F411518

General Info

Members Datasets Scaffolds Average Seq Length
333 226 330 220

Family's Representative Sequence

Representative Sequence 3300048903|Ga0496100_0000776|Ga0496100_0000776_4721_5389
Length 195
Sequence MIGQRVAAAALVVLTAALSGCAHAIQGTATWPGARLESAVLTAGDFPPGVQYDRIPETPGQADGAGGPPAMLSSPEGCSDGLTRVIAASAERGVGLEAVAQKCARFQTFFDRSSQGIPMTTTKLDTPRPGALAYEQTMQLGTIRSSVYFSFENVGSSAVFGIALPTPNPTIAVKATLPQTFMELVAKQAQRLEPS

Samples

Sample ID Description Type Environment
1 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
2 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
3 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
8 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
143 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
144 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
149 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
150 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
155 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
156 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
157 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
158 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
159 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
160 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
163 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
168 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
174 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
177 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
194 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
200 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
201 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
210 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
215 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
216 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
224 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
225 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
226 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.11
Nodule 0.3
Rhizoplane 10.21
Rhizosphere 71.17
Stem 0
Stem Tuber 0
Unclassified 4.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10111217 3300001989 Unclassified 822
2 JGI24750J21931_1014821 3300002070 Bacteria 1050
3 JGI24748J21848_1012552 3300002074 Bacteria 1000
4 JGI24749J21850_1011115 3300002076 Bacteria 1263
5 JGI24742J22300_10004134 3300002244 Bacteria 2366
6 Ga0070658_10418433 3300005327 Bacteria 1152
7 Ga0070690_100097832 3300005330 Bacteria 1941
8 Ga0070670_100050947 3300005331 Bacteria 3557
9 Ga0070677_10081852 3300005333 Bacteria 1383
10 Ga0070682_100090351 3300005337 Bacteria 2002
11 Ga0068868_100106597 3300005338 Bacteria 2273
12 Ga0070691_10049148 3300005341 Bacteria 2009
13 Ga0070691_10398709 3300005341 Unclassified 775
14 Ga0070687_100466510 3300005343 Bacteria 843
15 Ga0070661_100424021 3300005344 Bacteria 1055
16 Ga0070692_10110857 3300005345 Bacteria 1517
17 Ga0070692_10298463 3300005345 Bacteria 983
18 Ga0070668_100073610 3300005347 Bacteria 2663
19 Ga0070668_100541902 3300005347 Bacteria 1012
20 Ga0070669_100609051 3300005353 Bacteria 916
21 Ga0070671_100022257 3300005355 Bacteria 5177
22 Ga0070674_100240340 3300005356 Bacteria 1417
23 Ga0070688_100061478 3300005365 Bacteria 2374
24 Ga0070688_100275858 3300005365 Bacteria 1206
25 Ga0070659_100132737 3300005366 Bacteria 2023
26 Ga0070659_100228179 3300005366 Bacteria 1538
27 Ga0070659_100265479 3300005366 Bacteria 1425
28 Ga0070667_100079742 3300005367 Bacteria 2799
29 Ga0070667_100129217 3300005367 Bacteria 2204
30 Ga0070667_100549017 3300005367 Bacteria 1062
31 Ga0070709_10149978 3300005434 Bacteria 1610
32 Ga0070710_10075222 3300005437 Bacteria 1956
33 Ga0070711_100003155 3300005439 Bacteria 9567
34 Ga0070705_100308821 3300005440 Bacteria 1137
35 Ga0070700_100049171 3300005441 Bacteria 2617
36 Ga0070663_100182242 3300005455 Bacteria 1630
37 Ga0070678_100359883 3300005456 Bacteria 1253
38 Ga0068867_100015977 3300005459 Bacteria 5329
39 Ga0070685_10180423 3300005466 Bacteria 1359
40 Ga0070698_100907321 3300005471 Bacteria 827
41 Ga0068853_100093255 3300005539 Bacteria 2650
42 Ga0068853_100429986 3300005539 Bacteria 1239
43 Ga0070672_100095771 3300005543 Bacteria 2401
44 Ga0070686_100019444 3300005544 Bacteria 4003
45 Ga0070686_100254226 3300005544 Bacteria 1285
46 Ga0070695_100199940 3300005545 Bacteria 1428
47 Ga0070696_100615846 3300005546 Bacteria 877
48 Ga0070693_100101312 3300005547 Bacteria 1755
49 Ga0070665_100000979 3300005548 Bacteria 36153
50 Ga0070665_100047021 3300005548 Bacteria 4331
51 Ga0070704_100046620 3300005549 Bacteria 3024
52 Ga0068855_100100284 3300005563 Bacteria 3334
53 Ga0068855_100178721 3300005563 Bacteria 2400
54 Ga0068852_100163616 3300005616 Bacteria 2079
55 Ga0068859_100203765 3300005617 Bacteria 2063
56 Ga0068859_100430296 3300005617 Bacteria 1416
57 Ga0068864_100111148 3300005618 Bacteria 2441
58 Ga0068866_10102806 3300005718 Bacteria 1579
59 Ga0068861_100013839 3300005719 Bacteria 5653
