F411499

General Info

Members Datasets Scaffolds Average Seq Length
333 180 332 111

Family's Representative Sequence

Representative Sequence 3300046522|Ga0495643_0361519|Ga0495643_0361519_109_447
Length 112
Sequence MRCNIRKSGDVTILDLQGRLTIGEGDYILRENVRRELSEGARKILVNLEQATVVDSSGIGEMVSGYTTTAHHGGKLKLLKPTPKLRDILHITQLITIFEIYDDEKEAVASYG

Samples

Sample ID Description Type Environment
1 2773857922 Frankia sp. CcI49 Isolate Nodule
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
73 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
149 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
150 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
156 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
168 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
169 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 1.2
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.2
Nodule 0.3
Rhizoplane 0.6
Rhizosphere 95.2
Stem 0
Stem Tuber 0
Unclassified 2.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10097911 3300005293 Bacteria 3631
2 Ga0065707_10090147 3300005295 Unclassified 4201
3 Ga0065707_10154203 3300005295 Unclassified 1625
4 Ga0070658_10043385 3300005327 Bacteria 3633
5 Ga0070676_10231762 3300005328 Unclassified 1224
6 Ga0070676_10967953 3300005328 Unclassified 637
7 Ga0070683_100000086 3300005329 Bacteria 62329
8 Ga0070683_100191061 3300005329 Unclassified 1944
9 Ga0070683_100233367 3300005329 Bacteria 1749
10 Ga0070690_100436837 3300005330 Unclassified 968
11 Ga0070670_100000049 3300005331 Bacteria 132683
12 Ga0070670_100027906 3300005331 Bacteria 4857
13 Ga0070670_100180643 3300005331 Bacteria 1832
14 Ga0070677_10653026 3300005333 Unclassified 588
15 Ga0068869_100048008 3300005334 Bacteria 3085
16 Ga0068869_100077814 3300005334 Unclassified 2469
17 Ga0068869_100261599 3300005334 Unclassified 1385
18 Ga0068869_100275152 3300005334 Bacteria 1352
19 Ga0070680_100020879 3300005336 Bacteria 5199
20 Ga0070682_100120616 3300005337 Bacteria 1760
21 Ga0070682_101312265 3300005337 Unclassified 615
22 Ga0068868_100011815 3300005338 Bacteria 6366
23 Ga0070660_100367583 3300005339 Unclassified 1186
24 Ga0070689_100096294 3300005340 Unclassified 2339
25 Ga0070689_100146601 3300005340 Unclassified 1901
26 Ga0070689_100402777 3300005340 Unclassified 1157
27 Ga0070689_100532437 3300005340 Unclassified 1010
28 Ga0070689_101554754 3300005340 Bacteria 600
29 Ga0070689_101690351 3300005340 Unclassified 576
30 Ga0070687_100002706 3300005343 Bacteria 6709
31 Ga0070687_100066823 3300005343 Bacteria 1917
32 Ga0070687_100282714 3300005343 Bacteria 1045
33 Ga0070687_100938576 3300005343 Bacteria 623
34 Ga0070687_101183283 3300005343 Bacteria 563
35 Ga0070661_100600965 3300005344 Unclassified 889
36 Ga0070661_100716390 3300005344 Bacteria 816
37 Ga0070669_101935749 3300005353 Unclassified 515
38 Ga0070675_100000010 3300005354 Bacteria 243396
39 Ga0070675_100452104 3300005354 Unclassified 1152
40 Ga0070671_100441229 3300005355 Unclassified 1116
41 Ga0070671_100509023 3300005355 Unclassified 1036
42 Ga0070674_100140463 3300005356 Bacteria 1812
43 Ga0070673_100849030 3300005364 Bacteria 845
44 Ga0070659_100290428 3300005366 Unclassified 1362
45 Ga0070709_10121662 3300005434 Bacteria 1770
46 Ga0070709_10546274 3300005434 Bacteria 886
47 Ga0070709_11236665 3300005434 Unclassified 601
48 Ga0070714_100758574 3300005435 Bacteria 938
49 Ga0070713_101099994 3300005436 Bacteria 768
50 Ga0070710_10828143 3300005437 Unclassified 663
51 Ga0070701_10299335 3300005438 Bacteria 988
52 Ga0070705_100027490 3300005440 Unclassified 3107
53 Ga0070700_100000001 3300005441 Bacteria 346167
54 Ga0070708_100015791 3300005445 Bacteria 6242
55 Ga0070708_100816371 3300005445 Bacteria 876
56 Ga0070663_101053899 3300005455 Bacteria 709
57 Ga0070678_100161070 3300005456 Bacteria 1818
58 Ga0070678_100170319 3300005456 Bacteria 1773
59 Ga0068867_100080804 3300005459 Unclassified 2449
60 Ga0070685_10055325 3300005466 Bacteria 2305
61 Ga0070706_100003611 3300005467 Bacteria 15159
62 Ga0070706_100012155 3300005467 Bacteria 7981
63 Ga0070706_100599677 3300005467 Bacteria 1023
64 Ga0070706_100649968 3300005467 Unclassified 979
65 Ga0070707_100007503 3300005468 Bacteria 10127
66 Ga0070707_100117534 3300005468 Bacteria 2581
67 Ga0070707_100122897 3300005468 Bacteria 2520
68 Ga0070707_100236745 3300005468 Unclassified 1777
69 Ga0070698_100024209 3300005471 Bacteria 6335
70 Ga0070698_100057324 3300005471 Bacteria 3942
71 Ga0070698_100067221 3300005471 Unclassified 3605
72 Ga0070698_100178825 3300005471 Bacteria 2060
73 Ga0070698_100341392 3300005471 Bacteria 1429
74 Ga0070699_100014037 3300005518 Bacteria 6891
75 Ga0070699_100040550 3300005518 Bacteria 4031
76 Ga0070699_100074212 3300005518 Bacteria 2960
77 Ga0070699_100195070 3300005518 Bacteria 1800
78 Ga0070684_100009541 3300005535 Bacteria 7648
79 Ga0070684_100031335 3300005535 Bacteria 4526
80 Ga0070697_100109212 3300005536 Bacteria 2303
