F411337

General Info

Members Datasets Scaffolds Average Seq Length
333 178 666 148

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_10015922|Ga0105241_100159225
Length 177
Sequence MPSDLPDLPDPLPVMGRRNPSSSRFFRGLRMSSTWRAGLVAILLSLAFAAPGRAQSFGFPWWRDAQFQKDLSLSPEQSARIDSVFQSSVTLLRQKKAELDQQEAELSRLIAANAEEAVVVRQVDKVESIRATLNKSRTLMLLHMRQVLSPDQRVRLNKLHEQWEKDHQRPDNKQGRK

Samples

Sample ID Description Type Environment
1 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
135 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
138 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
144 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
149 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
150 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
153 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
176 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
177 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
178 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.3
Nodule 0
Rhizoplane 2.7
Rhizosphere 97
Stem 0
Stem Tuber 0
Unclassified 30.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105241_10015922 3300009174 Bacteria 5509
2 Ga0065712_10095553 3300005290 Bacteria 2197
3 Ga0065712_10392710 3300005290 Bacteria 740
4 Ga0065715_10226103 3300005293 Unclassified 1252
5 Ga0065715_10464891 3300005293 Unclassified 812
6 Ga0065715_10819530 3300005293 Bacteria 603
7 Ga0065707_10250754 3300005295 Archaea 1126
8 Ga0070676_10014881 3300005328 Bacteria 4281
9 Ga0070676_10328837 3300005328 Bacteria 1045
10 Ga0070690_100008840 3300005330 Bacteria 5817
11 Ga0070670_100819861 3300005331 Bacteria 841
12 Ga0070677_10088570 3300005333 Bacteria 1341
13 Ga0068869_100077509 3300005334 Bacteria 2473
14 Ga0070666_10139722 3300005335 Bacteria 1687
15 Ga0070666_10323204 3300005335 Bacteria 1101
16 Ga0070666_10485006 3300005335 Bacteria 895
17 Ga0070682_101582204 3300005337 Unclassified 566
18 Ga0070691_10001089 3300005341 Bacteria 11267
19 Ga0070687_100006326 3300005343 Bacteria 4848
20 Ga0070687_100041495 3300005343 Bacteria 2326
21 Ga0070661_100345230 3300005344 Bacteria 1167
22 Ga0070668_100051972 3300005347 Unclassified 3158
23 Ga0070669_100329254 3300005353 Bacteria 1235
24 Ga0070669_100465619 3300005353 Bacteria 1044
25 Ga0070675_100008614 3300005354 Bacteria 7922
26 Ga0070675_100029553 3300005354 Unclassified 4422
27 Ga0070671_100225750 3300005355 Bacteria 1589
28 Ga0070671_100853619 3300005355 Bacteria 794
29 Ga0070674_101485370 3300005356 Bacteria 609
30 Ga0070673_100012586 3300005364 Bacteria 5813
31 Ga0070673_100700817 3300005364 Bacteria 930
32 Ga0070688_100012812 3300005365 Bacteria 4709
33 Ga0070688_100709480 3300005365 Bacteria 780
34 Ga0070659_100731877 3300005366 Bacteria 857
35 Ga0070701_10001545 3300005438 Bacteria 8545
36 Ga0070701_10756907 3300005438 Unclassified 659
37 Ga0070705_100037083 3300005440 Bacteria 2747
38 Ga0070705_100141419 3300005440 Unclassified 1584
39 Ga0070700_100005095 3300005441 Bacteria 6934
40 Ga0070700_100073855 3300005441 Unclassified 2184
41 Ga0070694_100086851 3300005444 Bacteria 2186
42 Ga0070662_100227124 3300005457 Bacteria 1492
43 Ga0070662_100447162 3300005457 Bacteria 1072
44 Ga0068867_100163459 3300005459 Unclassified 1757
45 Ga0070685_10202133 3300005466 Bacteria 1292
46 Ga0070707_100019582 3300005468 Bacteria 6378
47 Ga0070707_100054438 3300005468 Bacteria 3836