60 Ga0068861_100298456 3300005719 Bacteria 1394
61 Ga0068861_100428855 3300005719 Bacteria 1180
62 Ga0068851_10420877 3300005834 Bacteria 789
63 Ga0068863_100009338 3300005841 Bacteria 9571
64 Ga0068863_100139407 3300005841 Bacteria 2318
65 Ga0068863_100360461 3300005841 Bacteria 1417
66 Ga0068863_100450134 3300005841 Bacteria 1264
67 Ga0068858_100332406 3300005842 Bacteria 1453
68 Ga0068860_100246400 3300005843 Bacteria 1739
69 Ga0075365_10005101 3300006038 Bacteria 7053
70 Ga0075365_10092132 3300006038 Bacteria 2066
71 Ga0075368_10144571 3300006042 Bacteria 992
72 Ga0075363_100001644 3300006048 Bacteria 8631
73 Ga0075363_100011379 3300006048 Bacteria 4258
74 Ga0075363_100040229 3300006048 Bacteria 2464
75 Ga0075363_100059746 3300006048 Bacteria 2051
76 Ga0075363_100141303 3300006048 Bacteria 1356
77 Ga0075364_10002472 3300006051 Bacteria 10344
78 Ga0075364_10012172 3300006051 Bacteria 5252
79 Ga0075364_10070614 3300006051 Bacteria 2299
80 Ga0070716_100005253 3300006173 Bacteria 6259
81 Ga0070716_100041293 3300006173 Bacteria 2569
82 Ga0070712_100039540 3300006175 Bacteria 3228
83 Ga0075362_10034129 3300006177 Bacteria 2216
84 Ga0075362_10060732 3300006177 Bacteria 1709
85 Ga0075367_10006461 3300006178 Bacteria 5925
86 Ga0075367_10050007 3300006178 Bacteria 2466
87 Ga0075369_10000241 3300006186 Bacteria 16255
88 Ga0075369_10015224 3300006186 Bacteria 3084
89 Ga0075369_10033783 3300006186 Bacteria 2169
90 Ga0075369_10065987 3300006186 Bacteria 1587
91 Ga0075369_10075291 3300006186 Bacteria 1490
92 Ga0075369_10075371 3300006186 Bacteria 1490
93 Ga0075369_10212519 3300006186 Unclassified 894
94 Ga0097621_100110937 3300006237 Bacteria 2318
95 Ga0075370_10192251 3300006353 Bacteria 1203
96 Ga0075370_10206684 3300006353 Bacteria 1159
97 Ga0075370_10347479 3300006353 Bacteria 886
98 Ga0075428_100058572 3300006844 Bacteria 4217
99 Ga0075430_100019924 3300006846 Bacteria 5708
100 Ga0075430_100213475 3300006846 Bacteria 1601
101 Ga0075431_100041750 3300006847 Bacteria 4731
102 Ga0068865_100475578 3300006881 Bacteria 1037
103 Ga0097620_100203760 3300006931 Bacteria 2063
104 Ga0097620_100430299 3300006931 Bacteria 1416
105 Ga0099795_10112836 3300007788 Bacteria 1079
106 Ga0105250_10059384 3300009092 Bacteria 1536
107 Ga0105250_10145357 3300009092 Bacteria 984
108 Ga0111539_10696551 3300009094 Bacteria 1183
109 Ga0105245_10114228 3300009098 Bacteria 2515
110 Ga0105247_10104713 3300009101 Bacteria 1813
111 Ga0114129_10039701 3300009147 Bacteria 6637
112 Ga0105243_10220577 3300009148 Bacteria 1676
113 Ga0105241_10035027 3300009174 Bacteria 3776
114 Ga0105241_10215761 3300009174 Bacteria 1610
115 Ga0105248_10239700 3300009177 Bacteria 2041
116 Ga0105237_10000346 3300009545 Bacteria 65318
117 Ga0105238_10344927 3300009551 Bacteria 1478
118 Ga0105249_10009157 3300009553 Bacteria 8658
119 Ga0105249_10091328 3300009553 Bacteria 2849
120 Ga0105249_10212437 3300009553 Bacteria 1899
121 Ga0105239_10031050 3300010375 Bacteria 5877
122 Ga0105239_10110066 3300010375 Bacteria 3053
123 Ga0105239_10809042 3300010375 Bacteria 1074
124 Ga0157374_10121707 3300013296 Bacteria 2519
125 Ga0157378_10067180 3300013297 Bacteria 3212
126 Ga0163162_10048408 3300013306 Bacteria 4259
127 Ga0157375_10240969 3300013308 Bacteria 1968
128 Ga0163163_10067748 3300014325 Bacteria 3550
129 Ga0163163_10426451 3300014325 Bacteria 1385
130 Ga0157377_10158136 3300014745 Bacteria 1407
131 Ga0157377_10272348 3300014745 Bacteria 1106
132 Ga0163161_10104503 3300017792 Bacteria 2111
133 Ga0163161_10447772 3300017792 Bacteria 1043
134 Ga0213876_10021637 3300021384 Bacteria 3401
135 Ga0213875_10017250 3300021388 Bacteria 3492
136 Ga0207682_10079250 3300025893 Bacteria 1404
137 Ga0207692_10054785 3300025898 Bacteria 2038
138 Ga0207688_10002249 3300025901 Bacteria 10402
139 Ga0207680_10078322 3300025903 Bacteria 2070
140 Ga0207685_10012397 3300025905 Bacteria 2599
141 Ga0207699_10081428 3300025906 Bacteria 2008
142 Ga0207645_10114551 3300025907 Bacteria 1747
143 Ga0207643_10198336 3300025908 Bacteria 1221
144 Ga0207654_10090116 3300025911 Bacteria 1867
145 Ga0207671_10042021 3300025914 Bacteria 3384
146 Ga0207693_10000743 3300025915 Bacteria 29363
147 Ga0207663_10337009 3300025916 Bacteria 1138
148 Ga0207660_10312994 3300025917 Bacteria 1252
149 Ga0207662_10216650 3300025918 Bacteria 1245
150 Ga0207649_10226058 3300025920 Bacteria 1336
151 Ga0207681_10060312 3300025923 Bacteria 2604
152 Ga0207687_10017251 3300025927 Bacteria 4751
153 Ga0207687_10077448 3300025927 Bacteria 2391
154 Ga0207664_10191556 3300025929 Bacteria 1761
155 Ga0207644_10186329 3300025931 Bacteria 1630
156 Ga0207706_10211649 3300025933 Bacteria 1699
157 Ga0207706_10231054 3300025933 Bacteria 1618
158 Ga0207706_10285959 3300025933 Bacteria 1438
159 Ga0207706_10600332 3300025933 Bacteria 945
160 Ga0207686_10436859 3300025934 Bacteria 1004
161 Ga0207665_10002351 3300025939 Bacteria 12764
162 Ga0207665_10066109 3300025939 Bacteria 2460
163 Ga0207691_10099635 3300025940 Bacteria 2594
164 Ga0207711_10197005 3300025941 Bacteria 1837
