F411278

General Info

Members Datasets Scaffolds Average Seq Length
333 215 666 199

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100002143|Ga0070697_10000214313
Length 199
Sequence MILLYDSKPSGNCYKVRLLLAQLGQRYERRELSVTDRSDRPKVLGGLNPALRVPTVVLDDGRPLAESNAILWYFGDGTRYIPQDRYERAQVLQWQFFEQYNHEPNIAVARFWLHDSGAELDRNALEKRQAAGYVALDAMEKHLAGRSFFVDERYSLADISLYAYTHVADEGGFDLGRYPAIRAWLDRVASQPGHVTIEA

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
23 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
24 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
25 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
28 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
29 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
30 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
31 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
32 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
84 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
85 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
86 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
87 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
88 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
89 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
94 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
95 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
96 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
102 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
106 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
109 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
111 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
112 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
121 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
122 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
123 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
124 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
125 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
130 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
131 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
135 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
142 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
148 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
164 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
176 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
177 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
178 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
179 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
182 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
183 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
184 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
197 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
208 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
209 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
210 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
211 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.8
Metatranscriptomes 1.2
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.8
Nodule 0
Rhizoplane 13.51
Rhizosphere 84.68
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100002143 3300005536 Bacteria 15125
2 Ga0070658_10035266 3300005327 Bacteria 4029
3 Ga0070683_100080488 3300005329 Bacteria 3049
4 Ga0070666_10415967 3300005335 Bacteria 968
5 Ga0068868_100408540 3300005338 Bacteria 1173
6 Ga0070660_100024852 3300005339 Bacteria 4449
7 Ga0070691_10252240 3300005341 Bacteria 947
8 Ga0070714_100030610 3300005435 Bacteria 4482
9 Ga0070710_10028766 3300005437 Bacteria 2975
10 Ga0070705_100278197 3300005440 Bacteria 1189
11 Ga0070700_100111735 3300005441 Bacteria 1818
12 Ga0070681_10547051 3300005458 Bacteria 1071
13 Ga0070706_100271356 3300005467 Unclassified 1583
14 Ga0070707_100577926 3300005468 Unclassified 1086
15 Ga0070698_100027076 3300005471 Bacteria 5962
16 Ga0070698_100093723 3300005471 Unclassified 2982
17 Ga0070698_100179766 3300005471 Unclassified 2054
18 Ga0070679_100078672 3300005530 Bacteria 3286
19 Ga0070684_100024941 3300005535 Bacteria 5021
20 Ga0070684_100031766 3300005535 Bacteria 4497
21 Ga0070684_100249416 3300005535 Bacteria 1622
22 Ga0068853_100168909 3300005539 Bacteria 1978
