F411506

General Info

Members Datasets Scaffolds Average Seq Length
333 170 325 142

Family's Representative Sequence

Representative Sequence 3300046665|Ga0495661_0036145|Ga0495661_0036145_2525_2974
Length 149
Sequence MPTKIESKIEVSKISEPHDLEKAFAIRREVFVEEQNCPPELEHENEDVSTHFLATVNGEPAGAARWRKTDKGYKLERFAVLSKFRGGVGSELVKVVLADLPANAGYIYLHAQTPAVSLYEKFGFEKIGPEFEEAGIKHYKMVKGDRFKR

Samples

Sample ID Description Type Environment
1 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
2 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
3 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
4 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
5 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
6 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
7 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
8 2977232053 Mucilaginibacter terrae SORGH_AS 422 Isolate Unclassified
9 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
13 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
14 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
24 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
25 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
30 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
31 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
77 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
79 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
111 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
112 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
113 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
114 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
115 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
116 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
117 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
126 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
127 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
139 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
144 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
153 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
157 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
158 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
161 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
162 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
163 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
164 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
165 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
166 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
167 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
168 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
169 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
170 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97
Metatranscriptomes 0.6
Isolates 2.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.51
Nodule 0
Rhizoplane 0.6
Rhizosphere 85.29
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008507 3300001904 Bacteria 1704
2 JGI24740J21852_10010066 3300001979 Bacteria 3663
3 JGI24739J22299_10054920 3300001989 Bacteria 1275
4 JGI24737J22298_10001541 3300001990 Bacteria 8204
5 JGI24737J22298_10024403 3300001990 Bacteria 1914
6 JGI24735J21928_10000002 3300002067 Bacteria 624895
7 JGI24744J21845_10002274 3300002077 Bacteria 3912
8 JGI25162J39368_1000062 3300002737 Bacteria 135587
9 JGI25162J39368_1001209 3300002737 Bacteria 15032
10 JGI25157J39369_1006030 3300002741 Bacteria 1896
11 JGI25164J39214_1004001 3300002772 Bacteria 1759
12 JGI25165J46597_1000862 3300003214 Bacteria 21841
13 rootH2_10008008 3300003320 Bacteria 1862
14 rootH2_10016472 3300003320 Bacteria 21539
15 rootH2_10024843 3300003320 Bacteria 5159
16 rootH2_10147865 3300003320 Bacteria 4887
17 rootH2_10152196 3300003320 Bacteria 2885
18 rootL2_10330910 3300003322 Bacteria 2308
19 rootH1_10018482 3300003323 Bacteria 48371
20 rootH1_10064409 3300003323 Bacteria 1355
21 rootH1_10165486 3300003323 Bacteria 3242
22 rootH1_10189091 3300003323 Bacteria 8329
23 rootH1_10238711 3300003323 Bacteria 3480
24 rootH1_10278557 3300003323 Bacteria 1254
25 Ga0055529_1011449 3300003763 Unclassified 1141
26 Ga0058863_11800105 3300004799 Bacteria 4333
27 Ga0058861_11411795 3300004800 Bacteria 1147
28 Ga0065714_10087266 3300005288 Bacteria 2063
29 Ga0070658_10000018 3300005327 Bacteria 200558
30 Ga0070658_10336411 3300005327 Bacteria 1291
31 Ga0070658_10408129 3300005327 Bacteria 1167
32 Ga0070658_10479715 3300005327 Bacteria 1073
33 Ga0070676_10002876 3300005328 Bacteria 8893
34 Ga0070683_100230867 3300005329 Bacteria 1759
35 Ga0070680_100020902 3300005336 Bacteria 5197
36 Ga0068868_100018594 3300005338 Bacteria 5199
37 Ga0070660_100013515 3300005339 Bacteria 5858
38 Ga0070660_100026783 3300005339 Bacteria 4296
39 Ga0070660_100049857 3300005339 Bacteria 3220
40 Ga0070660_100122593 3300005339 Bacteria 2075
41 Ga0070671_100171314 3300005355 Bacteria 1836
42 Ga0070673_100000909 3300005364 Bacteria 16718
43 Ga0070673_101549976 3300005364 Bacteria 625
44 Ga0070659_100000899 3300005366 Bacteria 21771
45 Ga0070659_100130047 3300005366 Bacteria 2044
46 Ga0070659_100341988 3300005366 Bacteria 1254
47 Ga0070678_100000238 3300005456 Bacteria 25199
48 Ga0070662_100000343 3300005457 Bacteria 27936
49 Ga0070662_100079447 3300005457 Bacteria 2439
50 Ga0070681_10050496 3300005458 Bacteria 4149
51 Ga0068867_100001894 3300005459 Bacteria 14557
52 Ga0070679_100080977 3300005530 Bacteria 3236
53 Ga0068853_100140798 3300005539 Bacteria 2165