81 Ga0070697_100146466 3300005536 Bacteria 1988
82 Ga0070697_101473592 3300005536 Bacteria 608
83 Ga0068853_100234882 3300005539 Archaea 1678
84 Ga0068853_100414768 3300005539 Unclassified 1262
85 Ga0070672_101365992 3300005543 Unclassified 633
86 Ga0070672_101676717 3300005543 Bacteria 571
87 Ga0070686_100116828 3300005544 Unclassified 1826
88 Ga0070686_100262629 3300005544 Bacteria 1266
89 Ga0070696_100835764 3300005546 Unclassified 760
90 Ga0070693_100017478 3300005547 Bacteria 3729
91 Ga0070693_100047592 3300005547 Bacteria 2440
92 Ga0070704_100633240 3300005549 Bacteria 943
93 Ga0070704_101591980 3300005549 Bacteria 602
94 Ga0070664_101285232 3300005564 Bacteria 691
95 Ga0070664_101956949 3300005564 Bacteria 556
96 Ga0068857_100048936 3300005577 Bacteria 3751
97 Ga0068857_101613568 3300005577 Unclassified 633
98 Ga0068854_100086792 3300005578 Unclassified 2320
99 Ga0068854_100162205 3300005578 Bacteria 1732
100 Ga0070702_100133982 3300005615 Bacteria 1569
101 Ga0070702_100290748 3300005615 Bacteria 1126
102 Ga0070702_100422459 3300005615 Bacteria 960
103 Ga0068864_101486550 3300005618 Unclassified 680
104 Ga0068864_101867969 3300005618 Unclassified 606
105 Ga0068861_100154869 3300005719 Unclassified 1884
106 Ga0068870_10038845 3300005840 Bacteria 2460
107 Ga0068870_10694585 3300005840 Bacteria 701
108 Ga0068863_101843921 3300005841 Bacteria 615
109 Ga0068860_102783455 3300005843 Bacteria 507
110 Ga0068862_101367173 3300005844 Bacteria 711
111 Ga0070717_10000088 3300006028 Bacteria 72135
112 Ga0070717_10089001 3300006028 Bacteria 2604
113 Ga0070717_10561386 3300006028 Bacteria 1034
114 Ga0070717_11110698 3300006028 Unclassified 720
115 Ga0070717_11851985 3300006028 Unclassified 545
116 Ga0075363_100638150 3300006048 Unclassified 640
117 Ga0070716_100077714 3300006173 Bacteria 1971
118 Ga0070716_100117041 3300006173 Bacteria 1662
119 Ga0070716_100487048 3300006173 Unclassified 907
120 Ga0097621_100223780 3300006237 Unclassified 1640
121 Ga0097621_100267236 3300006237 Unclassified 1502
122 Ga0075370_10110739 3300006353 Bacteria 1595
123 Ga0068871_100199258 3300006358 Bacteria 1728
124 Ga0068871_100491770 3300006358 Bacteria 1105
125 Ga0075428_100446048 3300006844 Bacteria 1386
126 Ga0075431_100001020 3300006847 Bacteria 24950
127 Ga0075431_100020811 3300006847 Bacteria 6704
128 Ga0075431_100155837 3300006847 Bacteria 2350
129 Ga0075433_10234646 3300006852 Bacteria 1628
130 Ga0075434_100167267 3300006871 Bacteria 2219
131 Ga0075434_100190814 3300006871 Bacteria 2069
132 Ga0075434_100259401 3300006871 Unclassified 1757
133 Ga0075434_101557110 3300006871 Bacteria 670
134 Ga0075429_100092801 3300006880 Bacteria 2633
135 Ga0075429_100637720 3300006880 Unclassified 933
136 Ga0068865_100871819 3300006881 Bacteria 781
137 Ga0068865_101205606 3300006881 Bacteria 670
138 Ga0075436_100004976 3300006914 Bacteria 9133
139 Ga0075436_100445152 3300006914 Unclassified 943
140 Ga0075436_100458316 3300006914 Unclassified 929
141 Ga0075435_100000254 3300007076 Bacteria 33129
142 Ga0075435_100065417 3300007076 Bacteria 2956
143 Ga0075435_100132431 3300007076 Unclassified 2086
144 Ga0099794_10299724 3300007265 Bacteria 832
145 Ga0105244_10006419 3300009036 Bacteria 7617
146 Ga0105240_10028432 3300009093 Bacteria 7304
147 Ga0111539_10000007 3300009094 Bacteria 418059
148 Ga0111539_10108403 3300009094 Bacteria 3259
149 Ga0111539_10281653 3300009094 Bacteria 1934
150 Ga0105245_10000084 3300009098 Bacteria 94992
151 Ga0105245_10001640 3300009098 Bacteria 20364
152 Ga0105245_10126738 3300009098 Unclassified 2391
153 Ga0105245_10590889 3300009098 Unclassified 1136
154 Ga0105245_11704490 3300009098 Bacteria 682
155 Ga0105243_10552764 3300009148 Bacteria 1100
156 Ga0105243_10786576 3300009148 Bacteria 936
157 Ga0105241_11047078 3300009174 Bacteria 766
158 Ga0105242_10008606 3300009176 Bacteria 7837
159 Ga0105248_11567035 3300009177 Bacteria 746
160 Ga0105238_10000129 3300009551 Bacteria 83108
161 Ga0105239_10214386 3300010375 Bacteria 2158
162 Ga0105246_12127422 3300011119 Bacteria 544
163 Ga0157369_10030979 3300013105 Bacteria 5894
164 Ga0157374_10000020 3300013296 Bacteria 276902
165 Ga0157378_10332247 3300013297 Unclassified 1480
166 Ga0163162_10031571 3300013306 Bacteria 5255
167 Ga0163162_11075968 3300013306 Unclassified 911
168 Ga0157372_10436042 3300013307 Bacteria 1527
169 Ga0157372_11667682 3300013307 Bacteria 734
170 Ga0157375_10000046 3300013308 Bacteria 150644
171 Ga0157375_10000238 3300013308 Bacteria 51057
172 Ga0157375_10469493 3300013308 Bacteria 1423
173 Ga0163163_10037405 3300014325 Bacteria 4722
174 Ga0157380_10409436 3300014326 Bacteria 1289
175 Ga0157377_10000005 3300014745 Bacteria 426955
176 Ga0157377_10000139 3300014745 Bacteria 46186
177 Ga0157377_10271493 3300014745 Unclassified 1108
178 Ga0157377_11488436 3300014745 Unclassified 538
179 Ga0157376_10000013 3300014969 Bacteria 304287