48 Ga0070698_100073588 3300005471 Bacteria 3423
49 Ga0070698_100236660 3300005471 Unclassified 1759
50 Ga0070698_101207462 3300005471 Bacteria 706
51 Ga0070698_101354919 3300005471 Bacteria 662
52 Ga0070698_101862879 3300005471 Bacteria 554
53 Ga0070699_100008811 3300005518 Bacteria 8743
54 Ga0070699_100210182 3300005518 Bacteria 1732
55 Ga0070699_100427097 3300005518 Unclassified 1200
56 Ga0070684_100574761 3300005535 Bacteria 1047
57 Ga0070697_100021848 3300005536 Bacteria 5073
58 Ga0070697_100069838 3300005536 Unclassified 2878
59 Ga0070697_100802777 3300005536 Bacteria 833
60 Ga0070697_100870421 3300005536 Unclassified 799
61 Ga0068853_100530312 3300005539 Unclassified 1114
62 Ga0070672_100206271 3300005543 Unclassified 1645
63 Ga0070686_100261010 3300005544 Unclassified 1270
64 Ga0070695_100004707 3300005545 Bacteria 8028
65 Ga0070695_100015874 3300005545 Unclassified 4551
66 Ga0070695_100231882 3300005545 Unclassified 1335
67 Ga0070695_100485254 3300005545 Bacteria 953
68 Ga0070696_100107518 3300005546 Unclassified 2006
69 Ga0070696_100242567 3300005546 Bacteria 1360
70 Ga0070696_100713930 3300005546 Bacteria 818
71 Ga0070665_100146154 3300005548 Unclassified 2367
72 Ga0070704_100029638 3300005549 Unclassified 3657
73 Ga0070704_100329136 3300005549 Unclassified 1283
74 Ga0070704_100817471 3300005549 Bacteria 834
75 Ga0068855_100619875 3300005563 Unclassified 1165
76 Ga0068857_100632838 3300005577 Bacteria 1013
77 Ga0068854_100494948 3300005578 Unclassified 1028
78 Ga0068854_100592321 3300005578 Unclassified 945
79 Ga0070702_100016470 3300005615 Unclassified 3793
80 Ga0070702_100531616 3300005615 Unclassified 869
81 Ga0068859_100328298 3300005617 Bacteria 1624
82 Ga0068864_100004451 3300005618 Bacteria 11516
83 Ga0068861_100003753 3300005719 Bacteria 10130
84 Ga0068861_100170458 3300005719 Bacteria 1803
85 Ga0068861_100305328 3300005719 Bacteria 1380
86 Ga0068861_100617430 3300005719 Bacteria 997
87 Ga0068870_10853362 3300005840 Bacteria 640
88 Ga0068863_101110003 3300005841 Bacteria 796
89 Ga0068858_100004654 3300005842 Bacteria 13446
90 Ga0068858_100235913 3300005842 Unclassified 1735
91 Ga0068858_100957016 3300005842 Unclassified 838
92 Ga0068858_102102825 3300005842 Unclassified 558
93 Ga0068860_100166185 3300005843 Bacteria 2130
94 Ga0068860_100402257 3300005843 Unclassified 1355
95 Ga0068860_100599470 3300005843 Unclassified 1107
96 Ga0068860_101038694 3300005843 Unclassified 838
97 Ga0068862_100176279 3300005844 Bacteria 1916
98 Ga0068862_100329858 3300005844 Unclassified 1411
99 Ga0068862_100590717 3300005844 Bacteria 1065
100 Ga0068862_101006634 3300005844 Bacteria 824
101 Ga0068862_102148559 3300005844 Unclassified 569
102 Ga0075432_10009424 3300006058 Bacteria 3324
103 Ga0070716_100152810 3300006173 Bacteria 1487
104 Ga0097621_100002470 3300006237 Bacteria 12658
105 Ga0097621_100421035 3300006237 Bacteria 1199
106 Ga0068871_100002676 3300006358 Bacteria 12160
107 Ga0075428_101419601 3300006844 Unclassified 728
108 Ga0075431_100210503 3300006847 Bacteria 1986
109 Ga0075433_10087606 3300006852 Bacteria 2750
110 Ga0075433_10213299 3300006852 Bacteria 1715
111 Ga0075433_10386133 3300006852 Bacteria 1236
112 Ga0075433_10510990 3300006852 Bacteria 1057
113 Ga0075433_11332227 3300006852 Archaea 622
114 Ga0075434_100069476 3300006871 Bacteria 3511
115 Ga0075434_100402209 3300006871 Unclassified 1390
116 Ga0075434_100425040 3300006871 Unclassified 1350