54 Ga0068853_100148840 3300005539 Bacteria 2106
55 Ga0070665_100000072 3300005548 Bacteria 198575
56 Ga0068855_100000019 3300005563 Bacteria 205963
57 Ga0068855_100000268 3300005563 Bacteria 64693
58 Ga0068855_100150023 3300005563 Bacteria 2651
59 Ga0068855_100378864 3300005563 Bacteria 1554
60 Ga0068855_100515292 3300005563 Bacteria 1298
61 Ga0068855_100530619 3300005563 Bacteria 1276
62 Ga0068855_101057928 3300005563 Bacteria 850
63 Ga0068854_100037735 3300005578 Bacteria 3393
64 Ga0068856_100000169 3300005614 Bacteria 67660
65 Ga0068856_100007535 3300005614 Bacteria 10621
66 Ga0068856_100158977 3300005614 Bacteria 2270
67 Ga0068856_100816400 3300005614 Bacteria 952
68 Ga0068852_100000143 3300005616 Bacteria 48192
69 Ga0068866_10099066 3300005718 Bacteria 1604
70 Ga0068870_10724455 3300005840 Bacteria 688
71 Ga0068860_100946031 3300005843 Bacteria 879
72 Ga0075366_10000741 3300006195 Bacteria 15511
73 Ga0097621_100000028 3300006237 Bacteria 71678
74 Ga0068871_100000066 3300006358 Bacteria 57980
75 Ga0068865_100000551 3300006881 Bacteria 20805
76 Ga0105240_10000876 3300009093 Bacteria 54171
77 Ga0105240_10007839 3300009093 Bacteria 15410
78 Ga0105240_10010800 3300009093 Bacteria 12792
79 Ga0105240_10032200 3300009093 Bacteria 6790
80 Ga0105240_10038993 3300009093 Bacteria 6088
81 Ga0105240_10297687 3300009093 Bacteria 1847
82 Ga0105240_10424329 3300009093 Bacteria 1493
83 Ga0105240_10436489 3300009093 Bacteria 1468
84 Ga0105240_11350415 3300009093 Bacteria 750
85 Ga0105240_12317864 3300009093 Bacteria 556
86 Ga0105245_10975269 3300009098 Bacteria 891
87 Ga0105243_10961260 3300009148 Bacteria 854
88 Ga0105241_10000711 3300009174 Bacteria 25180
89 Ga0105241_10002900 3300009174 Bacteria 12814
90 Ga0105241_10004477 3300009174 Bacteria 10333
91 Ga0105241_10118584 3300009174 Bacteria 2128
92 Ga0105241_11280573 3300009174 Bacteria 697
93 Ga0105242_10026547 3300009176 Bacteria 4591
94 Ga0105237_10000233 3300009545 Bacteria 79346
95 Ga0105237_10001267 3300009545 Bacteria 33722
96 Ga0105237_10008720 3300009545 Bacteria 10948
97 Ga0105237_10031167 3300009545 Bacteria 5409
98 Ga0105237_10079520 3300009545 Bacteria 3269
99 Ga0105237_10121661 3300009545 Bacteria 2605
100 Ga0105237_10133522 3300009545 Bacteria 2477
101 Ga0105238_10004976 3300009551 Bacteria 13140
102 Ga0105238_10039445 3300009551 Bacteria 4789
103 Ga0105239_10000120 3300010375 Bacteria 110003
104 Ga0105239_10001901 3300010375 Viruses 27265
105 Ga0105239_10008149 3300010375 Bacteria 11956
106 Ga0105239_10012753 3300010375 Bacteria 9351
107 Ga0105239_10013259 3300010375 Bacteria 9160
108 Ga0105239_10087477 3300010375 Bacteria 3435
109 Ga0105239_10145984 3300010375 Bacteria 2638
110 Ga0105239_10738589 3300010375 Bacteria 1126
111 Ga0105239_10743452 3300010375 Unclassified 1122
112 Ga0105246_10460267 3300011119 Bacteria 1071
113 Ga0157373_10000119 3300013100 Bacteria 62053
114 Ga0157373_10005760 3300013100 Bacteria 9275
115 Ga0157371_10000263 3300013102 Bacteria 71557
116 Ga0157371_10013802 3300013102 Bacteria 6120
117 Ga0157371_10026418 3300013102 Bacteria 4220
118 Ga0157371_10087300 3300013102 Bacteria 2209
119 Ga0157370_10031334 3300013104 Bacteria 5203
120 Ga0157370_10038041 3300013104 Bacteria 4657
121 Ga0157370_10064523 3300013104 Bacteria 3467
122 Ga0157370_10235940 3300013104 Bacteria 1693
123 Ga0157369_10010481 3300013105 Bacteria 10555
124 Ga0157369_10128122 3300013105 Bacteria 2690
125 Ga0157369_10227007 3300013105 Bacteria 1953
126 Ga0157369_10227008 3300013105 Bacteria 1953
127 Ga0157369_11770133 3300013105 Unclassified 628
128 Ga0157369_11871789 3300013105 Unclassified 609
129 Ga0157374_10000174 3300013296 Bacteria 59597
130 Ga0157374_10000451 3300013296 Bacteria 37378
131 Ga0157374_10002057 3300013296 Bacteria 16909
132 Ga0157374_11636615 3300013296 Bacteria 668
133 Ga0157378_10011058 3300013297 Bacteria 7900
134 Ga0157378_10053877 3300013297 Bacteria 3582
135 Ga0157378_10474024 3300013297 Bacteria 1246
136 Ga0163162_10000010 3300013306 Bacteria 302032
137 Ga0163162_10085486 3300013306 Bacteria 3231
138 Ga0163162_10434239 3300013306 Bacteria 1445
139 Ga0163162_10956661 3300013306 Bacteria 967
140 Ga0163162_12471665 3300013306 Bacteria 597
141 Ga0157372_10000050 3300013307 Bacteria 140381
142 Ga0157372_10004462 3300013307 Bacteria 14931
143 Ga0157372_10006504 3300013307 Bacteria 12440
144 Ga0157372_10010335 3300013307 Bacteria 9917
145 Ga0157372_10152548 3300013307 Bacteria 2667
146 Ga0157372_10155152 3300013307 Bacteria 2644
147 Ga0157372_10418292 3300013307 Bacteria 1562
148 Ga0157375_10023033 3300013308 Bacteria 5740
149 Ga0157375_10034077 3300013308 Bacteria 4847
150 Ga0157377_10122979 3300014745 Bacteria 1575
151 Ga0157376_10355931 3300014969 Bacteria 1403
152 Ga0157376_10703764 3300014969 Bacteria 1016
153 Ga0157376_10789260 3300014969 Bacteria 961
154 Ga0163161_10021333 3300017792 Bacteria 4553
155 Ga0207427_100172 3300025231 Bacteria 71550
156 Ga0209437_100034 3300025233 Bacteria 494007
157 Ga0209437_100177 3300025233 Bacteria 135759
158 Ga0209026_1000514 3300025250 Bacteria 27275
159 Ga0209026_1004898 3300025250 Bacteria 3785
160 Ga0209148_1026658 3300025254 Unclassified 895
161 Ga0209233_1000038 3300025261 Bacteria 548972
162 Ga0209233_1013244 3300025261 Bacteria 2359
163 Ga0209233_1014150 3300025261 Bacteria 2258
164 Ga0209455_1004071 3300025272 Bacteria 4925
165 Ga0207647_10000076 3300025904 Bacteria 75824
166 Ga0207647_10000328 3300025904 Bacteria 38905
167 Ga0207647_10503933 3300025904 Bacteria 675