180 Ga0163161_10133303 3300017792 Bacteria 1876
181 Ga0163161_11353163 3300017792 Unclassified 620
182 Ga0206351_10658470 3300020077 Bacteria 1115
183 Ga0154015_1330756 3300020610 Bacteria 791
184 Ga0213873_10000001 3300021358 Bacteria 1657979
185 Ga0213873_10031490 3300021358 Bacteria 1319
186 Ga0213876_10000002 3300021384 Bacteria 1168769
187 Ga0213876_10000067 3300021384 Bacteria 126770
188 Ga0213876_10011287 3300021384 Bacteria 4771
189 Ga0224712_10028678 3300022467 Bacteria 1992
190 Ga0207655_1073633 3300025728 Unclassified 1259
191 Ga0207692_11035626 3300025898 Unclassified 542
192 Ga0207699_10461989 3300025906 Unclassified 912
193 Ga0207699_11436428 3300025906 Bacteria 510
194 Ga0207699_11446971 3300025906 Unclassified 508
195 Ga0207645_10374838 3300025907 Unclassified 954
196 Ga0207705_10008942 3300025909 Bacteria 7294
197 Ga0207684_10009878 3300025910 Bacteria 8417
198 Ga0207684_10133267 3300025910 Unclassified 2133
199 Ga0207695_10014129 3300025913 Bacteria 9476
200 Ga0207660_10055434 3300025917 Unclassified 2833
201 Ga0207662_10004202 3300025918 Bacteria 7547
202 Ga0207662_10028658 3300025918 Bacteria 3221
203 Ga0207662_10227666 3300025918 Unclassified 1216
204 Ga0207662_11354376 3300025918 Unclassified 505
205 Ga0207646_10008689 3300025922 Bacteria 10139
206 Ga0207646_10097656 3300025922 Bacteria 2632
207 Ga0207646_10369619 3300025922 Bacteria 1296
208 Ga0207646_10530669 3300025922 Unclassified 1059
209 Ga0207646_11344694 3300025922 Bacteria 623
210 Ga0207681_10434282 3300025923 Unclassified 1066
211 Ga0207681_11036124 3300025923 Unclassified 689
212 Ga0207694_10000002 3300025924 Bacteria 1165763
213 Ga0207694_10000003 3300025924 Bacteria 1165533
214 Ga0207650_10000141 3300025925 Bacteria 87777
215 Ga0207650_10026227 3300025925 Bacteria 4155
216 Ga0207650_10216165 3300025925 Bacteria 1541
217 Ga0207659_10000001 3300025926 Bacteria 660958
218 Ga0207659_10369467 3300025926 Unclassified 1194
219 Ga0207687_10000019 3300025927 Bacteria 234280
220 Ga0207687_10000557 3300025927 Bacteria 25108
221 Ga0207687_10423443 3300025927 Unclassified 1099
222 Ga0207644_10412105 3300025931 Unclassified 1106
223 Ga0207690_10127645 3300025932 Unclassified 1857
224 Ga0207686_10012259 3300025934 Bacteria 4710
225 Ga0207709_10114266 3300025935 Bacteria 1811
226 Ga0207670_10576171 3300025936 Bacteria 922
227 Ga0207670_11773099 3300025936 Unclassified 525
228 Ga0207669_10396151 3300025937 Unclassified 1080
229 Ga0207704_10904423 3300025938 Bacteria 742
230 Ga0207665_10021035 3300025939 Bacteria 4288
231 Ga0207665_10202017 3300025939 Unclassified 1449
232 Ga0207665_11260589 3300025939 Unclassified 589
233 Ga0207691_11195372 3300025940 Bacteria 630
234 Ga0207689_10042961 3300025942 Bacteria 3737
235 Ga0207689_10056040 3300025942 Bacteria 3243
236 Ga0207689_10737989 3300025942 Unclassified 831
237 Ga0207661_10000002 3300025944 Bacteria 816104
238 Ga0207661_10547126 3300025944 Bacteria 1060
239 Ga0207651_10470899 3300025960 Unclassified 1081
240 Ga0207651_12127134 3300025960 Unclassified 504
241 Ga0207640_10071599 3300025981 Unclassified 2336
242 Ga0207640_10538329 3300025981 Bacteria 979
243 Ga0207677_10006014 3300026023 Bacteria 6614
244 Ga0207677_10815076 3300026023 Bacteria 836
245 Ga0207677_11271748 3300026023 Unclassified 675
246 Ga0207639_10000005 3300026041 Bacteria 579948
247 Ga0207639_11724302 3300026041 Bacteria 587
248 Ga0207708_10000118 3300026075 Bacteria 60843
249 Ga0207708_11496377 3300026075 Bacteria 593
250 Ga0207708_12047540 3300026075 Unclassified 501
251 Ga0207641_10558853 3300026088 Bacteria 1117
252 Ga0207648_10056632 3300026089 Bacteria 3420
253 Ga0207674_10012809 3300026116 Bacteria 9363
254 Ga0207674_12237507 3300026116 Bacteria 509
255 Ga0207675_100016999 3300026118 Bacteria 6797
256 Ga0207683_10023429 3300026121 Bacteria 5311
257 Ga0207683_10166128 3300026121 Bacteria 1997
258 Ga0207683_11425309 3300026121 Bacteria 640
259 Ga0207698_11182461 3300026142 Unclassified 778
260 Ga0210002_1022596 3300027617 Bacteria 1021
261 Ga0207428_10000008 3300027907 Bacteria 423201
262 Ga0207428_10092517 3300027907 Bacteria 2347
263 Ga0307511_10000120 3300030521 Bacteria 71419
264 Ga0307405_11027696 3300031731 Bacteria 705
265 Ga0307416_100748330 3300032002 Bacteria 1070
266 Ga0307416_101288286 3300032002 Bacteria 837
267 Ga0307416_102046594 3300032002 Unclassified 675
268 Ga0307416_102156524 3300032002 Bacteria 659
269 Ga0307411_11712895 3300032005 Bacteria 582
270 Ga0307415_100296261 3300032126 Unclassified 1338
271 Ga0307415_102404250 3300032126 Bacteria 518
272 Ga0307415_102571853 3300032126 Bacteria 502
273 Ga0373932_0000068 3300035112 Bacteria 25710
274 Ga0316584_0706513 3300036712 Bacteria 691
275 Ga0395900_0822392 3300037418 Unclassified 856
276 Ga0436365_0043513 3300039437 Unclassified 1209
277 Ga0436365_0301508 3300039437 Bacteria 65589
278 Ga0436365_0409696 3300039437 Bacteria 73546
279 Ga0436365_1114194 3300039437 Bacteria 840