117 Ga0075434_100712271 3300006871 Unclassified 1021
118 Ga0075434_100717840 3300006871 Unclassified 1017
119 Ga0068865_100002143 3300006881 Bacteria 11657
120 Ga0068865_100360535 3300006881 Bacteria 1180
121 Ga0068865_100903620 3300006881 Unclassified 768
122 Ga0068865_101015480 3300006881 Bacteria 727
123 Ga0075436_100003926 3300006914 Bacteria 10191
124 Ga0075436_100035840 3300006914 Bacteria 3422
125 Ga0097620_100328305 3300006931 Bacteria 1624
126 Ga0075435_100000440 3300007076 Bacteria 25381
127 Ga0075435_100001007 3300007076 Bacteria 17864
128 Ga0075435_100002546 3300007076 Bacteria 12138
129 Ga0075435_100118817 3300007076 Unclassified 2204
130 Ga0075435_100397437 3300007076 Unclassified 1185
131 Ga0105251_10155201 3300009011 Bacteria 1033
132 Ga0105240_10494686 3300009093 Unclassified 1361
133 Ga0111539_10015564 3300009094 Bacteria 9455
134 Ga0111539_10076375 3300009094 Bacteria 3944
135 Ga0105245_13008520 3300009098 Bacteria 522
136 Ga0105247_10024778 3300009101 Bacteria 3616
137 Ga0114129_10022148 3300009147 Bacteria 9019
138 Ga0114129_10023304 3300009147 Bacteria 8782
139 Ga0114129_10038884 3300009147 Bacteria 6706
140 Ga0114129_10638179 3300009147 Unclassified 1376
141 Ga0114129_11002225 3300009147 Unclassified 1052
142 Ga0114129_11380431 3300009147 Bacteria 870
143 Ga0105243_10252119 3300009148 Bacteria 1576
144 Ga0105243_11608856 3300009148 Bacteria 676
145 Ga0105241_10918305 3300009174 Bacteria 814
146 Ga0105242_10009046 3300009176 Bacteria 7652
147 Ga0105242_10629628 3300009176 Bacteria 1040
148 Ga0105242_12451097 3300009176 Unclassified 569
149 Ga0105248_10007961 3300009177 Bacteria 11652
150 Ga0105248_10107631 3300009177 Bacteria 3144
151 Ga0105248_10316718 3300009177 Unclassified 1757
152 Ga0105248_12436576 3300009177 Archaea 596
153 Ga0105238_11827430 3300009551 Bacteria 640
154 Ga0105249_10913810 3300009553 Bacteria 945
155 Ga0105246_10305442 3300011119 Bacteria 1286
156 Ga0105246_12499069 3300011119 Unclassified 508
157 Ga0157374_11456657 3300013296 Bacteria 708
158 Ga0157378_11307968 3300013297 Bacteria 766
159 Ga0157378_11706329 3300013297 Unclassified 677
160 Ga0163162_10927844 3300013306 Bacteria 983
161 Ga0163162_12628045 3300013306 Unclassified 579
162 Ga0163162_12783875 3300013306 Bacteria 563
163 Ga0157375_10265601 3300013308 Bacteria 1878
164 Ga0157375_10914456 3300013308 Unclassified 1021
165 Ga0163163_10016871 3300014325 Bacteria 6797
166 Ga0157380_10961572 3300014326 Unclassified 885
167 Ga0157380_10989239 3300014326 Unclassified 874
168 Ga0157380_11010901 3300014326 Bacteria 865
169 Ga0157377_10020646 3300014745 Bacteria 3454
170 Ga0157377_10112329 3300014745 Bacteria 1639
171 Ga0157379_10080212 3300014968 Unclassified 2923
172 Ga0157379_10380602 3300014968 Bacteria 1295
173 Ga0157379_11061102 3300014968 Unclassified 775
174 Ga0157379_12334345 3300014968 Unclassified 533
175 Ga0157376_10058202 3300014969 Bacteria 3236
176 Ga0182007_10073725 3300015262 Bacteria 1118
177 Ga0163161_11355407 3300017792 Bacteria 620
178 Ga0207710_10014344 3300025900 Bacteria 3340
179 Ga0207688_10303229 3300025901 Bacteria 977
180 Ga0207680_10034269 3300025903 Unclassified 2904
181 Ga0207680_10130087 3300025903 Unclassified 1658
182 Ga0207680_10450137 3300025903 Bacteria 914
183 Ga0207645_10004869 3300025907 Bacteria 9847
184 Ga0207645_10265808 3300025907 Unclassified 1137