168 Ga0207645_10000190 3300025907 Bacteria 49657
169 Ga0207705_10000036 3300025909 Bacteria 200787
170 Ga0207705_10243944 3300025909 Bacteria 1369
171 Ga0207705_10300741 3300025909 Bacteria 1231
172 Ga0207654_10000978 3300025911 Bacteria 15688
173 Ga0207654_10005955 3300025911 Bacteria 6137
174 Ga0207654_10096904 3300025911 Bacteria 1810
175 Ga0207654_10141912 3300025911 Bacteria 1533
176 Ga0207707_10012762 3300025912 Bacteria 7307
177 Ga0207695_10000013 3300025913 Bacteria 821265
178 Ga0207695_10008101 3300025913 Bacteria 13214
179 Ga0207695_10014055 3300025913 Bacteria 9506
180 Ga0207695_10022802 3300025913 Bacteria 7092
181 Ga0207695_10087265 3300025913 Bacteria 3143
182 Ga0207695_10305345 3300025913 Bacteria 1482
183 Ga0207695_10771541 3300025913 Bacteria 842
184 Ga0207695_11257854 3300025913 Bacteria 620
185 Ga0207671_10000663 3300025914 Bacteria 44922
186 Ga0207671_10011450 3300025914 Bacteria 7221
187 Ga0207671_10018264 3300025914 Bacteria 5384
188 Ga0207671_10019639 3300025914 Bacteria 5163
189 Ga0207671_10053402 3300025914 Bacteria 2994
190 Ga0207671_10704275 3300025914 Bacteria 803
191 Ga0207660_10037459 3300025917 Bacteria 3380
192 Ga0207657_10015372 3300025919 Bacteria 7416
193 Ga0207657_10209522 3300025919 Bacteria 1565
194 Ga0207652_10021742 3300025921 Bacteria 5298
195 Ga0207652_10036895 3300025921 Bacteria 4134
196 Ga0207652_10750346 3300025921 Bacteria 869
197 Ga0207694_10012622 3300025924 Bacteria 6365
198 Ga0207694_10898356 3300025924 Bacteria 749
199 Ga0207687_10330775 3300025927 Bacteria 1236
200 Ga0207644_10147961 3300025931 Bacteria 1815
201 Ga0207690_10000594 3300025932 Bacteria 23425
202 Ga0207706_10000778 3300025933 Bacteria 33033
203 Ga0207706_10200189 3300025933 Bacteria 1752
204 Ga0207686_10154993 3300025934 Bacteria 1599
205 Ga0207709_10184409 3300025935 Bacteria 1476
206 Ga0207704_10000073 3300025938 Bacteria 62449
207 Ga0207661_10281621 3300025944 Bacteria 1486
208 Ga0207667_10000020 3300025949 Bacteria 374770
209 Ga0207667_10001079 3300025949 Bacteria 34634
210 Ga0207667_10116291 3300025949 Bacteria 2756
211 Ga0207667_10379059 3300025949 Bacteria 1441
212 Ga0207651_10081127 3300025960 Bacteria 2337
213 Ga0207651_10651273 3300025960 Unclassified 925
214 Ga0207677_10042768 3300026023 Bacteria 3007
215 Ga0207639_10007665 3300026041 Bacteria 7369
216 Ga0207639_10046653 3300026041 Bacteria 3270
217 Ga0207639_10936271 3300026041 Bacteria 810
218 Ga0207678_11440932 3300026067 Bacteria 608
219 Ga0207702_10000142 3300026078 Bacteria 85850
220 Ga0207702_10027040 3300026078 Bacteria 4764
221 Ga0207702_10031776 3300026078 Bacteria 4402
222 Ga0207702_10292195 3300026078 Bacteria 1544
223 Ga0207702_10850804 3300026078 Bacteria 903
224 Ga0207702_11880089 3300026078 Bacteria 590
225 Ga0207648_10000347 3300026089 Bacteria 50952
226 Ga0207683_10007777 3300026121 Bacteria 9171
227 Ga0207698_10006150 3300026142 Bacteria 7474
228 Ga0268266_10000089 3300028379 Bacteria 198566
229 Ga0307517_10006296 3300028786 Bacteria 17624
230 Ga0307515_10001341 3300028794 Bacteria 55716
231 Ga0265338_10015011 3300028800 Bacteria 8555
232 Ga0265338_10195353 3300028800 Bacteria 1530
233 Ga0265327_10131932 3300031251 Bacteria 1175
234 Ga0307509_10128724 3300031507 Bacteria 2492
235 Ga0307413_10641343 3300031824 Unclassified 875
236 Ga0307510_10001230 3300033180 Bacteria 27766
237 Ga0373941_0044495 3300035115 Bacteria 1385
238 Ga0395899_0000002 3300037312 Bacteria 1324310
239 Ga0395899_0000592 3300037312 Bacteria 38093
240 Ga0395899_0000640 3300037312 Bacteria 36134
241 Ga0395900_0000095 3300037418 Bacteria 164383
242 Ga0395900_0000277 3300037418 Bacteria 77256
243 Ga0395900_0102315 3300037418 Bacteria 2943
244 Ga0395900_0187212 3300037418 Bacteria 2101
245 Ga0395898_0010001 3300037466 Bacteria 9931
246 Ga0395898_0457616 3300037466 Unclassified 1215
247 Ga0395905_0000068 3300037471 Bacteria 177163
248 Ga0395905_0000727 3300037471 Bacteria 43437
249 Ga0395901_0000199 3300038443 Bacteria 76415
250 Ga0395901_0003544 3300038443 Bacteria 15730
251 Ga0395901_0325552 3300038443 Bacteria 1589
252 Ga0395901_0590725 3300038443 Bacteria 1121
253 Ga0436361_0399615 3300039447 Bacteria 11828
254 Ga0439445_0147887 3300042004 Unclassified 683
255 Ga0439448_0013151 3300042005 Bacteria 2485
256 Ga0466969_0088052 3300044656 Unclassified 1474
257 Ga0466966_0006027 3300044684 Bacteria 8004
258 Ga0466966_0144608 3300044684 Bacteria 1452
259 Ga0466961_0099451 3300044693 Bacteria 1833
260 Ga0466959_0046967 3300045049 Bacteria 3177
261 Ga0495592_0277512 3300046454 Bacteria 1097
262 Ga0495651_0119335 3300046462 Bacteria 1940
263 Ga0495651_0523190 3300046462 Bacteria 757
264 Ga0495650_0000003 3300046471 Bacteria 900730
265 Ga0495585_0000771 3300046492 Bacteria 28305
266 Ga0495596_0161353 3300046500 Bacteria 871
267 Ga0495583_0030894 3300046506 Bacteria 2603
268 Ga0495606_0000116 3300046507 Bacteria 134901
269 Ga0495606_0112512 3300046507 Bacteria 1640
270 Ga0495606_0125936 3300046507 Bacteria 1528
271 Ga0495606_0268344 3300046507 Bacteria 939
272 Ga0495610_0011164 3300046512 Bacteria 5510
273 Ga0495616_0040717 3300046513 Bacteria 2372
274 Ga0495631_0034289 3300046518 Bacteria 2276
275 Ga0495631_0113479 3300046518 Bacteria 1165
276 Ga0495632_0039014 3300046519 Bacteria 2401
277 Ga0495644_0005847 3300046523 Bacteria 4805
278 Ga0495642_0112912 3300046528 Bacteria 1162
279 Ga0495652_0039039 3300046529 Bacteria 4107
280 Ga0495652_0573387 3300046529 Bacteria 773
281 Ga0495609_0059238 3300046538 Bacteria 1693