280 Ga0436365_1768988 3300039437 Bacteria 8895
281 Ga0436362_0925059 3300039453 Bacteria 12527
282 Ga0436362_0984254 3300039453 Bacteria 405590
283 Ga0439446_0227694 3300042156 Unclassified 637
284 Ga0451577_0391812 3300042876 Bacteria 1261
285 Ga0451577_0536830 3300042876 Bacteria 1062
286 Ga0453683_0048481 3300044673 Archaea 2664
287 Ga0466960_0212532 3300044901 Unclassified 1061
288 Ga0451576_0528217 3300045051 Unclassified 1240
289 Ga0495610_0096080 3300046512 Bacteria 1335
290 Ga0495620_0002798 3300046515 Bacteria 10039
291 Ga0495630_1464837 3300046517 Unclassified 513
292 Ga0495643_0361519 3300046522 Bacteria 648
293 Ga0495598_0056289 3300046537 Bacteria 1200
294 Ga0495598_0145044 3300046537 Unclassified 824
295 Ga0495598_0190964 3300046537 Bacteria 735
296 Ga0495621_0045605 3300046539 Unclassified 1553
297 Ga0495621_0100110 3300046539 Bacteria 1102
298 Ga0495588_0494761 3300046674 Unclassified 641
299 Ga0495679_058700 3300047446 Bacteria 1134
300 Ga0496100_0555236 3300048903 Unclassified 889
301 Ga0496112_0840825 3300048915 Bacteria 842
302 Ga0501072_1201407 3300049588 Bacteria 589
303 Ga0501073_0006649 3300049589 Bacteria 8611
304 Ga0501076_0769265 3300049592 Bacteria 795
305 Ga0501221_158303 3300049704 Unclassified 605
306 Ga0501080_0004669 3300049742 Bacteria 12221
307 nmdc:mga07m45_182231_c1 3300050496 Bacteria 1221
308 nmdc:mga05p37_64058_c1 3300050507 Unclassified 4523
309 nmdc:mga09592_1662315_c1 3300050508 Bacteria 516
310 nmdc:mga09592_243390_c1 3300050508 Bacteria 1559
311 nmdc:mga09592_87865_c1 3300050508 Bacteria 2654
312 nmdc:mga06r32_10912_c1 3300050510 Bacteria 8181
313 nmdc:mga06r32_1587_c1 3300050510 Bacteria 20487
314 nmdc:mga06r32_262857_c1 3300050510 Bacteria 1713
315 nmdc:mga08y16_13_c2 3300050511 Bacteria 418063
316 nmdc:mga08y16_1406901_c1 3300050511 Bacteria 661
317 nmdc:mga08y16_263238_c1 3300050511 Bacteria 1781
318 nmdc:mga08y16_305410_c1 3300050511 Bacteria 1639
319 nmdc:mga08y16_547329_c1 3300050511 Bacteria 1172
320 nmdc:mga0n895_1121070_c1 3300050512 Bacteria 763
321 nmdc:mga0n895_196151_c1 3300050512 Bacteria 2050
322 nmdc:mga0n895_255030_c1 3300050512 Unclassified 1780
323 nmdc:mga0n895_276128_c1 3300050512 Bacteria 1704
324 nmdc:mga0rr50_186_c1 3300050513 Bacteria 33945
325 nmdc:mga0rr50_343169_c1 3300050513 Bacteria 1255
326 nmdc:mga0rr50_4061_c1 3300050513 Bacteria 8207
327 nmdc:mga08x19_569_c1 3300050514 Bacteria 24166
328 nmdc:mga0a205_173310_c2 3300050515 Bacteria 1607
329 Ga0495655_0000020 3300053083 Bacteria 44521
330 Ga0495655_0083922 3300053083 Unclassified 916
331 Ga0500644_0077179 3300053088 Unclassified 1216
332 Ga0587077_262352 3300059493 Bacteria 504

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042876 Ga0451577_0536830 Ga0451577_0536830_426_740 104
2 3300009098 Ga0105245_10590889 Ga0105245_105908892 107
3 iso_pu_bacteria 2773857922 2774851869 107
4 3300005327 Ga0070658_10043385 Ga0070658_100433852 108
5 3300005329 Ga0070683_100000086 Ga0070683_10000008635 108
6 3300005329 Ga0070683_100191061 Ga0070683_1001910613 108
7 3300005331 Ga0070670_100000049 Ga0070670_100000049125 108
8 3300005331 Ga0070670_100027906 Ga0070670_1000279062 108
9 3300005334 Ga0068869_100077814 Ga0068869_1000778142 108
10 3300005337 Ga0070682_100120616 Ga0070682_1001206162 108
11 3300005338 Ga0068868_100011815 Ga0068868_1000118156 108
12 3300005344 Ga0070661_100716390 Ga0070661_1007163902 108
13 3300005535 Ga0070684_100009541 Ga0070684_1000095412 108
14 3300005539 Ga0068853_100414768 Ga0068853_1004147683 108
15 3300005544 Ga0070686_100116828 Ga0070686_1001168282 108
16 3300005564 Ga0070664_101285232 Ga0070664_1012852322 108
17 3300005578 Ga0068854_100086792 Ga0068854_1000867922 108
18 3300005578 Ga0068854_100162205 Ga0068854_1001622052 108
19 3300005618 Ga0068864_101867969 Ga0068864_1018679691 108
20 3300006173 Ga0070716_100117041 Ga0070716_1001170412 108
21 3300006237 Ga0097621_100223780 Ga0097621_1002237802 108
22 3300006358 Ga0068871_100199258 Ga0068871_1001992582 108
23 3300009098 Ga0105245_10000084 Ga0105245_1000008425 108
24 3300009148 Ga0105243_10552764 Ga0105243_105527642 108
25 3300009174 Ga0105241_11047078 Ga0105241_110470782 108
26 3300009177 Ga0105248_11567035 Ga0105248_115670352 108
27 3300009551 Ga0105238_10000129 Ga0105238_1000012916 108
28 3300013105 Ga0157369_10030979 Ga0157369_100309796 108
29 3300013296 Ga0157374_10000020 Ga0157374_1000002086 108
30 3300013307 Ga0157372_11667682 Ga0157372_116676822 108
31 3300013308 Ga0157375_10000046 Ga0157375_1000004618 108
32 3300013308 Ga0157375_10000238 Ga0157375_1000023816 108
33 3300013308 Ga0157375_10469493 Ga0157375_104694932 108
34 3300014325 Ga0163163_10037405 Ga0163163_100374052 108
35 3300014745 Ga0157377_10000005 Ga0157377_1000000572 108
36 3300014969 Ga0157376_10000013 Ga0157376_10000013267 108
37 3300021358 Ga0213873_10031490 Ga0213873_100314902 108
38 3300021384 Ga0213876_10000067 Ga0213876_1000006787 108