185 Ga0207643_10401535 3300025908 Bacteria 867
186 Ga0207643_10740215 3300025908 Bacteria 636
187 Ga0207684_10757806 3300025910 Unclassified 822
188 Ga0207660_10732338 3300025917 Bacteria 807
189 Ga0207662_10004155 3300025918 Bacteria 7578
190 Ga0207662_10033137 3300025918 Bacteria 3009
191 Ga0207662_10135432 3300025918 Bacteria 1556
192 Ga0207662_10187704 3300025918 Unclassified 1333
193 Ga0207649_10736850 3300025920 Bacteria 766
194 Ga0207646_10614254 3300025922 Bacteria 975
195 Ga0207681_10020574 3300025923 Bacteria 4184
196 Ga0207681_10144994 3300025923 Unclassified 1773
197 Ga0207681_10302092 3300025923 Bacteria 1267
198 Ga0207659_10002729 3300025926 Bacteria 10527
199 Ga0207659_10010552 3300025926 Bacteria 5808
200 Ga0207659_10386502 3300025926 Bacteria 1168
201 Ga0207687_10985584 3300025927 Unclassified 723
202 Ga0207644_10172230 3300025931 Bacteria 1691
203 Ga0207644_10764160 3300025931 Bacteria 808
204 Ga0207644_10775047 3300025931 Bacteria 802
205 Ga0207706_10037186 3300025933 Bacteria 4323
206 Ga0207706_10130051 3300025933 Bacteria 2214
207 Ga0207686_10005942 3300025934 Bacteria 6553
208 Ga0207709_10027980 3300025935 Unclassified 3255
209 Ga0207670_10508686 3300025936 Bacteria 979
210 Ga0207670_10962049 3300025936 Bacteria 717
211 Ga0207669_10891850 3300025937 Unclassified 742
212 Ga0207704_10001109 3300025938 Bacteria 11974
213 Ga0207704_10843445 3300025938 Unclassified 768
214 Ga0207665_10072356 3300025939 Unclassified 2355
215 Ga0207665_10224502 3300025939 Bacteria 1378
216 Ga0207691_10420224 3300025940 Bacteria 1139
217 Ga0207691_10428312 3300025940 Bacteria 1127
218 Ga0207711_10002168 3300025941 Bacteria 17661
219 Ga0207711_10056616 3300025941 Bacteria 3369
220 Ga0207711_10099106 3300025941 Bacteria 2575
221 Ga0207711_10168260 3300025941 Bacteria 1988
222 Ga0207689_10253653 3300025942 Bacteria 1455
223 Ga0207679_10422284 3300025945 Unclassified 1177
224 Ga0207667_11114962 3300025949 Unclassified 772
225 Ga0207651_10537544 3300025960 Unclassified 1015
226 Ga0207651_11134245 3300025960 Bacteria 701
227 Ga0207712_11375346 3300025961 Unclassified 631
228 Ga0207668_10258192 3300025972 Bacteria 1418
229 Ga0207668_10910882 3300025972 Bacteria 783
230 Ga0207640_10003227 3300025981 Bacteria 8784
231 Ga0207640_10112609 3300025981 Bacteria 1932
232 Ga0207640_10117650 3300025981 Bacteria 1897
233 Ga0207658_10600313 3300025986 Bacteria 989
234 Ga0207677_10238464 3300026023 Bacteria 1470
235 Ga0207677_10281774 3300026023 Bacteria 1365
236 Ga0207703_10039745 3300026035 Bacteria 3761
237 Ga0207639_10530578 3300026041 Unclassified 1079
238 Ga0207708_10009358 3300026075 Bacteria 7253
239 Ga0207641_10503604 3300026088 Unclassified 1176
240 Ga0207648_10051429 3300026089 Bacteria 3601
241 Ga0207648_10053541 3300026089 Bacteria 3527
242 Ga0207676_10009233 3300026095 Bacteria 7017
243 Ga0207676_11557507 3300026095 Unclassified 658
244 Ga0207674_10225718 3300026116 Bacteria 1821
245 Ga0207675_100002151 3300026118 Bacteria 19575
246 Ga0207675_100118246 3300026118 Bacteria 2506
247 Ga0207675_100123106 3300026118 Bacteria 2455
248 Ga0207675_100245661 3300026118 Bacteria 1731
249 Ga0207675_100260542 3300026118 Bacteria 1680
250 Ga0207675_100397156 3300026118 Unclassified 1358
251 Ga0207675_100747268 3300026118 Bacteria 989
252 Ga0207698_11442247 3300026142 Unclassified 703
253 Ga0207428_10016129 3300027907 Bacteria 6435
254 Ga0207428_10140268 3300027907 Bacteria 1845