165 Ga0207689_10088747 3300025942 Bacteria 2539
166 Ga0207661_10125453 3300025944 Bacteria 2192
167 Ga0207667_10257473 3300025949 Bacteria 1785
168 Ga0207712_10065734 3300025961 Bacteria 2590
169 Ga0207712_10285898 3300025961 Bacteria 1348
170 Ga0207640_10119540 3300025981 Bacteria 1884
171 Ga0207658_10123886 3300025986 Bacteria 2065
172 Ga0207658_10146931 3300025986 Bacteria 1916
173 Ga0207658_10290691 3300025986 Bacteria 1404
174 Ga0207658_10473912 3300025986 Bacteria 1111
175 Ga0207677_10677404 3300026023 Unclassified 913
176 Ga0207703_10302312 3300026035 Bacteria 1459
177 Ga0207678_10028987 3300026067 Bacteria 4831
178 Ga0207708_10016776 3300026075 Bacteria 5513
179 Ga0207702_10403596 3300026078 Bacteria 1319
180 Ga0207641_10008873 3300026088 Bacteria 8302
181 Ga0207641_10221732 3300026088 Bacteria 1754
182 Ga0207648_10035984 3300026089 Bacteria 4362
183 Ga0207676_10688724 3300026095 Bacteria 989
184 Ga0207675_100175796 3300026118 Bacteria 2048
185 Ga0207675_101024442 3300026118 Bacteria 844
186 Ga0207683_10053355 3300026121 Bacteria 3544
187 Ga0207698_10443297 3300026142 Bacteria 1251
188 Ga0209813_10182427 3300027866 Bacteria 768
189 Ga0268266_10002989 3300028379 Bacteria 17433
190 Ga0268266_10019643 3300028379 Bacteria 5757
191 Ga0268266_10601831 3300028379 Bacteria 1056
192 Ga0268265_10397794 3300028380 Bacteria 1272
193 Ga0268265_10448957 3300028380 Bacteria 1204
194 Ga0268264_10176983 3300028381 Bacteria 1934
195 Ga0268264_10234556 3300028381 Bacteria 1696
196 Ga0307410_10024101 3300031852 Bacteria 3796
197 Ga0307407_10060922 3300031903 Bacteria 2204
198 Ga0307409_100007127 3300031995 Bacteria 6657
199 Ga0307409_100180756 3300031995 Bacteria 1867
200 Ga0307409_100376445 3300031995 Bacteria 1348
201 Ga0307411_10431689 3300032005 Bacteria 1097
202 Ga0307415_100415212 3300032126 Bacteria 1153
203 Ga0373928_0028000 3300035084 Bacteria 1230
204 Ga0373951_0039125 3300035091 Bacteria 1139
205 Ga0373931_0008925 3300035691 Bacteria 4777
206 Ga0373947_0222455 3300035725 Bacteria 1241
207 Ga0395905_0990406 3300037471 Bacteria 744
208 Ga0436364_0256774 3300037853 Bacteria 34884
209 Ga0436365_1685663 3300039437 Bacteria 6718
210 Ga0439461_0009595 3300041410 Bacteria 1757
211 Ga0439466_0022726 3300041411 Bacteria 2211
212 Ga0439465_0006393 3300041413 Bacteria 3742
213 Ga0451835_0981626 3300041492 Bacteria 749
214 Ga0451853_1345077 3300041512 Bacteria 1086
215 Ga0439445_0011779 3300042004 Bacteria 2090
216 Ga0439434_0030116 3300042435 Bacteria 1647
217 Ga0439459_0016155 3300042438 Bacteria 1377
218 Ga0466972_0014282 3300044658 Bacteria 3980
219 Ga0466972_0048882 3300044658 Bacteria 2043
220 Ga0466972_0070863 3300044658 Bacteria 1663
221 Ga0466972_0139795 3300044658 Bacteria 1139
222 Ga0466965_0000761 3300044683 Bacteria 12126
223 Ga0466965_0019403 3300044683 Bacteria 3264
224 Ga0466968_0000170 3300044735 Bacteria 19904
225 Ga0466970_0052464 3300044765 Bacteria 2176
226 Ga0466957_0065193 3300044842 Bacteria 2242
227 Ga0466960_0000215 3300044901 Bacteria 19879
228 Ga0466960_0000966 3300044901 Bacteria 10195
229 Ga0466960_0024021 3300044901 Bacteria 2745
230 Ga0466959_0065254 3300045049 Bacteria 2641
231 Ga0466958_0034770 3300045836 Bacteria 3009
232 Ga0466967_0020847 3300045976 Bacteria 5309
233 Ga0466967_0028995 3300045976 Bacteria 4628
234 Ga0495629_0012353 3300046459 Bacteria 6183
235 Ga0495641_0049950 3300046461 Bacteria 1913
236 Ga0495583_0028660 3300046506 Bacteria 2735
237 Ga0495583_0189696 3300046506 Bacteria 839
238 Ga0495606_0199653 3300046507 Bacteria 1141
239 Ga0495630_0075917 3300046517 Bacteria 2532
240 Ga0495665_0106491 3300046531 Bacteria 1471
241 Ga0495640_0013725 3300046533 Bacteria 6155
242 Ga0495668_0019960 3300046616 Bacteria 3855
243 Ga0495611_0052980 3300046648 Bacteria 1831
244 Ga0495624_0041156 3300046690 Bacteria 2957
245 Ga0495671_0103952 3300046692 Bacteria 1387
246 Ga0495649_0261404 3300046694 Bacteria 887
247 Ga0495672_0001155 3300047320 Bacteria 26703
248 Ga0495676_0220316 3300047321 Bacteria 1308
249 Ga0495673_0000708 3300047469 Bacteria 32330
250 Ga0495593_0013227 3300047673 Bacteria 4710
251 Ga0496100_0000776 3300048903 Bacteria 15213
252 Ga0496100_0340370 3300048903 Bacteria 1131
253 Ga0496100_0342228 3300048903 Bacteria 1128
254 Ga0496101_0000077 3300048904 Bacteria 109236
255 Ga0496101_0169290 3300048904 Bacteria 1678
256 Ga0496102_0000037 3300048905 Bacteria 199368
257 Ga0496102_0005055 3300048905 Bacteria 11165
258 Ga0496102_0314504 3300048905 Bacteria 1475
259 Ga0496102_0336127 3300048905 Bacteria 1422
260 Ga0496103_0000004 3300048906 Bacteria 510080
261 Ga0496103_0439411 3300048906 Bacteria 837
262 Ga0496104_0011130 3300048907 Bacteria 8050
263 Ga0496105_0554664 3300048908 Bacteria 896
264 Ga0496106_0003936 3300048909 Bacteria 11090
265 Ga0496107_0125719 3300048910 Bacteria 1891
266 Ga0496108_0000188 3300048911 Bacteria 57492
267 Ga0496108_0054013 3300048911 Bacteria 3371
268 Ga0496108_0122322 3300048911 Bacteria 2233
269 Ga0496108_0157100 3300048911 Bacteria 1964