39 3300025906 Ga0207699_11436428 Ga0207699_114364281 108
40 3300025909 Ga0207705_10008942 Ga0207705_100089422 108
41 3300025924 Ga0207694_10000002 Ga0207694_10000002911 108
42 3300025924 Ga0207694_10000003 Ga0207694_10000003189 108
43 3300025925 Ga0207650_10000141 Ga0207650_1000014113 108
44 3300025925 Ga0207650_10026227 Ga0207650_100262275 108
45 3300025927 Ga0207687_10000019 Ga0207687_10000019141 108
46 3300025935 Ga0207709_10114266 Ga0207709_101142662 108
47 3300025942 Ga0207689_10056040 Ga0207689_100560403 108
48 3300025944 Ga0207661_10000002 Ga0207661_10000002545 108
49 3300025944 Ga0207661_10547126 Ga0207661_105471261 108
50 3300025981 Ga0207640_10071599 Ga0207640_100715993 108
51 3300025981 Ga0207640_10538329 Ga0207640_105383291 108
52 3300026023 Ga0207677_10006014 Ga0207677_100060146 108
53 3300026041 Ga0207639_11724302 Ga0207639_117243021 108
54 3300030521 Ga0307511_10000120 Ga0307511_1000012044 108
55 3300039437 Ga0436365_0409696 Ga0436365_0409696_17985_18311 108
56 3300039437 Ga0436365_1114194 Ga0436365_1114194_492_818 108
57 3300039453 Ga0436362_0925059 Ga0436362_0925059_1204_1530 108
58 3300046674 Ga0495588_0494761 Ga0495588_0494761_255_581 108
59 3300047446 Ga0495679_058700 Ga0495679_058700_393_719 108
60 3300048915 Ga0496112_0840825 Ga0496112_0840825_141_467 108
61 3300026121 Ga0207683_11425309 Ga0207683_114253092 109
62 3300005293 Ga0065715_10097911 Ga0065715_100979113 111
63 3300005295 Ga0065707_10090147 Ga0065707_100901475 111
64 3300005295 Ga0065707_10154203 Ga0065707_101542033 111
65 3300005328 Ga0070676_10231762 Ga0070676_102317622 111
66 3300005328 Ga0070676_10967953 Ga0070676_109679531 111
67 3300005329 Ga0070683_100233367 Ga0070683_1002333673 111
68 3300005330 Ga0070690_100436837 Ga0070690_1004368372 111
69 3300005331 Ga0070670_100180643 Ga0070670_1001806431 111
70 3300005333 Ga0070677_10653026 Ga0070677_106530262 111
71 3300005334 Ga0068869_100048008 Ga0068869_1000480085 111
72 3300005334 Ga0068869_100261599 Ga0068869_1002615992 111
73 3300005334 Ga0068869_100275152 Ga0068869_1002751521 111
74 3300005336 Ga0070680_100020879 Ga0070680_1000208793 111
75 3300005337 Ga0070682_101312265 Ga0070682_1013122652 111
76 3300005339 Ga0070660_100367583 Ga0070660_1003675832 111
77 3300005340 Ga0070689_100096294 Ga0070689_1000962941 111
78 3300005340 Ga0070689_100146601 Ga0070689_1001466012 111
79 3300005340 Ga0070689_100402777 Ga0070689_1004027771 111
80 3300005340 Ga0070689_100532437 Ga0070689_1005324372 111
81 3300005340 Ga0070689_101554754 Ga0070689_1015547542 111
82 3300005340 Ga0070689_101690351 Ga0070689_1016903512 111
83 3300005343 Ga0070687_100002706 Ga0070687_1000027069 111
84 3300005343 Ga0070687_100066823 Ga0070687_1000668231 111
85 3300005343 Ga0070687_100282714 Ga0070687_1002827142 111
86 3300005343 Ga0070687_100938576 Ga0070687_1009385762 111
87 3300005343 Ga0070687_101183283 Ga0070687_1011832831 111
88 3300005344 Ga0070661_100600965 Ga0070661_1006009652 111
89 3300005353 Ga0070669_101935749 Ga0070669_1019357492 111
90 3300005354 Ga0070675_100000010 Ga0070675_100000010108 111
91 3300005354 Ga0070675_100452104 Ga0070675_1004521042 111
92 3300005355 Ga0070671_100441229 Ga0070671_1004412292 111
93 3300005355 Ga0070671_100509023 Ga0070671_1005090232 111
94 3300005356 Ga0070674_100140463 Ga0070674_1001404632 111
95 3300005364 Ga0070673_100849030 Ga0070673_1008490302 111
96 3300005366 Ga0070659_100290428 Ga0070659_1002904281 111
97 3300005434 Ga0070709_10121662 Ga0070709_101216621 111
98 3300005434 Ga0070709_10546274 Ga0070709_105462741 111
99 3300005434 Ga0070709_11236665 Ga0070709_112366652 111
100 3300005435 Ga0070714_100758574 Ga0070714_1007585742 111
101 3300005436 Ga0070713_101099994 Ga0070713_1010999941 111
102 3300005437 Ga0070710_10828143 Ga0070710_108281432 111
103 3300005438 Ga0070701_10299335 Ga0070701_102993351 111
104 3300005440 Ga0070705_100027490 Ga0070705_1000274905 111
105 3300005441 Ga0070700_100000001 Ga0070700_100000001166 111
106 3300005445 Ga0070708_100015791 Ga0070708_1000157912 111
107 3300005445 Ga0070708_100816371 Ga0070708_1008163711 111
108 3300005455 Ga0070663_101053899 Ga0070663_1010538992 111
109 3300005456 Ga0070678_100161070 Ga0070678_1001610702 111
110 3300005456 Ga0070678_100170319 Ga0070678_1001703192 111
111 3300005459 Ga0068867_100080804 Ga0068867_1000808043 111
112 3300005466 Ga0070685_10055325 Ga0070685_100553252 111
113 3300005467 Ga0070706_100003611 Ga0070706_10000361113 111
114 3300005467 Ga0070706_100012155 Ga0070706_1000121557 111
115 3300005467 Ga0070706_100599677 Ga0070706_1005996772 111
116 3300005467 Ga0070706_100649968 Ga0070706_1006499682 111
117 3300005468 Ga0070707_100007503 Ga0070707_1000075038 111
118 3300005468 Ga0070707_100117534 Ga0070707_1001175342 111
119 3300005468 Ga0070707_100122897 Ga0070707_1001228972 111
120 3300005468 Ga0070707_100236745 Ga0070707_1002367453 111
121 3300005471 Ga0070698_100024209 Ga0070698_1000242095 111