255 Ga0268266_10214546 3300028379 Unclassified 1766
256 Ga0268265_10021458 3300028380 Bacteria 4524
257 Ga0268265_10064899 3300028380 Bacteria 2815
258 Ga0268265_10223912 3300028380 Unclassified 1648
259 Ga0268265_11162008 3300028380 Bacteria 768
260 Ga0268264_10144392 3300028381 Bacteria 2126
261 Ga0268264_10350194 3300028381 Unclassified 1406
262 Ga0268264_10425417 3300028381 Unclassified 1282
263 Ga0268264_12642708 3300028381 Bacteria 506
264 Ga0373930_0001538 3300034816 Unclassified 3454
265 Ga0373950_0004924 3300034818 Unclassified 1974
266 Ga0373958_0048970 3300034819 Bacteria 887
267 Ga0373938_0000263 3300034957 Bacteria 8270
268 Ga0373928_0001360 3300035084 Bacteria 4796
269 Ga0373929_0000744 3300035085 Bacteria 6316
270 Ga0373940_0000245 3300035088 Bacteria 7785
271 Ga0373949_0012932 3300035090 Unclassified 1849
272 Ga0373951_0000369 3300035091 Bacteria 13571
273 Ga0373952_0005244 3300035092 Bacteria 2363
274 Ga0373932_0000168 3300035112 Bacteria 19237
275 Ga0373939_0002290 3300035114 Bacteria 4527
276 Ga0373939_0426867 3300035114 Bacteria 554
277 Ga0373941_0000301 3300035115 Bacteria 9560
278 Ga0373960_0003360 3300035121 Unclassified 3619
279 Ga0373942_0002916 3300035207 Unclassified 4050
280 Ga0373961_0002030 3300035241 Bacteria 5418
281 Ga0373962_0000248 3300035242 Bacteria 11496
282 Ga0373931_0005133 3300035691 Bacteria 6030
283 Ga0373937_0055371 3300036401 Bacteria 3641
284 Ga0466957_0346944 3300044842 Unclassified 1006
285 Ga0451576_0010430 3300045051 Bacteria 10659
286 Ga0451576_0437312 3300045051 Bacteria 1373
287 Ga0495656_0227890 3300046615 Bacteria 934
288 Ga0495659_0158455 3300046664 Bacteria 913
289 Ga0495659_0392357 3300046664 Bacteria 598
290 Ga0495669_0280981 3300046684 Unclassified 801
291 Ga0495670_0146613 3300046691 Unclassified 1237
292 Ga0495593_0608351 3300047673 Unclassified 549
293 Ga0496102_0137480 3300048905 Bacteria 2290
294 Ga0496104_0197022 3300048907 Bacteria 1926
295 Ga0496107_0483911 3300048910 Unclassified 918
296 Ga0496108_0104544 3300048911 Bacteria 2416
297 Ga0496109_0051623 3300048912 Bacteria 3746
298 Ga0496112_0016099 3300048915 Bacteria 6992
299 Ga0496113_0005512 3300048916 Bacteria 7901
300 Ga0496113_1185380 3300048916 Bacteria 597
301 Ga0496114_0624659 3300048917 Unclassified 949
302 Ga0501067_0173059 3300049583 Unclassified 1203
303 nmdc:mga06z11_434723_c1 3300050494 Unclassified 792
304 nmdc:mga05p37_18000_c1 3300050507 Bacteria 8532
305 nmdc:mga05p37_29645_c1 3300050507 Bacteria 6676
306 nmdc:mga05p37_335315_c1 3300050507 Bacteria 1785
307 nmdc:mga05p37_36736_c1 3300050507 Bacteria 6008
308 nmdc:mga05p37_457713_c1 3300050507 Bacteria 1475
309 nmdc:mga09592_245424_c1 3300050508 Bacteria 1552
310 nmdc:mga06r32_138906_c1 3300050510 Bacteria 2405
311 nmdc:mga08y16_23921_c1 3300050511 Bacteria 6451
312 nmdc:mga08y16_377371_c1 3300050511 Bacteria 1454
313 nmdc:mga0n895_1286651_c1 3300050512 Unclassified 703
314 nmdc:mga0n895_175971_c1 3300050512 Bacteria 2170
315 nmdc:mga0n895_5284_c1 3300050512 Bacteria 10754
316 nmdc:mga0n895_57_c1 3300050512 Bacteria 65730
317 nmdc:mga0n895_718692_c1 3300050512 Unclassified 994
318 nmdc:mga0n895_901063_c1 3300050512 Unclassified 870
319 nmdc:mga0rr50_285508_c1 3300050513 Unclassified 1378
320 nmdc:mga0rr50_384016_c1 3300050513 Unclassified 1185
321 nmdc:mga0rr50_398_c1 3300050513 Bacteria 23629
322 nmdc:mga0rr50_47585_c1 3300050513 Bacteria 3165