282 Ga0495633_0000044 3300046558 Bacteria 171185
283 Ga0495633_0010869 3300046558 Bacteria 4948
284 Ga0495668_0000449 3300046616 Bacteria 52562
285 Ga0495668_0456845 3300046616 Bacteria 703
286 Ga0495634_0680792 3300046642 Bacteria 592
287 Ga0495625_0000219 3300046660 Bacteria 90690
288 Ga0495625_0006083 3300046660 Bacteria 10825
289 Ga0495625_0050885 3300046660 Bacteria 2971
290 Ga0495625_0192827 3300046660 Bacteria 1349
291 Ga0495661_0001581 3300046665 Bacteria 18761
292 Ga0495661_0023473 3300046665 Bacteria 4004
293 Ga0495661_0036145 3300046665 Bacteria 3095
294 Ga0495669_0091645 3300046684 Bacteria 1404
295 Ga0495669_0454637 3300046684 Bacteria 622
296 Ga0495670_0205056 3300046691 Bacteria 1045
297 Ga0495671_0515612 3300046692 Bacteria 570
298 Ga0495649_0000037 3300046694 Bacteria 133848
299 Ga0495649_0112229 3300046694 Bacteria 1445
300 Ga0495589_0121900 3300046794 Bacteria 1255
301 Ga0495683_0035813 3300047323 Bacteria 2522
302 Ga0495683_0064473 3300047323 Bacteria 1809
303 Ga0495687_000484 3300047443 Bacteria 48242
304 Ga0495687_001565 3300047443 Bacteria 20768
305 Ga0495679_181512 3300047446 Bacteria 557
306 Ga0495685_044318 3300047447 Bacteria 1517
307 Ga0495673_0057026 3300047469 Bacteria 1687
308 Ga0495686_0000372 3300047472 Bacteria 72285
309 Ga0495686_0001661 3300047472 Bacteria 23172
310 Ga0495686_0070737 3300047472 Bacteria 2149
311 Ga0495686_0216454 3300047472 Bacteria 1092
312 Ga0495686_0236010 3300047472 Bacteria 1033
313 Ga0496115_0863057 3300048918 Unclassified 700
314 Ga0495678_011315 3300049459 Bacteria 4277
315 nmdc:mga0k408_1005_c1 3300050493 Bacteria 15517
316 Ga0500635_0000806 3300053080 Bacteria 7735
317 Ga0500635_0027167 3300053080 Bacteria 1817
318 Ga0500608_000453 3300053122 Bacteria 15356
319 Ga0500618_000001 3300053125 Bacteria 538477
320 Ga0500642_0040250 3300053130 Bacteria 2014
321 Ga0500642_0046373 3300053130 Bacteria 1900
322 Ga0500564_068242 3300053138 Bacteria 1607
323 Ga0500616_0267039 3300053153 Bacteria 724
324 Ga0500622_0000584 3300053156 Bacteria 33074
325 Ga0500624_000539 3300053157 Bacteria 10713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_12471665 Ga0163162_124716651 131
2 3300013100 Ga0157373_10005760 Ga0157373_100057603 134
3 3300013102 Ga0157371_10000263 Ga0157371_1000026366 134
4 3300013104 Ga0157370_10064523 Ga0157370_100645234 134
5 3300013105 Ga0157369_10227007 Ga0157369_102270072 134
6 3300013105 Ga0157369_10227008 Ga0157369_102270082 134
7 3300013307 Ga0157372_10004462 Ga0157372_100044626 134
8 3300038443 Ga0395901_0325552 Ga0395901_0325552_290_694 134
9 iso_pu_bacteria 2599185184 2599478558 137
10 iso_pu_bacteria 2852623160 2852626875 137
11 iso_pu_bacteria 2884933994 2884938076 137
12 iso_pu_bacteria 2928078545 2928080388 137
13 iso_pu_bacteria 2928147474 2928149439 137
14 iso_pu_bacteria 2932082852 2932083268 137
15 iso_pu_bacteria 2977232053 2977232841 137
16 3300003320 rootH2_10024843 rootH2_100248432 138
17 3300003320 rootH2_10152196 rootH2_101521962 138
18 3300003322 rootL2_10330910 rootL2_103309102 138
19 3300003323 rootH1_10064409 rootH1_100644091 138
20 3300005327 Ga0070658_10000018 Ga0070658_1000001863 138
21 3300013296 Ga0157374_10000451 Ga0157374_100004519 138
22 3300013306 Ga0163162_10434239 Ga0163162_104342392 138
23 3300014969 Ga0157376_10355931 Ga0157376_103559312 138
24 3300025909 Ga0207705_10000036 Ga0207705_10000036132 138
25 3300039447 Ga0436361_0399615 Ga0436361_0399615_11373_11789 138
26 3300002741 JGI25157J39369_1006030 JGI25157J39369_10060303 139
27 3300003323 rootH1_10238711 rootH1_102387113 139
28 3300003323 rootH1_10278557 rootH1_102785572 139
29 3300005327 Ga0070658_10408129 Ga0070658_104081292 139
30 3300005329 Ga0070683_100230867 Ga0070683_1002308672 139
31 3300005339 Ga0070660_100013515 Ga0070660_1000135152 139
32 3300005366 Ga0070659_100000899 Ga0070659_10000089919 139
33 3300005563 Ga0068855_100530619 Ga0068855_1005306192 139
34 3300013100 Ga0157373_10000119 Ga0157373_1000011923 139
35 3300013307 Ga0157372_10010335 Ga0157372_100103353 139
36 3300025250 Ga0209026_1000514 Ga0209026_10005146 139
37 3300025919 Ga0207657_10015372 Ga0207657_100153728 139
38 3300025932 Ga0207690_10000594 Ga0207690_1000059422 139
39 3300025944 Ga0207661_10281621 Ga0207661_102816212 139
40 3300031824 Ga0307413_10641343 Ga0307413_106413431 139
41 3300047472 Ga0495686_0216454 Ga0495686_0216454_117_539 139
42 iso_pu_bacteria 2919437846 2919441023 139
43 3300002077 JGI24744J21845_10002274 JGI24744J21845_100022745 140
44 3300003320 rootH2_10016472 rootH2_1001647222 140
45 3300005327 Ga0070658_10479715 Ga0070658_104797152 140
46 3300005328 Ga0070676_10002876 Ga0070676_100028769 140
47 3300005338 Ga0068868_100018594 Ga0068868_1000185945 140
48 3300005364 Ga0070673_100000909 Ga0070673_1000009094 140
49 3300005456 Ga0070678_100000238 Ga0070678_1000002389 140
50 3300005459 Ga0068867_100001894 Ga0068867_10000189410 140
51 3300005530 Ga0070679_100080977 Ga0070679_1000809774 140
52 3300005539 Ga0068853_100140798 Ga0068853_1001407982 140
53 3300005539 Ga0068853_100148840 Ga0068853_1001488402 140
54 3300005548 Ga0070665_100000072 Ga0070665_10000007231 140
55 3300005563 Ga0068855_100000268 Ga0068855_10000026875 140
56 3300005563 Ga0068855_100150023 Ga0068855_1001500234 140
57 3300005614 Ga0068856_100007535 Ga0068856_1000075352 140
58 3300005616 Ga0068852_100000143 Ga0068852_10000014337 140
59 3300005718 Ga0068866_10099066 Ga0068866_100990662 140
60 3300005840 Ga0068870_10724455 Ga0068870_107244551 140
61 3300006237 Ga0097621_100000028 Ga0097621_10000002854 140