122 3300005471 Ga0070698_100057324 Ga0070698_1000573245 111
123 3300005471 Ga0070698_100067221 Ga0070698_1000672213 111
124 3300005471 Ga0070698_100178825 Ga0070698_1001788253 111
125 3300005471 Ga0070698_100341392 Ga0070698_1003413922 111
126 3300005518 Ga0070699_100014037 Ga0070699_1000140378 111
127 3300005518 Ga0070699_100040550 Ga0070699_1000405503 111
128 3300005518 Ga0070699_100074212 Ga0070699_1000742123 111
129 3300005518 Ga0070699_100195070 Ga0070699_1001950703 111
130 3300005535 Ga0070684_100031335 Ga0070684_1000313354 111
131 3300005536 Ga0070697_100109212 Ga0070697_1001092122 111
132 3300005536 Ga0070697_100146466 Ga0070697_1001464662 111
133 3300005536 Ga0070697_101473592 Ga0070697_1014735922 111
134 3300005539 Ga0068853_100234882 Ga0068853_1002348821 111
135 3300005543 Ga0070672_101365992 Ga0070672_1013659922 111
136 3300005543 Ga0070672_101676717 Ga0070672_1016767171 111
137 3300005544 Ga0070686_100262629 Ga0070686_1002626291 111
138 3300005546 Ga0070696_100835764 Ga0070696_1008357642 111
139 3300005547 Ga0070693_100017478 Ga0070693_1000174784 111
140 3300005547 Ga0070693_100047592 Ga0070693_1000475921 111
141 3300005549 Ga0070704_100633240 Ga0070704_1006332402 111
142 3300005549 Ga0070704_101591980 Ga0070704_1015919801 111
143 3300005564 Ga0070664_101956949 Ga0070664_1019569491 111
144 3300005577 Ga0068857_100048936 Ga0068857_1000489364 111
145 3300005577 Ga0068857_101613568 Ga0068857_1016135681 111
146 3300005615 Ga0070702_100133982 Ga0070702_1001339822 111
147 3300005615 Ga0070702_100290748 Ga0070702_1002907482 111
148 3300005615 Ga0070702_100422459 Ga0070702_1004224591 111
149 3300005618 Ga0068864_101486550 Ga0068864_1014865502 111
150 3300005719 Ga0068861_100154869 Ga0068861_1001548692 111
151 3300005840 Ga0068870_10038845 Ga0068870_100388452 111
152 3300005840 Ga0068870_10694585 Ga0068870_106945852 111
153 3300005841 Ga0068863_101843921 Ga0068863_1018439211 111
154 3300005843 Ga0068860_102783455 Ga0068860_1027834551 111
155 3300005844 Ga0068862_101367173 Ga0068862_1013671732 111
156 3300006028 Ga0070717_10000088 Ga0070717_1000008819 111
157 3300006028 Ga0070717_10089001 Ga0070717_100890013 111
158 3300006028 Ga0070717_10561386 Ga0070717_105613862 111
159 3300006028 Ga0070717_11110698 Ga0070717_111106981 111
160 3300006028 Ga0070717_11851985 Ga0070717_118519851 111
161 3300006048 Ga0075363_100638150 Ga0075363_1006381502 111
162 3300006173 Ga0070716_100077714 Ga0070716_1000777141 111
163 3300006173 Ga0070716_100487048 Ga0070716_1004870482 111
164 3300006237 Ga0097621_100267236 Ga0097621_1002672363 111
165 3300006353 Ga0075370_10110739 Ga0075370_101107393 111
166 3300006358 Ga0068871_100491770 Ga0068871_1004917702 111
167 3300006844 Ga0075428_100446048 Ga0075428_1004460483 111
168 3300006847 Ga0075431_100001020 Ga0075431_10000102011 111
169 3300006847 Ga0075431_100020811 Ga0075431_1000208114 111
170 3300006847 Ga0075431_100155837 Ga0075431_1001558373 111
171 3300006852 Ga0075433_10234646 Ga0075433_102346462 111
172 3300006871 Ga0075434_100167267 Ga0075434_1001672673 111
173 3300006871 Ga0075434_100190814 Ga0075434_1001908143 111
174 3300006871 Ga0075434_100259401 Ga0075434_1002594011 111
175 3300006871 Ga0075434_101557110 Ga0075434_1015571101 111
176 3300006880 Ga0075429_100092801 Ga0075429_1000928013 111
177 3300006880 Ga0075429_100637720 Ga0075429_1006377202 111
178 3300006881 Ga0068865_100871819 Ga0068865_1008718191 111
179 3300006881 Ga0068865_101205606 Ga0068865_1012056061 111
180 3300006914 Ga0075436_100004976 Ga0075436_1000049764 111
181 3300006914 Ga0075436_100445152 Ga0075436_1004451522 111
182 3300006914 Ga0075436_100458316 Ga0075436_1004583162 111
183 3300007076 Ga0075435_100000254 Ga0075435_10000025431 111
184 3300007076 Ga0075435_100065417 Ga0075435_1000654174 111
185 3300007076 Ga0075435_100132431 Ga0075435_1001324313 111
186 3300007265 Ga0099794_10299724 Ga0099794_102997241 111
187 3300009036 Ga0105244_10006419 Ga0105244_100064198 111
188 3300009093 Ga0105240_10028432 Ga0105240_100284324 111
189 3300009094 Ga0111539_10000007 Ga0111539_10000007331 111
190 3300009094 Ga0111539_10108403 Ga0111539_101084035 111
191 3300009094 Ga0111539_10281653 Ga0111539_102816533 111
192 3300009098 Ga0105245_10001640 Ga0105245_1000164012 111
193 3300009098 Ga0105245_10126738 Ga0105245_101267383 111
194 3300009098 Ga0105245_11704490 Ga0105245_117044901 111
195 3300009148 Ga0105243_10786576 Ga0105243_107865762 111
196 3300009176 Ga0105242_10008606 Ga0105242_100086069 111
197 3300010375 Ga0105239_10214386 Ga0105239_102143864 111
198 3300011119 Ga0105246_12127422 Ga0105246_121274222 111
199 3300013297 Ga0157378_10332247 Ga0157378_103322473 111
200 3300013306 Ga0163162_10031571 Ga0163162_100315715 111
201 3300013306 Ga0163162_11075968 Ga0163162_110759681 111
202 3300013307 Ga0157372_10436042 Ga0157372_104360423 111
203 3300014326 Ga0157380_10409436 Ga0157380_104094362 111
204 3300014745 Ga0157377_10000139 Ga0157377_1000013916 111