270 Ga0496109_0004324 3300048912 Bacteria 11863
271 Ga0496109_0023814 3300048912 Bacteria 5435
272 Ga0496109_0025624 3300048912 Bacteria 5256
273 Ga0496109_0170333 3300048912 Bacteria 2043
274 Ga0496109_0219014 3300048912 Bacteria 1790
275 Ga0496109_0374119 3300048912 Bacteria 1346
276 Ga0496110_0037047 3300048913 Bacteria 4238
277 Ga0496110_0091115 3300048913 Bacteria 2727
278 Ga0496111_0266673 3300048914 Bacteria 1270
279 Ga0496112_0010706 3300048915 Bacteria 8336
280 Ga0496112_0023995 3300048915 Bacteria 5836
281 Ga0496112_0046363 3300048915 Bacteria 4263
282 Ga0496112_0160939 3300048915 Bacteria 2211
283 Ga0496114_0113126 3300048917 Bacteria 2327
284 Ga0496114_0297452 3300048917 Bacteria 1425
285 Ga0496116_0000056 3300048919 Bacteria 282554
286 Ga0496117_0000003 3300048920 Bacteria 1881097
287 Ga0496118_0000001 3300048921 Bacteria 1881100
288 Ga0496119_0230719 3300048922 Bacteria 942
289 Ga0496121_0000790 3300048924 Bacteria 57884
290 Ga0496126_0000735 3300048929 Bacteria 59474
291 Ga0496126_0374479 3300048929 Bacteria 1160
292 Ga0501032_0006318 3300049569 Bacteria 8729
293 Ga0501034_0001976 3300049571 Bacteria 25980
294 Ga0501034_0022479 3300049571 Bacteria 6427
295 Ga0501037_0045459 3300049573 Bacteria 3223
296 Ga0501038_0010359 3300049574 Bacteria 8531
297 Ga0501039_0016710 3300049575 Bacteria 5622
298 Ga0501040_0351301 3300049576 Bacteria 1056
299 Ga0501043_0009083 3300049579 Bacteria 7819
300 Ga0501070_0003812 3300049586 Bacteria 13014
301 Ga0501070_0052096 3300049586 Bacteria 3397
302 Ga0501073_0017543 3300049589 Bacteria 5183
303 Ga0501073_0153135 3300049589 Bacteria 1598
304 Ga0501080_0752302 3300049742 Bacteria 857
305 Ga0501044_0025358 3300049823 Bacteria 6284
306 nmdc:mga03683_31810_c1 3300050489 Bacteria 2119
307 nmdc:mga03683_55781_c1 3300050489 Bacteria 1660
308 nmdc:mga03n38_127659_c1 3300050490 Bacteria 1257
309 nmdc:mga03n38_146390_c1 3300050490 Bacteria 1185
310 nmdc:mga03n38_195995_c1 3300050490 Bacteria 1043
311 nmdc:mga03n38_3226_c1 3300050490 Bacteria 5198
312 nmdc:mga00v17_14423_c1 3300050491 Bacteria 4410
313 nmdc:mga00v17_57194_c1 3300050491 Bacteria 2385
314 nmdc:mga00v17_86105_c1 3300050491 Bacteria 1969
315 nmdc:mga0yw44_23348_c1 3300050492 Bacteria 2089
316 nmdc:mga06z11_19588_c1 3300050494 Bacteria 3114
317 nmdc:mga06z11_431285_c1 3300050494 Bacteria 795
318 nmdc:mga04h51_173168_c1 3300050495 Bacteria 836
319 nmdc:mga07m45_303897_c1 3300050496 Bacteria 928
320 nmdc:mga0qj67_179153_c1 3300050509 Bacteria 1721
321 nmdc:mga06r32_82813_c1 3300050510 Bacteria 3126
322 nmdc:mga0sz30_1671_c1 3300050516 Bacteria 7873
323 nmdc:mga0sz30_50856_c1 3300050516 Bacteria 1757
324 nmdc:mga0sz30_56904_c1 3300050516 Bacteria 1666
325 nmdc:mga0sz30_63186_c1 3300050516 Bacteria 1584
326 Ga0495655_0005089 3300053083 Bacteria 2299
327 Ga0495655_0219830 3300053083 Bacteria 628
328 Ga0500577_0164689 3300053142 Bacteria 946
329 Ga0500604_0049836 3300053151 Bacteria 1289
330 Ga0500611_013096 3300053727 Bacteria 1415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_1345077 Ga0451853_1345077_381_929 182
2 3300053083 Ga0495655_0219830 Ga0495655_0219830_23_574 183
3 3300045836 Ga0466958_0034770 Ga0466958_0034770_2408_2971 187
4 3300046506 Ga0495583_0028660 Ga0495583_0028660_42_605 187
5 3300048903 Ga0496100_0000776 Ga0496100_0000776_4721_5389 195
6 3300048904 Ga0496101_0000077 Ga0496101_0000077_58960_59628 195
7 3300048910 Ga0496107_0125719 Ga0496107_0125719_844_1512 195
8 3300048924 Ga0496121_0000790 Ga0496121_0000790_52197_52865 195
9 3300048929 Ga0496126_0000735 Ga0496126_0000735_49727_50395 195
10 3300048914 Ga0496111_0266673 Ga0496111_0266673_21_620 199
11 3300025942 Ga0207689_10088747 Ga0207689_100887471 203
12 3300042438 Ga0439459_0016155 Ga0439459_0016155_503_1174 209
13 3300025961 Ga0207712_10285898 Ga0207712_102858982 210
14 3300028380 Ga0268265_10448957 Ga0268265_104489572 210
15 3300006178 Ga0075367_10050007 Ga0075367_100500073 212
16 3300006186 Ga0075369_10212519 Ga0075369_102125192 212
17 3300010375 Ga0105239_10809042 Ga0105239_108090422 212
18 3300025933 Ga0207706_10285959 Ga0207706_102859592 212
19 3300025933 Ga0207706_10600332 Ga0207706_106003321 212
20 3300026118 Ga0207675_101024442 Ga0207675_1010244421 212
21 3300048912 Ga0496109_0374119 Ga0496109_0374119_293_934 212
22 3300050491 nmdc:mga00v17_86105_c1 nmdc:mga00v17_86105_c1_1303_1944 212
23 3300050494 nmdc:mga06z11_431285_c1 nmdc:mga06z11_431285_c1_80_721 212
24 3300006353 Ga0075370_10192251 Ga0075370_101922512 213
25 3300009092 Ga0105250_10145357 Ga0105250_101453572 213
26 3300050489 nmdc:mga03683_31810_c1 nmdc:mga03683_31810_c1_947_1588 213
27 3300050490 nmdc:mga03n38_3226_c1 nmdc:mga03n38_3226_c1_2414_3055 213
28 3300050491 nmdc:mga00v17_14423_c1 nmdc:mga00v17_14423_c1_1161_1802 213
29 3300050516 nmdc:mga0sz30_1671_c1 nmdc:mga0sz30_1671_c1_750_1391 213
30 iso_pu_bacteria 2939582691 2939587369 214
31 3300006186 Ga0075369_10075291 Ga0075369_100752912 215
32 3300048912 Ga0496109_0025624 Ga0496109_0025624_973_1623 215