323 nmdc:mga0rr50_5_c1 3300050513 Bacteria 327169
324 nmdc:mga08x19_109359_c1 3300050514 Bacteria 1843
325 nmdc:mga08x19_1174_c1 3300050514 Bacteria 16412
326 nmdc:mga08x19_227334_c1 3300050514 Unclassified 1283
327 nmdc:mga08x19_40362_c1 3300050514 Bacteria 2970
328 nmdc:mga08x19_505137_c1 3300050514 Bacteria 854
329 nmdc:mga0a205_142112_c1 3300050515 Unclassified 2300
330 nmdc:mga0a205_1506968_c1 3300050515 Unclassified 521
331 nmdc:mga0a205_15508_c1 3300050515 Bacteria 7121
332 nmdc:mga0a205_33112_c1 3300050515 Bacteria 4956
333 Ga0495601_0184677 3300053077 Unclassified 1363
334 Ga0105241_10015922
335 Ga0065712_10095553
336 Ga0065712_10392710
337 Ga0065715_10226103
338 Ga0065715_10464891
339 Ga0065715_10819530
340 Ga0065707_10250754
341 Ga0070676_10014881
342 Ga0070676_10328837
343 Ga0070690_100008840
344 Ga0070670_100819861
345 Ga0070677_10088570
346 Ga0068869_100077509
347 Ga0070666_10139722
348 Ga0070666_10323204
349 Ga0070666_10485006
350 Ga0070682_101582204
351 Ga0070691_10001089
352 Ga0070687_100006326
353 Ga0070687_100041495
354 Ga0070661_100345230
355 Ga0070668_100051972
356 Ga0070669_100329254
357 Ga0070669_100465619
358 Ga0070675_100008614
359 Ga0070675_100029553
360 Ga0070671_100225750
361 Ga0070671_100853619
362 Ga0070674_101485370
363 Ga0070673_100012586
364 Ga0070673_100700817
365 Ga0070688_100012812
366 Ga0070688_100709480
367 Ga0070659_100731877
368 Ga0070701_10001545
369 Ga0070701_10756907
370 Ga0070705_100037083
371 Ga0070705_100141419
372 Ga0070700_100005095
373 Ga0070700_100073855
374 Ga0070694_100086851
375 Ga0070662_100227124
376 Ga0070662_100447162
377 Ga0068867_100163459
378 Ga0070685_10202133
379 Ga0070707_100019582
380 Ga0070707_100054438
381 Ga0070698_100073588
382 Ga0070698_100236660
383 Ga0070698_101207462
384 Ga0070698_101354919
385 Ga0070698_101862879
386 Ga0070699_100008811
387 Ga0070699_100210182
388 Ga0070699_100427097
389 Ga0070684_100574761
390 Ga0070697_100021848
391 Ga0070697_100069838
392 Ga0070697_100802777
393 Ga0070697_100870421
394 Ga0068853_100530312
395 Ga0070672_100206271
396 Ga0070686_100261010
397 Ga0070695_100004707
398 Ga0070695_100015874
399 Ga0070695_100231882
400 Ga0070695_100485254
401 Ga0070696_100107518
402 Ga0070696_100242567
403 Ga0070696_100713930
404 Ga0070665_100146154
405 Ga0070704_100029638
406 Ga0070704_100329136
407 Ga0070704_100817471
408 Ga0068855_100619875
409 Ga0068857_100632838
410 Ga0068854_100494948
411 Ga0068854_100592321
412 Ga0070702_100016470
413 Ga0070702_100531616
414 Ga0068859_100328298
415 Ga0068864_100004451
416 Ga0068861_100003753
417 Ga0068861_100170458
418 Ga0068861_100305328
419 Ga0068861_100617430
420 Ga0068870_10853362
421 Ga0068863_101110003
422 Ga0068858_100004654
423 Ga0068858_100235913
424 Ga0068858_100957016
425 Ga0068858_102102825
426 Ga0068860_100166185
427 Ga0068860_100402257
428 Ga0068860_100599470
429 Ga0068860_101038694
430 Ga0068862_100176279
431 Ga0068862_100329858
432 Ga0068862_100590717
433 Ga0068862_101006634
434 Ga0068862_102148559
435 Ga0075432_10009424
436 Ga0070716_100152810
437 Ga0097621_100002470
438 Ga0097621_100421035
439 Ga0068871_100002676
440 Ga0075428_101419601
441 Ga0075431_100210503
442 Ga0075433_10087606
443 Ga0075433_10213299
444 Ga0075433_10386133
445 Ga0075433_10510990
446 Ga0075433_11332227
447 Ga0075434_100069476
448 Ga0075434_100402209
449 Ga0075434_100425040
450 Ga0075434_100712271