205 3300014745 Ga0157377_10271493 Ga0157377_102714931 111
206 3300014745 Ga0157377_11488436 Ga0157377_114884361 111
207 3300017792 Ga0163161_10133303 Ga0163161_101333032 111
208 3300017792 Ga0163161_11353163 Ga0163161_113531632 111
209 3300020077 Ga0206351_10658470 Ga0206351_106584702 111
210 3300020610 Ga0154015_1330756 Ga0154015_13307562 111
211 3300021358 Ga0213873_10000001 Ga0213873_10000001904 111
212 3300021384 Ga0213876_10000002 Ga0213876_10000002638 111
213 3300021384 Ga0213876_10011287 Ga0213876_100112873 111
214 3300022467 Ga0224712_10028678 Ga0224712_100286782 111
215 3300025728 Ga0207655_1073633 Ga0207655_10736332 111
216 3300025898 Ga0207692_11035626 Ga0207692_110356262 111
217 3300025906 Ga0207699_10461989 Ga0207699_104619892 111
218 3300025906 Ga0207699_11446971 Ga0207699_114469711 111
219 3300025907 Ga0207645_10374838 Ga0207645_103748382 111
220 3300025910 Ga0207684_10009878 Ga0207684_100098787 111
221 3300025910 Ga0207684_10133267 Ga0207684_101332672 111
222 3300025913 Ga0207695_10014129 Ga0207695_100141294 111
223 3300025917 Ga0207660_10055434 Ga0207660_100554343 111
224 3300025918 Ga0207662_10004202 Ga0207662_1000420210 111
225 3300025918 Ga0207662_10028658 Ga0207662_100286583 111
226 3300025918 Ga0207662_10227666 Ga0207662_102276662 111
227 3300025918 Ga0207662_11354376 Ga0207662_113543761 111
228 3300025922 Ga0207646_10008689 Ga0207646_100086892 111
229 3300025922 Ga0207646_10097656 Ga0207646_100976564 111
230 3300025922 Ga0207646_10369619 Ga0207646_103696192 111
231 3300025922 Ga0207646_10530669 Ga0207646_105306692 111
232 3300025922 Ga0207646_11344694 Ga0207646_113446942 111
233 3300025923 Ga0207681_10434282 Ga0207681_104342822 111
234 3300025923 Ga0207681_11036124 Ga0207681_110361242 111
235 3300025925 Ga0207650_10216165 Ga0207650_102161652 111
236 3300025926 Ga0207659_10000001 Ga0207659_10000001294 111
237 3300025926 Ga0207659_10369467 Ga0207659_103694672 111
238 3300025927 Ga0207687_10000557 Ga0207687_100005573 111
239 3300025927 Ga0207687_10423443 Ga0207687_104234432 111
240 3300025931 Ga0207644_10412105 Ga0207644_104121052 111
241 3300025932 Ga0207690_10127645 Ga0207690_101276451 111
242 3300025934 Ga0207686_10012259 Ga0207686_100122597 111
243 3300025936 Ga0207670_10576171 Ga0207670_105761711 111
244 3300025936 Ga0207670_11773099 Ga0207670_117730991 111
245 3300025937 Ga0207669_10396151 Ga0207669_103961512 111
246 3300025938 Ga0207704_10904423 Ga0207704_109044232 111
247 3300025939 Ga0207665_10021035 Ga0207665_100210355 111
248 3300025939 Ga0207665_10202017 Ga0207665_102020173 111
249 3300025939 Ga0207665_11260589 Ga0207665_112605891 111
250 3300025940 Ga0207691_11195372 Ga0207691_111953721 111
251 3300025942 Ga0207689_10042961 Ga0207689_100429612 111
252 3300025942 Ga0207689_10737989 Ga0207689_107379892 111
253 3300025960 Ga0207651_10470899 Ga0207651_104708991 111
254 3300025960 Ga0207651_12127134 Ga0207651_121271341 111
255 3300026023 Ga0207677_10815076 Ga0207677_108150762 111
256 3300026023 Ga0207677_11271748 Ga0207677_112717481 111
257 3300026041 Ga0207639_10000005 Ga0207639_10000005552 111
258 3300026075 Ga0207708_10000118 Ga0207708_100001187 111
259 3300026075 Ga0207708_11496377 Ga0207708_114963771 111
260 3300026075 Ga0207708_12047540 Ga0207708_120475401 111
261 3300026088 Ga0207641_10558853 Ga0207641_105588532 111
262 3300026089 Ga0207648_10056632 Ga0207648_100566323 111
263 3300026116 Ga0207674_10012809 Ga0207674_100128095 111
264 3300026116 Ga0207674_12237507 Ga0207674_122375071 111
265 3300026118 Ga0207675_100016999 Ga0207675_1000169998 111
266 3300026121 Ga0207683_10023429 Ga0207683_100234291 111
267 3300026121 Ga0207683_10166128 Ga0207683_101661283 111
268 3300026142 Ga0207698_11182461 Ga0207698_111824611 111
269 3300027617 Ga0210002_1022596 Ga0210002_10225963 111
270 3300027907 Ga0207428_10000008 Ga0207428_10000008333 111
271 3300027907 Ga0207428_10092517 Ga0207428_100925172 111
272 3300031731 Ga0307405_11027696 Ga0307405_110276961 111
273 3300032002 Ga0307416_100748330 Ga0307416_1007483302 111
274 3300032002 Ga0307416_101288286 Ga0307416_1012882862 111
275 3300032002 Ga0307416_102046594 Ga0307416_1020465942 111
276 3300032002 Ga0307416_102156524 Ga0307416_1021565241 111
277 3300032005 Ga0307411_11712895 Ga0307411_117128951 111
278 3300032126 Ga0307415_100296261 Ga0307415_1002962612 111
279 3300032126 Ga0307415_102404250 Ga0307415_1024042501 111
280 3300032126 Ga0307415_102571853 Ga0307415_1025718531 111
281 3300035112 Ga0373932_0000068 Ga0373932_0000068_319_654 111
282 3300036712 Ga0316584_0706513 Ga0316584_0706513_100_447 111
283 3300037418 Ga0395900_0822392 Ga0395900_0822392_75_410 111
284 3300039437 Ga0436365_0043513 Ga0436365_0043513_849_1184 111
285 3300039437 Ga0436365_0301508 Ga0436365_0301508_26773_27108 111
286 3300039437 Ga0436365_1768988 Ga0436365_1768988_3597_3932 111
287 3300039453 Ga0436362_0984254 Ga0436362_0984254_30904_31239 111