33 3300050516 nmdc:mga0sz30_63186_c1 nmdc:mga0sz30_63186_c1_460_1128 215
34 3300002244 JGI24742J22300_10004134 JGI24742J22300_100041343 216
35 3300005333 Ga0070677_10081852 Ga0070677_100818521 216
36 3300005544 Ga0070686_100254226 Ga0070686_1002542261 216
37 3300006844 Ga0075428_100058572 Ga0075428_1000585724 216
38 3300006846 Ga0075430_100019924 Ga0075430_1000199245 216
39 3300006847 Ga0075431_100041750 Ga0075431_1000417504 216
40 3300009147 Ga0114129_10039701 Ga0114129_100397015 216
41 3300044683 Ga0466965_0019403 Ga0466965_0019403_1490_2152 216
42 3300050510 nmdc:mga06r32_82813_c1 nmdc:mga06r32_82813_c1_798_1448 216
43 iso_pu_bacteria 2842134933 2842138386 216
44 iso_pu_bacteria 2902792274 2902798496 216
45 3300005367 Ga0070667_100549017 Ga0070667_1005490172 217
46 3300005719 Ga0068861_100428855 Ga0068861_1004288552 217
47 3300005843 Ga0068860_100246400 Ga0068860_1002464002 217
48 3300006038 Ga0075365_10092132 Ga0075365_100921323 217
49 3300006048 Ga0075363_100141303 Ga0075363_1001413032 217
50 3300006051 Ga0075364_10070614 Ga0075364_100706143 217
51 3300025986 Ga0207658_10146931 Ga0207658_101469312 217
52 3300025986 Ga0207658_10473912 Ga0207658_104739122 217
53 3300028381 Ga0268264_10176983 Ga0268264_101769833 217
54 3300044658 Ga0466972_0139795 Ga0466972_0139795_104_760 217
55 3300044735 Ga0466968_0000170 Ga0466968_0000170_13328_13984 217
56 3300044765 Ga0466970_0052464 Ga0466970_0052464_552_1208 217
57 3300044842 Ga0466957_0065193 Ga0466957_0065193_958_1614 217
58 3300044901 Ga0466960_0000966 Ga0466960_0000966_8290_8946 217
59 3300045049 Ga0466959_0065254 Ga0466959_0065254_380_1036 217
60 3300045976 Ga0466967_0028995 Ga0466967_0028995_527_1183 217
61 3300053142 Ga0500577_0164689 Ga0500577_0164689_84_740 217
62 3300053151 Ga0500604_0049836 Ga0500604_0049836_427_1083 217
63 3300002070 JGI24750J21931_1014821 JGI24750J21931_10148212 218
64 3300005331 Ga0070670_100050947 Ga0070670_1000509472 218
65 3300005347 Ga0070668_100541902 Ga0070668_1005419022 218
66 3300005355 Ga0070671_100022257 Ga0070671_1000222574 218
67 3300005365 Ga0070688_100275858 Ga0070688_1002758582 218
68 3300005367 Ga0070667_100079742 Ga0070667_1000797424 218
69 3300005367 Ga0070667_100129217 Ga0070667_1001292172 218
70 3300005544 Ga0070686_100019444 Ga0070686_1000194445 218
71 3300005548 Ga0070665_100000979 Ga0070665_10000097918 218
72 3300005617 Ga0068859_100430296 Ga0068859_1004302962 218
73 3300005841 Ga0068863_100009338 Ga0068863_1000093386 218
74 3300005841 Ga0068863_100139407 Ga0068863_1001394073 218
75 3300006038 Ga0075365_10005101 Ga0075365_100051014 218
76 3300006042 Ga0075368_10144571 Ga0075368_101445712 218
77 3300006048 Ga0075363_100040229 Ga0075363_1000402293 218
78 3300006048 Ga0075363_100059746 Ga0075363_1000597462 218
79 3300006051 Ga0075364_10012172 Ga0075364_100121723 218
80 3300006177 Ga0075362_10034129 Ga0075362_100341293 218
81 3300006178 Ga0075367_10006461 Ga0075367_100064611 218
82 3300006186 Ga0075369_10015224 Ga0075369_100152243 218
83 3300006186 Ga0075369_10065987 Ga0075369_100659871 218
84 3300006353 Ga0075370_10206684 Ga0075370_102066841 218
85 3300006353 Ga0075370_10347479 Ga0075370_103474792 218
86 3300006931 Ga0097620_100430299 Ga0097620_1004302992 218
87 3300009092 Ga0105250_10059384 Ga0105250_100593842 218
88 3300009553 Ga0105249_10091328 Ga0105249_100913283 218
89 3300014325 Ga0163163_10067748 Ga0163163_100677483 218
90 3300014325 Ga0163163_10426451 Ga0163163_104264512 218
91 3300021384 Ga0213876_10021637 Ga0213876_100216373 218
92 3300021388 Ga0213875_10017250 Ga0213875_100172503 218
93 3300025986 Ga0207658_10123886 Ga0207658_101238862 218
94 3300025986 Ga0207658_10290691 Ga0207658_102906912 218
95 3300026088 Ga0207641_10008873 Ga0207641_100088736 218
96 3300027866 Ga0209813_10182427 Ga0209813_101824271 218
97 3300028379 Ga0268266_10002989 Ga0268266_100029897 218
98 3300031852 Ga0307410_10024101 Ga0307410_100241012 218
99 3300031903 Ga0307407_10060922 Ga0307407_100609221 218
100 3300031995 Ga0307409_100007127 Ga0307409_1000071275 218
101 3300031995 Ga0307409_100376445 Ga0307409_1003764452 218
102 3300032005 Ga0307411_10431689 Ga0307411_104316892 218
103 3300032126 Ga0307415_100415212 Ga0307415_1004152122 218
104 3300037471 Ga0395905_0990406 Ga0395905_0990406_58_714 218
105 3300037853 Ga0436364_0256774 Ga0436364_0256774_14182_14853 218
106 3300039437 Ga0436365_1685663 Ga0436365_1685663_4030_4701 218
107 3300041410 Ga0439461_0009595 Ga0439461_0009595_144_803 218
108 3300042004 Ga0439445_0011779 Ga0439445_0011779_149_808 218
109 3300042435 Ga0439434_0030116 Ga0439434_0030116_395_1054 218
110 3300048903 Ga0496100_0342228 Ga0496100_0342228_335_991 218
111 3300048905 Ga0496102_0005055 Ga0496102_0005055_2824_3480 218
112 3300048907 Ga0496104_0011130 Ga0496104_0011130_6475_7131 218
113 3300048911 Ga0496108_0157100 Ga0496108_0157100_645_1301 218
114 3300048912 Ga0496109_0023814 Ga0496109_0023814_3951_4607 218
115 3300048912 Ga0496109_0219014 Ga0496109_0219014_348_1004 218
116 3300048913 Ga0496110_0091115 Ga0496110_0091115_294_950 218