62 3300006358 Ga0068871_100000066 Ga0068871_10000006651 140
63 3300006881 Ga0068865_100000551 Ga0068865_10000055119 140
64 3300009093 Ga0105240_10010800 Ga0105240_100108003 140
65 3300009093 Ga0105240_10424329 Ga0105240_104243291 140
66 3300009148 Ga0105243_10961260 Ga0105243_109612602 140
67 3300009174 Ga0105241_10002900 Ga0105241_1000290014 140
68 3300009176 Ga0105242_10026547 Ga0105242_100265474 140
69 3300009545 Ga0105237_10001267 Ga0105237_1000126728 140
70 3300009551 Ga0105238_10004976 Ga0105238_1000497613 140
71 3300010375 Ga0105239_10012753 Ga0105239_100127537 140
72 3300013102 Ga0157371_10026418 Ga0157371_100264183 140
73 3300013104 Ga0157370_10038041 Ga0157370_100380412 140
74 3300013105 Ga0157369_11770133 Ga0157369_117701331 140
75 3300013296 Ga0157374_10000174 Ga0157374_1000017434 140
76 3300013297 Ga0157378_10011058 Ga0157378_100110584 140
77 3300013306 Ga0163162_10000010 Ga0163162_1000001097 140
78 3300013307 Ga0157372_10418292 Ga0157372_104182922 140
79 3300014969 Ga0157376_10789260 Ga0157376_107892601 140
80 3300025907 Ga0207645_10000190 Ga0207645_1000019047 140
81 3300025909 Ga0207705_10243944 Ga0207705_102439441 140
82 3300025911 Ga0207654_10005955 Ga0207654_100059552 140
83 3300025913 Ga0207695_10008101 Ga0207695_1000810111 140
84 3300025913 Ga0207695_11257854 Ga0207695_112578541 140
85 3300025914 Ga0207671_10053402 Ga0207671_100534024 140
86 3300025921 Ga0207652_10750346 Ga0207652_107503461 140
87 3300025924 Ga0207694_10012622 Ga0207694_100126223 140
88 3300025934 Ga0207686_10154993 Ga0207686_101549932 140
89 3300025935 Ga0207709_10184409 Ga0207709_101844092 140
90 3300025938 Ga0207704_10000073 Ga0207704_1000007361 140
91 3300025949 Ga0207667_10001079 Ga0207667_1000107913 140
92 3300025949 Ga0207667_10116291 Ga0207667_101162914 140
93 3300025960 Ga0207651_10081127 Ga0207651_100811271 140
94 3300026023 Ga0207677_10042768 Ga0207677_100427682 140
95 3300026041 Ga0207639_10007665 Ga0207639_100076658 140
96 3300026041 Ga0207639_10046653 Ga0207639_100466532 140
97 3300026067 Ga0207678_11440932 Ga0207678_114409321 140
98 3300026078 Ga0207702_10292195 Ga0207702_102921952 140
99 3300026089 Ga0207648_10000347 Ga0207648_1000034755 140
100 3300026121 Ga0207683_10007777 Ga0207683_100077779 140
101 3300026142 Ga0207698_10006150 Ga0207698_100061505 140
102 3300028379 Ga0268266_10000089 Ga0268266_1000008931 140
103 3300031251 Ga0265327_10131932 Ga0265327_101319321 140
104 3300037418 Ga0395900_0102315 Ga0395900_0102315_1275_1697 140
105 3300037466 Ga0395898_0457616 Ga0395898_0457616_635_1057 140
106 3300037471 Ga0395905_0000727 Ga0395905_0000727_26097_26519 140
107 3300038443 Ga0395901_0003544 Ga0395901_0003544_7548_7970 140
108 3300046616 Ga0495668_0000449 Ga0495668_0000449_14621_15046 140
109 3300001979 JGI24740J21852_10010066 JGI24740J21852_100100665 141
110 3300001989 JGI24739J22299_10054920 JGI24739J22299_100549201 141
111 3300001990 JGI24737J22298_10001541 JGI24737J22298_100015413 141
112 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002395 141
113 3300002737 JGI25162J39368_1000062 JGI25162J39368_100006262 141
114 3300002737 JGI25162J39368_1001209 JGI25162J39368_100120912 141
115 3300002772 JGI25164J39214_1004001 JGI25164J39214_10040012 141
116 3300003214 JGI25165J46597_1000862 JGI25165J46597_10008624 141
117 3300003320 rootH2_10147865 rootH2_101478657 141
118 3300003323 rootH1_10018482 rootH1_1001848219 141
119 3300003323 rootH1_10165486 rootH1_101654861 141
120 3300003763 Ga0055529_1011449 Ga0055529_10114492 141
121 3300004799 Ga0058863_11800105 Ga0058863_118001052 141
122 3300004800 Ga0058861_11411795 Ga0058861_114117952 141
123 3300005288 Ga0065714_10087266 Ga0065714_100872662 141
124 3300005336 Ga0070680_100020902 Ga0070680_1000209025 141
125 3300005339 Ga0070660_100026783 Ga0070660_1000267833 141
126 3300005355 Ga0070671_100171314 Ga0070671_1001713141 141
127 3300005364 Ga0070673_101549976 Ga0070673_1015499761 141
128 3300005366 Ga0070659_100130047 Ga0070659_1001300472 141
129 3300005457 Ga0070662_100000343 Ga0070662_1000003439 141
130 3300005457 Ga0070662_100079447 Ga0070662_1000794471 141
131 3300005458 Ga0070681_10050496 Ga0070681_100504964 141
132 3300005563 Ga0068855_100000019 Ga0068855_100000019161 141
133 3300005563 Ga0068855_100378864 Ga0068855_1003788642 141
134 3300005563 Ga0068855_100515292 Ga0068855_1005152923 141
135 3300005563 Ga0068855_101057928 Ga0068855_1010579282 141
136 3300005614 Ga0068856_100000169 Ga0068856_10000016912 141
137 3300005614 Ga0068856_100816400 Ga0068856_1008164002 141
138 3300005843 Ga0068860_100946031 Ga0068860_1009460311 141
139 3300006195 Ga0075366_10000741 Ga0075366_100007412 141
140 3300009093 Ga0105240_10007839 Ga0105240_100078398 141
141 3300009093 Ga0105240_10038993 Ga0105240_100389934 141
142 3300009093 Ga0105240_10436489 Ga0105240_104364891 141
143 3300009093 Ga0105240_11350415 Ga0105240_113504151 141
144 3300009098 Ga0105245_10975269 Ga0105245_109752692 141
145 3300009174 Ga0105241_10000711 Ga0105241_1000071118 141
146 3300009174 Ga0105241_10118584 Ga0105241_101185843 141
147 3300009174 Ga0105241_11280573 Ga0105241_112805732 141
148 3300009545 Ga0105237_10008720 Ga0105237_100087205 141
149 3300009545 Ga0105237_10079520 Ga0105237_100795205 141
150 3300009545 Ga0105237_10121661 Ga0105237_101216613 141
151 3300010375 Ga0105239_10001901 Ga0105239_1000190123 141
152 3300010375 Ga0105239_10008149 Ga0105239_1000814913 141
153 3300010375 Ga0105239_10145984 Ga0105239_101459843 141
