_0423033
612 Ga0495684_0123810
613 Ga0496101_0269867
614 Ga0496102_0179419
615 Ga0496103_0313054
616 Ga0496104_0010482
617 Ga0496104_0244015
618 Ga0496104_0302472
619 Ga0496108_0053550
620 Ga0496109_0330917
621 Ga0496109_0481876
622 Ga0496112_0007942
623 Ga0496112_0116459
624 Ga0496114_0092901
625 Ga0496114_0264910
626 Ga0496114_0497921
627 Ga0496114_0498560
628 Ga0496115_0064100
629 Ga0501075_0432830
630 Ga0501076_0824942
631 Ga0501235_060280
632 Ga0501268_039439
633 nmdc:mga0k408_11909_c1
634 nmdc:mga05p37_1511310_c1
635 nmdc:mga05p37_2516_c1
636 nmdc:mga05p37_314578_c1
637 nmdc:mga05p37_3977_c1
638 nmdc:mga05p37_49937_c1
639 nmdc:mga05p37_90181_c1
640 nmdc:mga09592_24027_c1
641 nmdc:mga09592_440948_c1
642 nmdc:mga09592_87782_c1
643 nmdc:mga09592_8947_c1
644 nmdc:mga0qj67_10426_c1
645 nmdc:mga0qj67_19523_c1
646 nmdc:mga06r32_133358_c1
647 nmdc:mga06r32_28538_c1
648 nmdc:mga06r32_86893_c1
649 nmdc:mga08y16_6908_c1
650 nmdc:mga08y16_97315_c1
651 nmdc:mga0n895_1054705_c1
652 nmdc:mga0rr50_13330_c1
653 nmdc:mga0rr50_27361_c1
654 nmdc:mga08x19_15791_c1
655 nmdc:mga08x19_19533_c1
656 nmdc:mga08x19_89690_c1
657 nmdc:mga0a205_151744_c1
658 nmdc:mga0a205_164642_c1
659 nmdc:mga0a205_281044_c1
660 nmdc:mga0a205_319965_c1
661 Ga0495601_0234412
662 Ga0495595_0052238
663 Ga0495619_0028429
664 Ga0495619_0164907
665 Ga0495619_0661117
666 Ga0501082_0490334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00213

OSCP

ATP synthase delta (OSCP) subunit

20

192

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6re7-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2c, focussed refinement of f1 head and rotor 0.9198 7 106
6rea-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2d, focussed refinement of f1 head and rotor 0.9176 7 106
6rde-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 2, focussed refinement of f1 head and rotor 0.9174 7 106
6re1-assembly1.cif.gz_P cryo-em structure of polytomella f-atp synthase, rotary substate 2a, focussed refinement of f1 head and rotor 0.9142 7 106
6rdb-assembly1.cif.gz_P cryoem structure of polytomella f-atp synthase, primary rotary state 1, focussed refinement of f1 head and rotor 0.9129 7 106
ID Description Score Start End Superfamily
af_Q9DB20_36_129_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9605 7 99 1.10.520.20
af_Q5A7P7_25_119_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9464 7 99 1.10.520.20
af_Q96251_57_149_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9414 8 99 1.10.520.20
af_Q7JNG1_50_145_1.10.520.20 Mainly Alpha;Orthogonal Bundle;Peroxidase; domain 1;N-terminal domain of the delta subunit of the F1F0-ATP synthase 0.9412 6 100 1.10.520.20
af_P0ABA4_107_177_3.30.2320.30 Alpha Beta;2-Layer Sandwich;hypothetical protein PF0899 fold;ATP synthase, E subunit, C-terminal 0.941 111 178 3.30.2320.30
ID Description Score Start End GO Terms
AF-A0A2V8BGX0-F1-model_v4 F0F1 ATP synthase subunit delta 0.9658 106 181 GO:0016020
GO:0046933
AF-A0A7C0X607-F1-model_v4 ATP synthase F1 subunit delta 0.9495 54 179 GO:0005886
GO:0045261
GO:0046933
AF-A0A7J0EVI7-F1-model_v4 Myb domain protein 83 0.9487 9 148 GO:0005634
GO:0016020
GO:0046933
AF-A0A7C7D9R1-F1-model_v4 ATP synthase subunit alpha (EC 7.1.2.2) (ATP synthase F1 sector subunit alpha) (F-ATPase subunit alpha) 0.9487 107 180 GO:0005524
GO:0005886
GO:0043531
GO:0045261
GO:0046933
GO:0046961
AF-A0A1F8WZK4-F1-model_v4 ATP synthase F1 subunit delta 0.9462 1 171 GO:0016020
GO:0046933

Map