117 3300048915 Ga0496112_0010706 Ga0496112_0010706_1947_2603 218
118 3300049571 Ga0501034_0022479 Ga0501034_0022479_1227_1886 218
119 3300049586 Ga0501070_0052096 Ga0501070_0052096_908_1570 218
120 3300049589 Ga0501073_0153135 Ga0501073_0153135_71_733 218
121 3300049742 Ga0501080_0752302 Ga0501080_0752302_146_808 218
122 3300050489 nmdc:mga03683_55781_c1 nmdc:mga03683_55781_c1_382_1038 218
123 3300050490 nmdc:mga03n38_146390_c1 nmdc:mga03n38_146390_c1_231_887 218
124 3300050494 nmdc:mga06z11_19588_c1 nmdc:mga06z11_19588_c1_567_1223 218
125 3300050495 nmdc:mga04h51_173168_c1 nmdc:mga04h51_173168_c1_96_752 218
126 3300050496 nmdc:mga07m45_303897_c1 nmdc:mga07m45_303897_c1_262_918 218
127 3300050491 nmdc:mga00v17_57194_c1 nmdc:mga00v17_57194_c1_1068_1730 219
128 3300050492 nmdc:mga0yw44_23348_c1 nmdc:mga0yw44_23348_c1_423_1085 219
129 3300006186 Ga0075369_10033783 Ga0075369_100337831 220
130 3300031995 Ga0307409_100180756 Ga0307409_1001807562 220
131 3300046694 Ga0495649_0261404 Ga0495649_0261404_185_850 220
132 3300049569 Ga0501032_0006318 Ga0501032_0006318_129_791 220
133 3300049571 Ga0501034_0001976 Ga0501034_0001976_900_1562 220
134 3300049573 Ga0501037_0045459 Ga0501037_0045459_508_1170 220
135 3300049574 Ga0501038_0010359 Ga0501038_0010359_3024_3686 220
136 3300049575 Ga0501039_0016710 Ga0501039_0016710_600_1262 220
137 3300049576 Ga0501040_0351301 Ga0501040_0351301_10_672 220
138 3300049579 Ga0501043_0009083 Ga0501043_0009083_6980_7642 220
139 3300049586 Ga0501070_0003812 Ga0501070_0003812_2251_2913 220
140 3300049589 Ga0501073_0017543 Ga0501073_0017543_3872_4534 220
141 3300049823 Ga0501044_0025358 Ga0501044_0025358_905_1567 220
142 3300050516 nmdc:mga0sz30_56904_c1 nmdc:mga0sz30_56904_c1_11_679 220
143 3300006186 Ga0075369_10075371 Ga0075369_100753711 221
144 3300026023 Ga0207677_10677404 Ga0207677_106774041 221
145 3300041413 Ga0439465_0006393 Ga0439465_0006393_435_1103 221
146 3300044658 Ga0466972_0070863 Ga0466972_0070863_816_1484 221
147 3300045976 Ga0466967_0020847 Ga0466967_0020847_3089_3757 221
148 3300048929 Ga0496126_0374479 Ga0496126_0374479_396_1061 221
149 3300050516 nmdc:mga0sz30_50856_c1 nmdc:mga0sz30_50856_c1_408_1076 221
150 3300053727 Ga0500611_013096 Ga0500611_013096_734_1399 221
151 3300001989 JGI24739J22299_10111217 JGI24739J22299_101112171 222
152 3300002074 JGI24748J21848_1012552 JGI24748J21848_10125521 222
153 3300002076 JGI24749J21850_1011115 JGI24749J21850_10111152 222
154 3300005327 Ga0070658_10418433 Ga0070658_104184332 222
155 3300005330 Ga0070690_100097832 Ga0070690_1000978322 222
156 3300005337 Ga0070682_100090351 Ga0070682_1000903512 222
157 3300005338 Ga0068868_100106597 Ga0068868_1001065972 222
158 3300005341 Ga0070691_10049148 Ga0070691_100491483 222
159 3300005341 Ga0070691_10398709 Ga0070691_103987091 222
160 3300005343 Ga0070687_100466510 Ga0070687_1004665101 222
161 3300005344 Ga0070661_100424021 Ga0070661_1004240211 222
162 3300005345 Ga0070692_10110857 Ga0070692_101108572 222
163 3300005345 Ga0070692_10298463 Ga0070692_102984631 222
164 3300005347 Ga0070668_100073610 Ga0070668_1000736102 222
165 3300005353 Ga0070669_100609051 Ga0070669_1006090511 222
166 3300005356 Ga0070674_100240340 Ga0070674_1002403401 222
167 3300005365 Ga0070688_100061478 Ga0070688_1000614783 222
168 3300005366 Ga0070659_100132737 Ga0070659_1001327373 222
169 3300005366 Ga0070659_100228179 Ga0070659_1002281792 222
170 3300005366 Ga0070659_100265479 Ga0070659_1002654792 222
171 3300005434 Ga0070709_10149978 Ga0070709_101499782 222
172 3300005437 Ga0070710_10075222 Ga0070710_100752222 222
173 3300005439 Ga0070711_100003155 Ga0070711_1000031556 222
174 3300005440 Ga0070705_100308821 Ga0070705_1003088211 222
175 3300005441 Ga0070700_100049171 Ga0070700_1000491712 222
176 3300005455 Ga0070663_100182242 Ga0070663_1001822422 222
177 3300005456 Ga0070678_100359883 Ga0070678_1003598832 222
178 3300005459 Ga0068867_100015977 Ga0068867_1000159772 222
179 3300005466 Ga0070685_10180423 Ga0070685_101804231 222
180 3300005471 Ga0070698_100907321 Ga0070698_1009073211 222
181 3300005539 Ga0068853_100093255 Ga0068853_1000932552 222
182 3300005539 Ga0068853_100429986 Ga0068853_1004299861 222
183 3300005543 Ga0070672_100095771 Ga0070672_1000957711 222
184 3300005545 Ga0070695_100199940 Ga0070695_1001999402 222
185 3300005546 Ga0070696_100615846 Ga0070696_1006158461 222
186 3300005547 Ga0070693_100101312 Ga0070693_1001013121 222
187 3300005548 Ga0070665_100047021 Ga0070665_1000470213 222
188 3300005549 Ga0070704_100046620 Ga0070704_1000466202 222
189 3300005563 Ga0068855_100100284 Ga0068855_1001002844 222
190 3300005563 Ga0068855_100178721 Ga0068855_1001787212 222
191 3300005616 Ga0068852_100163616 Ga0068852_1001636162 222
192 3300005617 Ga0068859_100203765 Ga0068859_1002037652 222
193 3300005618 Ga0068864_100111148 Ga0068864_1001111482 222
194 3300005718 Ga0068866_10102806 Ga0068866_101028062 222
195 3300005719 Ga0068861_100013839 Ga0068861_1000138397 222
196 3300005719 Ga0068861_100298456 Ga0068861_1002984562 222