154 3300010375 Ga0105239_10738589 Ga0105239_107385891 141
155 3300010375 Ga0105239_10743452 Ga0105239_107434522 141
156 3300011119 Ga0105246_10460267 Ga0105246_104602672 141
157 3300013102 Ga0157371_10013802 Ga0157371_100138026 141
158 3300013102 Ga0157371_10087300 Ga0157371_100873002 141
159 3300013104 Ga0157370_10031334 Ga0157370_100313343 141
160 3300013104 Ga0157370_10235940 Ga0157370_102359402 141
161 3300013105 Ga0157369_10010481 Ga0157369_1001048110 141
162 3300013105 Ga0157369_10128122 Ga0157369_101281223 141
163 3300013105 Ga0157369_11871789 Ga0157369_118717892 141
164 3300013296 Ga0157374_10002057 Ga0157374_1000205720 141
165 3300013296 Ga0157374_11636615 Ga0157374_116366151 141
166 3300013297 Ga0157378_10053877 Ga0157378_100538771 141
167 3300013297 Ga0157378_10474024 Ga0157378_104740243 141
168 3300013306 Ga0163162_10085486 Ga0163162_100854863 141
169 3300013307 Ga0157372_10000050 Ga0157372_1000005064 141
170 3300013307 Ga0157372_10006504 Ga0157372_100065047 141
171 3300013307 Ga0157372_10152548 Ga0157372_101525483 141
172 3300013307 Ga0157372_10155152 Ga0157372_101551522 141
173 3300013308 Ga0157375_10023033 Ga0157375_100230335 141
174 3300013308 Ga0157375_10034077 Ga0157375_100340777 141
175 3300014745 Ga0157377_10122979 Ga0157377_101229792 141
176 3300014969 Ga0157376_10703764 Ga0157376_107037642 141
177 3300025231 Ga0207427_100172 Ga0207427_10017226 141
178 3300025233 Ga0209437_100034 Ga0209437_100034131 141
179 3300025233 Ga0209437_100177 Ga0209437_10017761 141
180 3300025254 Ga0209148_1026658 Ga0209148_10266581 141
181 3300025261 Ga0209233_1000038 Ga0209233_1000038131 141
182 3300025272 Ga0209455_1004071 Ga0209455_10040713 141
183 3300025904 Ga0207647_10000328 Ga0207647_1000032824 141
184 3300025904 Ga0207647_10503933 Ga0207647_105039331 141
185 3300025911 Ga0207654_10000978 Ga0207654_1000097810 141
186 3300025911 Ga0207654_10096904 Ga0207654_100969043 141
187 3300025912 Ga0207707_10012762 Ga0207707_100127621 141
188 3300025913 Ga0207695_10014055 Ga0207695_100140558 141
189 3300025913 Ga0207695_10022802 Ga0207695_100228027 141
190 3300025913 Ga0207695_10771541 Ga0207695_107715411 141
191 3300025914 Ga0207671_10018264 Ga0207671_100182645 141
192 3300025914 Ga0207671_10019639 Ga0207671_100196395 141
193 3300025917 Ga0207660_10037459 Ga0207660_100374594 141
194 3300025919 Ga0207657_10209522 Ga0207657_102095222 141
195 3300025921 Ga0207652_10021742 Ga0207652_100217424 141
196 3300025921 Ga0207652_10036895 Ga0207652_100368951 141
197 3300025927 Ga0207687_10330775 Ga0207687_103307752 141
198 3300025931 Ga0207644_10147961 Ga0207644_101479611 141
199 3300025933 Ga0207706_10000778 Ga0207706_1000077810 141
200 3300025933 Ga0207706_10200189 Ga0207706_102001892 141
201 3300025949 Ga0207667_10000020 Ga0207667_100000208 141
202 3300025949 Ga0207667_10379059 Ga0207667_103790593 141
203 3300025960 Ga0207651_10651273 Ga0207651_106512732 141
204 3300026078 Ga0207702_10000142 Ga0207702_1000014276 141
205 3300026078 Ga0207702_10031776 Ga0207702_100317764 141
206 3300026078 Ga0207702_10850804 Ga0207702_108508042 141
207 3300026078 Ga0207702_11880089 Ga0207702_118800891 141
208 3300028786 Ga0307517_10006296 Ga0307517_1000629620 141
209 3300028794 Ga0307515_10001341 Ga0307515_1000134155 141
210 3300028800 Ga0265338_10015011 Ga0265338_1001501111 141
211 3300028800 Ga0265338_10195353 Ga0265338_101953532 141
212 3300031507 Ga0307509_10128724 Ga0307509_101287243 141
213 3300033180 Ga0307510_10001230 Ga0307510_1000123019 141
214 3300035115 Ga0373941_0044495 Ga0373941_0044495_69_497 141
215 3300037312 Ga0395899_0000592 Ga0395899_0000592_22901_23326 141
216 3300037312 Ga0395899_0000640 Ga0395899_0000640_2366_2791 141
217 3300037418 Ga0395900_0000095 Ga0395900_0000095_110104_110529 141
218 3300037418 Ga0395900_0000277 Ga0395900_0000277_66737_67162 141
219 3300037418 Ga0395900_0187212 Ga0395900_0187212_923_1348 141
220 3300037466 Ga0395898_0010001 Ga0395898_0010001_4711_5136 141
221 3300037471 Ga0395905_0000068 Ga0395905_0000068_24104_24529 141
222 3300038443 Ga0395901_0000199 Ga0395901_0000199_44416_44841 141
223 3300038443 Ga0395901_0590725 Ga0395901_0590725_289_714 141
224 3300042005 Ga0439448_0013151 Ga0439448_0013151_243_668 141
225 3300044656 Ga0466969_0088052 Ga0466969_0088052_110_535 141
226 3300044684 Ga0466966_0006027 Ga0466966_0006027_2933_3358 141
227 3300044693 Ga0466961_0099451 Ga0466961_0099451_869_1294 141
228 3300045049 Ga0466959_0046967 Ga0466959_0046967_2684_3109 141
229 3300046454 Ga0495592_0277512 Ga0495592_0277512_432_857 141
230 3300046462 Ga0495651_0119335 Ga0495651_0119335_1062_1490 141
231 3300046462 Ga0495651_0523190 Ga0495651_0523190_95_520 141
232 3300046471 Ga0495650_0000003 Ga0495650_0000003_836916_837341 141
233 3300046492 Ga0495585_0000771 Ga0495585_0000771_26522_26947 141
234 3300046500 Ga0495596_0161353 Ga0495596_0161353_284_709 141
235 3300046506 Ga0495583_0030894 Ga0495583_0030894_157_582 141
236 3300046507 Ga0495606_0000116 Ga0495606_0000116_13922_14347 141
237 3300046507 Ga0495606_0112512 Ga0495606_0112512_377_802 141
238 3300046507 Ga0495606_0125936 Ga0495606_0125936_292_720 141
239 3300046507 Ga0495606_0268344 Ga0495606_0268344_296_721 141
240 3300046512 Ga0495610_0011164 Ga0495610_0011164_2649_3074 141
241 3300046513 Ga0495616_0040717 Ga0495616_0040717_1389_1814 141
242 3300046518 Ga0495631_0034289 Ga0495631_0034289_367_795 141
243 3300046519 Ga0495632_0039014 Ga0495632_0039014_1414_1842 141
244 3300046523 Ga0495644_0005847 Ga0495644_0005847_3388_3813 141