451 Ga0075434_100717840
452 Ga0068865_100002143
453 Ga0068865_100360535
454 Ga0068865_100903620
455 Ga0068865_101015480
456 Ga0075436_100003926
457 Ga0075436_100035840
458 Ga0097620_100328305
459 Ga0075435_100000440
460 Ga0075435_100001007
461 Ga0075435_100002546
462 Ga0075435_100118817
463 Ga0075435_100397437
464 Ga0105251_10155201
465 Ga0105240_10494686
466 Ga0111539_10015564
467 Ga0111539_10076375
468 Ga0105245_13008520
469 Ga0105247_10024778
470 Ga0114129_10022148
471 Ga0114129_10023304
472 Ga0114129_10038884
473 Ga0114129_10638179
474 Ga0114129_11002225
475 Ga0114129_11380431
476 Ga0105243_10252119
477 Ga0105243_11608856
478 Ga0105241_10918305
479 Ga0105242_10009046
480 Ga0105242_10629628
481 Ga0105242_12451097
482 Ga0105248_10007961
483 Ga0105248_10107631
484 Ga0105248_10316718
485 Ga0105248_12436576
486 Ga0105238_11827430
487 Ga0105249_10913810
488 Ga0105246_10305442
489 Ga0105246_12499069
490 Ga0157374_11456657
491 Ga0157378_11307968
492 Ga0157378_11706329
493 Ga0163162_10927844
494 Ga0163162_12628045
495 Ga0163162_12783875
496 Ga0157375_10265601
497 Ga0157375_10914456
498 Ga0163163_10016871
499 Ga0157380_10961572
500 Ga0157380_10989239
501 Ga0157380_11010901
502 Ga0157377_10020646
503 Ga0157377_10112329
504 Ga0157379_10080212
505 Ga0157379_10380602
506 Ga0157379_11061102
507 Ga0157379_12334345
508 Ga0157376_10058202
509 Ga0182007_10073725
510 Ga0163161_11355407
511 Ga0207710_10014344
512 Ga0207688_10303229
513 Ga0207680_10034269
514 Ga0207680_10130087
515 Ga0207680_10450137
516 Ga0207645_10004869
517 Ga0207645_10265808
518 Ga0207643_10401535
519 Ga0207643_10740215
520 Ga0207684_10757806
521 Ga0207660_10732338
522 Ga0207662_10004155
523 Ga0207662_10033137
524 Ga0207662_10135432
525 Ga0207662_10187704
526 Ga0207649_10736850
527 Ga0207646_10614254
528 Ga0207681_10020574
529 Ga0207681_10144994
530 Ga0207681_10302092
531 Ga0207659_10002729
532 Ga0207659_10010552
533 Ga0207659_10386502
534 Ga0207687_10985584
535 Ga0207644_10172230
536 Ga0207644_10764160
537 Ga0207644_10775047
538 Ga0207706_10037186
539 Ga0207706_10130051
540 Ga0207686_10005942
541 Ga0207709_10027980
542 Ga0207670_10508686
543 Ga0207670_10962049
544 Ga0207669_10891850
545 Ga0207704_10001109
546 Ga0207704_10843445
547 Ga0207665_10072356
548 Ga0207665_10224502
549 Ga0207691_10420224
550 Ga0207691_10428312
551 Ga0207711_10002168
552 Ga0207711_10056616
553 Ga0207711_10099106
554 Ga0207711_10168260
555 Ga0207689_10253653
556 Ga0207679_10422284
557 Ga0207667_11114962
558 Ga0207651_10537544
559 Ga0207651_11134245
560 Ga0207712_11375346
561 Ga0207668_10258192
562 Ga0207668_10910882
563 Ga0207640_10003227
564 Ga0207640_10112609
565 Ga0207640_10117650
566 Ga0207658_10600313
567 Ga0207677_10238464
568 Ga0207677_10281774
569 Ga0207703_10039745
570 Ga0207639_10530578
571 Ga0207708_10009358
572 Ga0207641_10503604
573 Ga0207648_10051429
574 Ga0207648_10053541
575 Ga0207676_10009233
576 Ga0207676_11557507
577 Ga0207674_10225718
578 Ga0207675_100002151
579 Ga0207675_100118246
580 Ga0207675_100123106
581 Ga0207675_100245661
582 Ga0207675_100260542
583 Ga0207675_100397156
584 Ga0207675_100747268
585 Ga0207698_11442247
586 Ga0207428_10016129
587 Ga0207428_10140268
588 Ga0268266_10214546
589 Ga0268265_10021458
590 Ga0268265_10064899
591 Ga0268265_10223912
592 Ga0268265_11162008
593 Ga0268264_10144392
594 Ga0268264_10350194
595 Ga0268264_10425417
596 Ga0268264_12642708