197 3300005834 Ga0068851_10420877 Ga0068851_104208771 222
198 3300005841 Ga0068863_100360461 Ga0068863_1003604612 222
199 3300005841 Ga0068863_100450134 Ga0068863_1004501341 222
200 3300005842 Ga0068858_100332406 Ga0068858_1003324062 222
201 3300006048 Ga0075363_100001644 Ga0075363_1000016446 222
202 3300006048 Ga0075363_100011379 Ga0075363_1000113792 222
203 3300006051 Ga0075364_10002472 Ga0075364_1000247212 222
204 3300006173 Ga0070716_100005253 Ga0070716_1000052534 222
205 3300006173 Ga0070716_100041293 Ga0070716_1000412932 222
206 3300006175 Ga0070712_100039540 Ga0070712_1000395401 222
207 3300006177 Ga0075362_10060732 Ga0075362_100607322 222
208 3300006186 Ga0075369_10000241 Ga0075369_100002412 222
209 3300006237 Ga0097621_100110937 Ga0097621_1001109373 222
210 3300006846 Ga0075430_100213475 Ga0075430_1002134752 222
211 3300006881 Ga0068865_100475578 Ga0068865_1004755782 222
212 3300006931 Ga0097620_100203760 Ga0097620_1002037602 222
213 3300007788 Ga0099795_10112836 Ga0099795_101128361 222
214 3300009094 Ga0111539_10696551 Ga0111539_106965511 222
215 3300009098 Ga0105245_10114228 Ga0105245_101142282 222
216 3300009101 Ga0105247_10104713 Ga0105247_101047131 222
217 3300009148 Ga0105243_10220577 Ga0105243_102205772 222
218 3300009174 Ga0105241_10035027 Ga0105241_100350276 222
219 3300009174 Ga0105241_10215761 Ga0105241_102157612 222
220 3300009177 Ga0105248_10239700 Ga0105248_102397002 222
221 3300009545 Ga0105237_10000346 Ga0105237_1000034624 222
222 3300009551 Ga0105238_10344927 Ga0105238_103449272 222
223 3300009553 Ga0105249_10009157 Ga0105249_100091577 222
224 3300009553 Ga0105249_10212437 Ga0105249_102124373 222
225 3300010375 Ga0105239_10031050 Ga0105239_100310503 222
226 3300010375 Ga0105239_10110066 Ga0105239_101100663 222
227 3300013296 Ga0157374_10121707 Ga0157374_101217072 222
228 3300013297 Ga0157378_10067180 Ga0157378_100671804 222
229 3300013306 Ga0163162_10048408 Ga0163162_100484085 222
230 3300013308 Ga0157375_10240969 Ga0157375_102409691 222
231 3300014745 Ga0157377_10158136 Ga0157377_101581363 222
232 3300014745 Ga0157377_10272348 Ga0157377_102723482 222
233 3300017792 Ga0163161_10104503 Ga0163161_101045032 222
234 3300017792 Ga0163161_10447772 Ga0163161_104477722 222
235 3300025893 Ga0207682_10079250 Ga0207682_100792501 222
236 3300025898 Ga0207692_10054785 Ga0207692_100547852 222
237 3300025901 Ga0207688_10002249 Ga0207688_100022497 222
238 3300025903 Ga0207680_10078322 Ga0207680_100783222 222
239 3300025905 Ga0207685_10012397 Ga0207685_100123973 222
240 3300025906 Ga0207699_10081428 Ga0207699_100814282 222
241 3300025907 Ga0207645_10114551 Ga0207645_101145511 222
242 3300025908 Ga0207643_10198336 Ga0207643_101983362 222
243 3300025911 Ga0207654_10090116 Ga0207654_100901163 222
244 3300025914 Ga0207671_10042021 Ga0207671_100420213 222
245 3300025915 Ga0207693_10000743 Ga0207693_1000074329 222
246 3300025916 Ga0207663_10337009 Ga0207663_103370092 222
247 3300025917 Ga0207660_10312994 Ga0207660_103129942 222
248 3300025918 Ga0207662_10216650 Ga0207662_102166502 222
249 3300025920 Ga0207649_10226058 Ga0207649_102260582 222
250 3300025923 Ga0207681_10060312 Ga0207681_100603122 222
251 3300025927 Ga0207687_10017251 Ga0207687_100172513 222
252 3300025927 Ga0207687_10077448 Ga0207687_100774482 222
253 3300025929 Ga0207664_10191556 Ga0207664_101915561 222
254 3300025931 Ga0207644_10186329 Ga0207644_101863292 222
255 3300025933 Ga0207706_10211649 Ga0207706_102116492 222
256 3300025933 Ga0207706_10231054 Ga0207706_102310543 222
257 3300025934 Ga0207686_10436859 Ga0207686_104368592 222
258 3300025939 Ga0207665_10002351 Ga0207665_100023518 222
259 3300025939 Ga0207665_10066109 Ga0207665_100661093 222
260 3300025940 Ga0207691_10099635 Ga0207691_100996352 222
261 3300025941 Ga0207711_10197005 Ga0207711_101970053 222
262 3300025944 Ga0207661_10125453 Ga0207661_101254533 222
263 3300025949 Ga0207667_10257473 Ga0207667_102574732 222
264 3300025961 Ga0207712_10065734 Ga0207712_100657343 222
265 3300025981 Ga0207640_10119540 Ga0207640_101195403 222
266 3300026035 Ga0207703_10302312 Ga0207703_103023122 222
267 3300026067 Ga0207678_10028987 Ga0207678_100289875 222
268 3300026075 Ga0207708_10016776 Ga0207708_100167765 222
269 3300026078 Ga0207702_10403596 Ga0207702_104035961 222
270 3300026088 Ga0207641_10221732 Ga0207641_102217322 222
271 3300026089 Ga0207648_10035984 Ga0207648_100359844 222
272 3300026095 Ga0207676_10688724 Ga0207676_106887242 222
273 3300026118 Ga0207675_100175796 Ga0207675_1001757962 222
274 3300026121 Ga0207683_10053355 Ga0207683_100533554 222
275 3300026142 Ga0207698_10443297 Ga0207698_104432972 222
276 3300028379 Ga0268266_10019643 Ga0268266_100196433 222
277 3300028379 Ga0268266_10601831 Ga0268266_106018312 222
278 3300028380 Ga0268265_10397794 Ga0268265_103977942 222
279 3300028381 Ga0268264_10234556 Ga0268264_102345563 222
280 3300035084 Ga0373928_0028000 Ga0373928_0028000_196_864 222
281 3300035091 Ga0373951_0039125 Ga0373951_0039125_156_824 222