245 3300046528 Ga0495642_0112912 Ga0495642_0112912_697_1122 141
246 3300046529 Ga0495652_0039039 Ga0495652_0039039_2833_3258 141
247 3300046529 Ga0495652_0573387 Ga0495652_0573387_264_689 141
248 3300046538 Ga0495609_0059238 Ga0495609_0059238_674_1099 141
249 3300046558 Ga0495633_0000044 Ga0495633_0000044_142401_142826 141
250 3300046558 Ga0495633_0010869 Ga0495633_0010869_993_1418 141
251 3300046642 Ga0495634_0680792 Ga0495634_0680792_30_458 141
252 3300046660 Ga0495625_0000219 Ga0495625_0000219_72530_72955 141
253 3300046660 Ga0495625_0006083 Ga0495625_0006083_8246_8671 141
254 3300046660 Ga0495625_0050885 Ga0495625_0050885_2446_2871 141
255 3300046665 Ga0495661_0023473 Ga0495661_0023473_1548_1973 141
256 3300046684 Ga0495669_0091645 Ga0495669_0091645_456_884 141
257 3300046684 Ga0495669_0454637 Ga0495669_0454637_124_549 141
258 3300046691 Ga0495670_0205056 Ga0495670_0205056_373_798 141
259 3300046694 Ga0495649_0000037 Ga0495649_0000037_72329_72754 141
260 3300046694 Ga0495649_0112229 Ga0495649_0112229_136_564 141
261 3300046794 Ga0495589_0121900 Ga0495589_0121900_773_1198 141
262 3300047323 Ga0495683_0035813 Ga0495683_0035813_1165_1590 141
263 3300047323 Ga0495683_0064473 Ga0495683_0064473_1086_1511 141
264 3300047443 Ga0495687_000484 Ga0495687_000484_21280_21708 141
265 3300047443 Ga0495687_001565 Ga0495687_001565_2663_3088 141
266 3300047446 Ga0495679_181512 Ga0495679_181512_78_503 141
267 3300047447 Ga0495685_044318 Ga0495685_044318_182_607 141
268 3300047469 Ga0495673_0057026 Ga0495673_0057026_680_1105 141
269 3300047472 Ga0495686_0000372 Ga0495686_0000372_45036_45461 141
270 3300047472 Ga0495686_0070737 Ga0495686_0070737_413_838 141
271 3300047472 Ga0495686_0236010 Ga0495686_0236010_551_976 141
272 3300050493 nmdc:mga0k408_1005_c1 nmdc:mga0k408_1005_c1_370_795 141
273 3300053080 Ga0500635_0027167 Ga0500635_0027167_137_562 141
274 3300053122 Ga0500608_000453 Ga0500608_000453_5576_6004 141
275 3300053125 Ga0500618_000001 Ga0500618_000001_116284_116709 141
276 3300053130 Ga0500642_0046373 Ga0500642_0046373_504_929 141
277 3300053157 Ga0500624_000539 Ga0500624_000539_5345_5770 141
278 3300005614 Ga0068856_100158977 Ga0068856_1001589773 142
279 3300025250 Ga0209026_1004898 Ga0209026_10048981 142
280 3300026078 Ga0207702_10027040 Ga0207702_100270401 142
281 3300046665 Ga0495661_0001581 Ga0495661_0001581_12025_12462 142
282 3300046665 Ga0495661_0036145 Ga0495661_0036145_2525_2974 142
283 3300001904 JGI24736J21556_1008507 JGI24736J21556_10085072 143
284 3300001990 JGI24737J22298_10024403 JGI24737J22298_100244033 143
285 3300003320 rootH2_10008008 rootH2_100080083 143
286 3300003323 rootH1_10189091 rootH1_101890918 143
287 3300005327 Ga0070658_10336411 Ga0070658_103364112 143
288 3300005339 Ga0070660_100049857 Ga0070660_1000498573 143
289 3300005339 Ga0070660_100122593 Ga0070660_1001225932 143
290 3300005366 Ga0070659_100341988 Ga0070659_1003419882 143
291 3300005578 Ga0068854_100037735 Ga0068854_1000377354 143
292 3300009093 Ga0105240_10000876 Ga0105240_1000087628 143
293 3300009093 Ga0105240_10032200 Ga0105240_100322004 143
294 3300009093 Ga0105240_10297687 Ga0105240_102976872 143
295 3300009093 Ga0105240_12317864 Ga0105240_123178641 143
296 3300009174 Ga0105241_10004477 Ga0105241_1000447710 143
297 3300009545 Ga0105237_10000233 Ga0105237_1000023337 143
298 3300009545 Ga0105237_10031167 Ga0105237_100311672 143
299 3300009545 Ga0105237_10133522 Ga0105237_101335223 143
300 3300009551 Ga0105238_10039445 Ga0105238_100394454 143
301 3300010375 Ga0105239_10000120 Ga0105239_1000012036 143
302 3300010375 Ga0105239_10013259 Ga0105239_1001325910 143
303 3300010375 Ga0105239_10087477 Ga0105239_100874773 143
304 3300013306 Ga0163162_10956661 Ga0163162_109566611 143
305 3300017792 Ga0163161_10021333 Ga0163161_100213332 143
306 3300025261 Ga0209233_1013244 Ga0209233_10132443 143
307 3300025261 Ga0209233_1014150 Ga0209233_10141504 143
308 3300025904 Ga0207647_10000076 Ga0207647_1000007636 143
309 3300025909 Ga0207705_10300741 Ga0207705_103007413 143
310 3300025911 Ga0207654_10141912 Ga0207654_101419122 143
311 3300025913 Ga0207695_10000013 Ga0207695_10000013297 143
312 3300025913 Ga0207695_10087265 Ga0207695_100872654 143
313 3300025913 Ga0207695_10305345 Ga0207695_103053451 143
314 3300025914 Ga0207671_10000663 Ga0207671_1000066337 143
315 3300025914 Ga0207671_10011450 Ga0207671_100114508 143
316 3300025914 Ga0207671_10704275 Ga0207671_107042752 143
317 3300025924 Ga0207694_10898356 Ga0207694_108983562 143
318 3300026041 Ga0207639_10936271 Ga0207639_109362712 143
319 3300037312 Ga0395899_0000002 Ga0395899_0000002_976433_976879 143
320 3300042004 Ga0439445_0147887 Ga0439445_0147887_159_656 143
321 3300044684 Ga0466966_0144608 Ga0466966_0144608_275_727 143
322 3300046518 Ga0495631_0113479 Ga0495631_0113479_196_627 143
323 3300046616 Ga0495668_0456845 Ga0495668_0456845_134_565 143
324 3300046660 Ga0495625_0192827 Ga0495625_0192827_503_934 143
325 3300046692 Ga0495671_0515612 Ga0495671_0515612_29_460 143
326 3300047472 Ga0495686_0001661 Ga0495686_0001661_14878_15312 143
327 3300048918 Ga0496115_0863057 Ga0496115_0863057_219_650 143
328 3300049459 Ga0495678_011315 Ga0495678_011315_1258_1689 143
329 3300053080 Ga0500635_0000806 Ga0500635_0000806_6439_6873 143
330 3300053130 Ga0500642_0040250 Ga0500642_0040250_610_1125 143
331 3300053138 Ga0500564_068242 Ga0500564_068242_607_1038 143
332 3300053153 Ga0500616_0267039 Ga0500616_0267039_157_588 143
333 3300053156 Ga0500622_0000584 Ga0500622_0000584_30394_30825 143