597 Ga0373930_0001538
598 Ga0373950_0004924
599 Ga0373958_0048970
600 Ga0373938_0000263
601 Ga0373928_0001360
602 Ga0373929_0000744
603 Ga0373940_0000245
604 Ga0373949_0012932
605 Ga0373951_0000369
606 Ga0373952_0005244
607 Ga0373932_0000168
608 Ga0373939_0002290
609 Ga0373939_0426867
610 Ga0373941_0000301
611 Ga0373960_0003360
612 Ga0373942_0002916
613 Ga0373961_0002030
614 Ga0373962_0000248
615 Ga0373931_0005133
616 Ga0373937_0055371
617 Ga0466957_0346944
618 Ga0451576_0010430
619 Ga0451576_0437312
620 Ga0495656_0227890
621 Ga0495659_0158455
622 Ga0495659_0392357
623 Ga0495669_0280981
624 Ga0495670_0146613
625 Ga0495593_0608351
626 Ga0496102_0137480
627 Ga0496104_0197022
628 Ga0496107_0483911
629 Ga0496108_0104544
630 Ga0496109_0051623
631 Ga0496112_0016099
632 Ga0496113_0005512
633 Ga0496113_1185380
634 Ga0496114_0624659
635 Ga0501067_0173059
636 nmdc:mga06z11_434723_c1
637 nmdc:mga05p37_18000_c1
638 nmdc:mga05p37_29645_c1
639 nmdc:mga05p37_335315_c1
640 nmdc:mga05p37_36736_c1
641 nmdc:mga05p37_457713_c1
642 nmdc:mga09592_245424_c1
643 nmdc:mga06r32_138906_c1
644 nmdc:mga08y16_23921_c1
645 nmdc:mga08y16_377371_c1
646 nmdc:mga0n895_1286651_c1
647 nmdc:mga0n895_175971_c1
648 nmdc:mga0n895_5284_c1
649 nmdc:mga0n895_57_c1
650 nmdc:mga0n895_718692_c1
651 nmdc:mga0n895_901063_c1
652 nmdc:mga0rr50_285508_c1
653 nmdc:mga0rr50_384016_c1
654 nmdc:mga0rr50_398_c1
655 nmdc:mga0rr50_47585_c1
656 nmdc:mga0rr50_5_c1
657 nmdc:mga08x19_109359_c1
658 nmdc:mga08x19_1174_c1
659 nmdc:mga08x19_227334_c1
660 nmdc:mga08x19_40362_c1
661 nmdc:mga08x19_505137_c1
662 nmdc:mga0a205_142112_c1
663 nmdc:mga0a205_1506968_c1
664 nmdc:mga0a205_15508_c1
665 nmdc:mga0a205_33112_c1
666 Ga0495601_0184677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07813

LTXXQ

LTXXQ motif family protein

61

160

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o76-assembly1.cif.gz_B human cytosolic histidyl-trna synthetase (hisrs) with whep domain 0.9898 61 102
6ahx-assembly1.cif.gz_A-2 copper-sensing operon regulator protein (csorgz) 0.9425 61 105
5j2l-assembly1.cif.gz_B de novo design of protein homo-oligomers with modular hydrogen bond network-mediated specificity 0.9166 56 117
7uq2-assembly1.cif.gz_A vs.4 from t4 phage in complex with cgamp 0.8802 43 118
2djv-assembly1.cif.gz_A solution structures of the whep-trs domain of human methionyl-trna synthetase 0.8796 60 107
ID Description Score Start End Superfamily
af_P07814_749_805_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9912 64 105 1.10.287.10
5ujjA01 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.9836 62 105 1.10.287.10
3dkqC02 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;Rabenosyn, Rab binding domain 0.9599 64 102 4.10.860.20
af_P0AAA9_39_119_1.20.120.1490 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9337 43 117 1.20.120.1490
3layA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.9261 43 117 1.20.120.1490
ID Description Score Start End GO Terms
AF-U5DIU3-F1-model_v4 P pilus assembly/Cpx signaling pathway, periplasmic inhibitor/zinc-resistance associated protein 0.9484 39 136 GO:0030288
GO:0051082
AF-A0A2E7G9C7-F1-model_v4 deleted 0.937 36 137
AF-A0A2E0VIJ3-F1-model_v4 Periplasmic heavy metal sensor 0.9282 36 137 GO:0030288
GO:0051082
AF-A0A2S9K607-F1-model_v4 Uncharacterized protein 0.9259 36 133
AF-A0A379LJ61-F1-model_v4 Periplasmic protein 0.925 36 136 GO:0042597

Map