282 3300035691 Ga0373931_0008925 Ga0373931_0008925_2929_3597 222
283 3300035725 Ga0373947_0222455 Ga0373947_0222455_394_1062 222
284 3300041411 Ga0439466_0022726 Ga0439466_0022726_999_1667 222
285 3300041492 Ga0451835_0981626 Ga0451835_0981626_39_707 222
286 3300044658 Ga0466972_0014282 Ga0466972_0014282_1181_1876 222
287 3300044658 Ga0466972_0048882 Ga0466972_0048882_128_796 222
288 3300044683 Ga0466965_0000761 Ga0466965_0000761_1189_1884 222
289 3300044901 Ga0466960_0000215 Ga0466960_0000215_16645_17340 222
290 3300044901 Ga0466960_0024021 Ga0466960_0024021_1584_2252 222
291 3300046459 Ga0495629_0012353 Ga0495629_0012353_4234_4902 222
292 3300046461 Ga0495641_0049950 Ga0495641_0049950_803_1471 222
293 3300046506 Ga0495583_0189696 Ga0495583_0189696_89_757 222
294 3300046507 Ga0495606_0199653 Ga0495606_0199653_374_1045 222
295 3300046517 Ga0495630_0075917 Ga0495630_0075917_442_1110 222
296 3300046531 Ga0495665_0106491 Ga0495665_0106491_75_743 222
297 3300046533 Ga0495640_0013725 Ga0495640_0013725_1467_2135 222
298 3300046616 Ga0495668_0019960 Ga0495668_0019960_749_1417 222
299 3300046648 Ga0495611_0052980 Ga0495611_0052980_273_941 222
300 3300046690 Ga0495624_0041156 Ga0495624_0041156_173_841 222
301 3300046692 Ga0495671_0103952 Ga0495671_0103952_22_690 222
302 3300047320 Ga0495672_0001155 Ga0495672_0001155_2565_3233 222
303 3300047321 Ga0495676_0220316 Ga0495676_0220316_625_1293 222
304 3300047469 Ga0495673_0000708 Ga0495673_0000708_16400_17068 222
305 3300047673 Ga0495593_0013227 Ga0495593_0013227_2643_3311 222
306 3300048903 Ga0496100_0340370 Ga0496100_0340370_222_890 222
307 3300048904 Ga0496101_0169290 Ga0496101_0169290_911_1579 222
308 3300048905 Ga0496102_0000037 Ga0496102_0000037_139578_140246 222
309 3300048905 Ga0496102_0314504 Ga0496102_0314504_708_1379 222
310 3300048905 Ga0496102_0336127 Ga0496102_0336127_131_799 222
311 3300048906 Ga0496103_0000004 Ga0496103_0000004_450290_450958 222
312 3300048906 Ga0496103_0439411 Ga0496103_0439411_102_773 222
313 3300048908 Ga0496105_0554664 Ga0496105_0554664_171_839 222
314 3300048909 Ga0496106_0003936 Ga0496106_0003936_8397_9065 222
315 3300048911 Ga0496108_0000188 Ga0496108_0000188_45210_45878 222
316 3300048911 Ga0496108_0054013 Ga0496108_0054013_1040_1711 222
317 3300048911 Ga0496108_0122322 Ga0496108_0122322_1176_1847 222
318 3300048912 Ga0496109_0004324 Ga0496109_0004324_8735_9403 222
319 3300048912 Ga0496109_0170333 Ga0496109_0170333_1183_1854 222
320 3300048913 Ga0496110_0037047 Ga0496110_0037047_1166_1834 222
321 3300048915 Ga0496112_0023995 Ga0496112_0023995_4295_4966 222
322 3300048915 Ga0496112_0046363 Ga0496112_0046363_3557_4228 222
323 3300048915 Ga0496112_0160939 Ga0496112_0160939_163_831 222
324 3300048917 Ga0496114_0113126 Ga0496114_0113126_676_1344 222
325 3300048917 Ga0496114_0297452 Ga0496114_0297452_530_1201 222
326 3300048919 Ga0496116_0000056 Ga0496116_0000056_231737_232405 222
327 3300048920 Ga0496117_0000003 Ga0496117_0000003_1648693_1649361 222
328 3300048921 Ga0496118_0000001 Ga0496118_0000001_1648696_1649364 222
329 3300048922 Ga0496119_0230719 Ga0496119_0230719_151_819 222
330 3300050490 nmdc:mga03n38_127659_c1 nmdc:mga03n38_127659_c1_381_1052 222
331 3300050490 nmdc:mga03n38_195995_c1 nmdc:mga03n38_195995_c1_101_772 222
332 3300050509 nmdc:mga0qj67_179153_c1 nmdc:mga0qj67_179153_c1_537_1205 222
333 3300053083 Ga0495655_0005089 Ga0495655_0005089_870_1541 222

Structural Annotation

Top 5 Hits

ID Description Score Start End
4wsp-assembly1.cif.gz_A racemic crystal structure of rv1738 from mycobacterium tuberculosis (form-i) 0.7689 138 179
3hdj-assembly1.cif.gz_B the crystal structure of probable ornithine cyclodeaminase from bordetella pertussis tohama i 0.7402 141 179
6w3g-assembly2.cif.gz_B rd1ntf2_04 with long sheet 0.7244 146 178
4d1t-assembly1.cif.gz_A high resolution structure of native tvim-7 from pseudomonas aeruginosa 0.7093 148 181
4d1w-assembly1.cif.gz_A a h224y mutant for vim-7 from pseudomonas aeruginosa 0.6984 148 181
ID Description Score Start End Superfamily
af_Q18065_76_189_3.30.505.10 Alpha Beta;2-Layer Sandwich;SHC Adaptor Protein;SH2 domain 0.8238 146 179 3.30.505.10
3hdjB01 Alpha Beta;2-Layer Sandwich;ornithine cyclodeaminase, domain 1;ornithine cyclodeaminase, domain 1 0.7402 141 179 3.30.1780.10
af_A0A1D6GMB4_657_734_3.30.160.20 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain; 0.6942 146 183 3.30.160.20
1m2xC00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6823 148 181 3.60.15.10
5lscA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.6607 148 182 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A2S8NAX7-F1-model_v4 deleted 0.9655 72 155
AF-A0A3S4VIY7-F1-model_v4 DUF5642 domain-containing protein 0.9535 18 222
AF-A0A1P8XKY7-F1-model_v4 DUF5642 domain-containing protein 0.9517 25 222
AF-A0A2S8NAX7-F1-model_v4 deleted 0.9437 72 155
AF-A0A1V4PV19-F1-model_v4 DUF5642 domain-containing protein 0.9422 18 222

Feature Viewer

pLDDT pTM Quality
85.51 0.78 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map