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

11

144

0.87

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

19

124

0.82

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

47

126

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jph-assembly1.cif.gz_B structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus in complex with coa 0.9323 9 142
3efa-assembly1.cif.gz_A-2 crystal structure of putative n-acetyltransferase from lactobacillus plantarum 0.8732 7 142
5jph-assembly1.cif.gz_B structure of a gnat acetyltransferase sacol1063 from staphylococcus aureus in complex with coa 0.8701 9 142
1q2y-assembly1.cif.gz_A crystal structure of the protein yjcf from bacillus subtilis: a member of the gcn5-related n-acetyltransferase superfamily fold 0.8664 9 143
3c26-assembly1.cif.gz_A-2 crystal structure of a putative acetyltransferase (np_394282.1) from thermoplasma acidophilum at 2.00 a resolution 0.8612 49 126
ID Description Score Start End Superfamily
af_Q17765_2_142_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8958 8 142 3.40.630.30
af_P0ADQ2_18_164_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8949 8 142 3.40.630.30
af_Q10081_4_149_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8815 6 143 3.40.630.30
5jphB00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8729 8 140 3.40.630.30
1q2yA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8664 9 143 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Q5QM11-F1-model_v4 GNAT family N-acetyltransferase 0.9999 6 141 GO:0016747
AF-A0A4Q3FUA8-F1-model_v4 GNAT family N-acetyltransferase 0.9994 4 128 GO:0016747
AF-A0A179DN41-F1-model_v4 GNAT family acetyltransferase 0.9973 5 141 GO:0016747
AF-A0A444MTV8-F1-model_v4 GNAT family N-acetyltransferase 0.9961 1 142 GO:0016747
AF-A0A519X510-F1-model_v4 N-acetyltransferase 0.9918 5 131 GO:0016747

Feature Viewer

pLDDT pTM Quality
93.92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map