288 3300042156 Ga0439446_0227694 Ga0439446_0227694_285_620 111
289 3300042876 Ga0451577_0391812 Ga0451577_0391812_736_1071 111
290 3300044673 Ga0453683_0048481 Ga0453683_0048481_1976_2335 111
291 3300044901 Ga0466960_0212532 Ga0466960_0212532_354_692 111
292 3300045051 Ga0451576_0528217 Ga0451576_0528217_153_488 111
293 3300046512 Ga0495610_0096080 Ga0495610_0096080_640_978 111
294 3300046515 Ga0495620_0002798 Ga0495620_0002798_5415_5750 111
295 3300046517 Ga0495630_1464837 Ga0495630_1464837_119_457 111
296 3300046522 Ga0495643_0361519 Ga0495643_0361519_109_447 111
297 3300046537 Ga0495598_0056289 Ga0495598_0056289_37_372 111
298 3300046537 Ga0495598_0145044 Ga0495598_0145044_405_740 111
299 3300046537 Ga0495598_0190964 Ga0495598_0190964_226_561 111
300 3300046539 Ga0495621_0045605 Ga0495621_0045605_679_1014 111
301 3300046539 Ga0495621_0100110 Ga0495621_0100110_242_577 111
302 3300048903 Ga0496100_0555236 Ga0496100_0555236_541_879 111
303 3300049588 Ga0501072_1201407 Ga0501072_1201407_230_565 111
304 3300049589 Ga0501073_0006649 Ga0501073_0006649_5615_5950 111
305 3300049592 Ga0501076_0769265 Ga0501076_0769265_333_674 111
306 3300049704 Ga0501221_158303 Ga0501221_158303_192_527 111
307 3300049742 Ga0501080_0004669 Ga0501080_0004669_992_1327 111
308 3300050496 nmdc:mga07m45_182231_c1 nmdc:mga07m45_182231_c1_823_1161 111
309 3300050507 nmdc:mga05p37_64058_c1 nmdc:mga05p37_64058_c1_2923_3258 111
310 3300050508 nmdc:mga09592_1662315_c1 nmdc:mga09592_1662315_c1_108_443 111
311 3300050508 nmdc:mga09592_243390_c1 nmdc:mga09592_243390_c1_653_994 111
312 3300050508 nmdc:mga09592_87865_c1 nmdc:mga09592_87865_c1_1395_1730 111
313 3300050510 nmdc:mga06r32_10912_c1 nmdc:mga06r32_10912_c1_509_844 111
314 3300050510 nmdc:mga06r32_1587_c1 nmdc:mga06r32_1587_c1_12421_12762 111
315 3300050510 nmdc:mga06r32_262857_c1 nmdc:mga06r32_262857_c1_290_625 111
316 3300050511 nmdc:mga08y16_13_c2 nmdc:mga08y16_13_c2_355137_355472 111
317 3300050511 nmdc:mga08y16_1406901_c1 nmdc:mga08y16_1406901_c1_18_356 111
318 3300050511 nmdc:mga08y16_263238_c1 nmdc:mga08y16_263238_c1_567_905 111
319 3300050511 nmdc:mga08y16_305410_c1 nmdc:mga08y16_305410_c1_683_1018 111
320 3300050511 nmdc:mga08y16_547329_c1 nmdc:mga08y16_547329_c1_270_611 111
321 3300050512 nmdc:mga0n895_1121070_c1 nmdc:mga0n895_1121070_c1_247_585 111
322 3300050512 nmdc:mga0n895_196151_c1 nmdc:mga0n895_196151_c1_453_788 111
323 3300050512 nmdc:mga0n895_255030_c1 nmdc:mga0n895_255030_c1_1381_1716 111
324 3300050512 nmdc:mga0n895_276128_c1 nmdc:mga0n895_276128_c1_413_748 111
325 3300050513 nmdc:mga0rr50_186_c1 nmdc:mga0rr50_186_c1_2781_3116 111
326 3300050513 nmdc:mga0rr50_343169_c1 nmdc:mga0rr50_343169_c1_367_705 111
327 3300050513 nmdc:mga0rr50_4061_c1 nmdc:mga0rr50_4061_c1_1897_2232 111
328 3300050514 nmdc:mga08x19_569_c1 nmdc:mga08x19_569_c1_1746_2081 111
329 3300050515 nmdc:mga0a205_173310_c2 nmdc:mga0a205_173310_c2_549_884 111
330 3300053083 Ga0495655_0000020 Ga0495655_0000020_33997_34332 111
331 3300053083 Ga0495655_0083922 Ga0495655_0083922_240_575 111
332 3300053088 Ga0500644_0077179 Ga0500644_0077179_818_1156 111
333 3300059493 Ga0587077_262352 Ga0587077_262352_107_442 111

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

2

107

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f43-assembly1.cif.gz_A-2 crystal structure of a putative anti-sigma factor antagonist (tm1081) from thermotoga maritima at 1.59 a resolution 0.9112 3 110
1vc1-assembly1.cif.gz_B crystal structure of the tm1442 protein from thermotoga maritima, a homolog of the bacillus subtilis general stress response anti-anti-sigma factor rsbv 0.9109 2 106
4hyl-assembly1.cif.gz_A the crystal structure of an anti-sigma-factor antagonist from haliangium ochraceum dsm 14365 0.9054 2 109
6m36-assembly1.cif.gz_H the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.9028 2 100
6m36-assembly1.cif.gz_F the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.895 2 99
ID Description Score Start End Superfamily
af_G5EDS5_481_631_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8982 10 94 3.30.750.24
3f43A01 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8967 6 109 3.30.750.24
af_Q10QI4_508_648_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8887 6 110 3.30.750.24
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8882 4 83 3.30.750.24
4hylA00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8882 2 105 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A2H0VD70-F1-model_v4 Anti-sigma factor antagonist 0.9961 2 111 GO:0043856
AF-A0A7C2Q4R7-F1-model_v4 Anti-sigma factor antagonist 0.9959 2 111 GO:0043856
AF-A0A7Y4TLF9-F1-model_v4 Anti-sigma factor antagonist 0.9917 2 111 GO:0043856
AF-F8B0S2-F1-model_v4 Anti-sigma-factor antagonist 0.9916 2 111 GO:0004674
AF-A0A2D6R3H5-F1-model_v4 Anti-sigma factor antagonist 0.9909 1 111 GO:0043856

Feature Viewer

pLDDT pTM Quality
92.07 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map