23 Ga0070686_100440221 3300005544 Bacteria 1000
24 Ga0070693_100012922 3300005547 Bacteria 4239
25 Ga0070693_100055902 3300005547 Bacteria 2276
26 Ga0068855_100181087 3300005563 Bacteria 2382
27 Ga0068855_100674926 3300005563 Bacteria 1108
28 Ga0068856_100074385 3300005614 Bacteria 3363
29 Ga0068856_100145861 3300005614 Bacteria 2374
30 Ga0081455_10026165 3300005937 Bacteria 5375
31 Ga0081455_10056615 3300005937 Bacteria 3328
32 Ga0081538_10054016 3300005981 Bacteria 2380
33 Ga0081540_1008476 3300005983 Bacteria 7177
34 Ga0070717_10331824 3300006028 Unclassified 1357
35 Ga0070717_10891365 3300006028 Bacteria 810
36 Ga0075432_10020364 3300006058 Bacteria 2269
37 Ga0070715_10090073 3300006163 Bacteria 1410
38 Ga0070716_100135446 3300006173 Bacteria 1563
39 Ga0070712_100034520 3300006175 Bacteria 3429
40 Ga0070712_100142926 3300006175 Bacteria 1828
41 Ga0070712_100336253 3300006175 Unclassified 1232
42 Ga0075367_10178952 3300006178 Bacteria 1322
43 Ga0075366_10129830 3300006195 Bacteria 1520
44 Ga0068871_100055758 3300006358 Bacteria 3209
45 Ga0075430_100088303 3300006846 Bacteria 2594
46 Ga0075431_100273654 3300006847 Bacteria 1711
47 Ga0075429_100119609 3300006880 Bacteria 2302
48 Ga0075429_100187324 3300006880 Bacteria 1813
49 Ga0075436_100015463 3300006914 Bacteria 5225
50 Ga0075435_100138825 3300007076 Bacteria 2038
51 Ga0075435_100810159 3300007076 Bacteria 815
52 Ga0105240_10294641 3300009093 Bacteria 1858
53 Ga0111539_10406086 3300009094 Bacteria 1586
54 Ga0105245_10039950 3300009098 Bacteria 4177
55 Ga0105245_10346793 3300009098 Bacteria 1470
56 Ga0114129_10001381 3300009147 Bacteria 32671
57 Ga0114129_10137036 3300009147 Bacteria 3358
58 Ga0105241_10083861 3300009174 Bacteria 2501
59 Ga0105242_10413422 3300009176 Bacteria 1262
60 Ga0105248_10181703 3300009177 Bacteria 2370
61 Ga0099796_10045926 3300010159 Bacteria 1497
62 Ga0105246_10717793 3300011119 Bacteria 878
63 Ga0157336_1012584 3300012477 Bacteria 673
64 Ga0157370_10052939 3300013104 Bacteria 3873
65 Ga0157369_10316007 3300013105 Bacteria 1624
66 Ga0157372_10207362 3300013307 Bacteria 2271
67 Ga0157375_10450729 3300013308 Bacteria 1452
68 Ga0157377_10646805 3300014745 Bacteria 760
69 Ga0157376_10285130 3300014969 Bacteria 1557
70 Ga0197907_10342160 3300020069 Bacteria 1930
71 Ga0206356_11389976 3300020070 Bacteria 4912
72 Ga0206354_10963030 3300020081 Bacteria 2609
73 Ga0206353_10822813 3300020082 Bacteria 1587
74 Ga0207692_10055452 3300025898 Unclassified 2029
75 Ga0207685_10112745 3300025905 Bacteria 1181
76 Ga0207684_10248424 3300025910 Unclassified 1535
77 Ga0207707_10050945 3300025912 Bacteria 3605
78 Ga0207695_10335503 3300025913 Bacteria 1400
79 Ga0207693_10041676 3300025915 Bacteria 3614
80 Ga0207693_10075843 3300025915 Bacteria 2633
81 Ga0207660_10206460 3300025917 Bacteria 1536
82 Ga0207657_10000073 3300025919 Bacteria 93299
83 Ga0207652_10109217 3300025921 Bacteria 2452
84 Ga0207646_10489452 3300025922 Bacteria 1109
85 Ga0207687_10401356 3300025927 Bacteria 1128
86 Ga0207664_10026274 3300025929 Bacteria 4399
87 Ga0207665_10024924 3300025939 Bacteria 3945
88 Ga0207689_10274384 3300025942 Bacteria 1396
89 Ga0207661_10689481 3300025944 Bacteria 939
90 Ga0207667_10122012 3300025949 Bacteria 2685
91 Ga0207640_10227623 3300025981 Bacteria 1432
92 Ga0207658_10509742 3300025986 Bacteria 1073
93 Ga0207678_10094559 3300026067 Bacteria 2554
94 Ga0207708_10008947 3300026075 Bacteria 7410
95 Ga0207708_10177900 3300026075 Bacteria 1688
96 Ga0207702_10374271 3300026078 Bacteria 1368
97 Ga0207702_10486257 3300026078 Bacteria 1202
98 Ga0207648_10889451 3300026089 Bacteria 832
99 Ga0207683_10059244 3300026121 Bacteria 3364
100 Ga0207683_10089731 3300026121 Bacteria 2736
101 Ga0207683_10133228 3300026121 Bacteria 2236
102 Ga0207428_10218979 3300027907 Bacteria 1428
103 Ga0265319_1032821 3300028563 Bacteria 1797
104 Ga0265318_10004085 3300028577 Bacteria 7155
105 Ga0265318_10099892 3300028577 Bacteria 1068
106 Ga0265322_10021564 3300028654 Bacteria 1844
107 Ga0265338_10058467 3300028800 Bacteria 3402
108 Ga0265338_10131455 3300028800 Unclassified 1975
109 Ga0265338_10147619 3300028800 Bacteria 1832
110 Ga0265330_10075874 3300031235 Bacteria 1451
111 Ga0265330_10097825 3300031235 Bacteria 1257
112 Ga0265329_10012288 3300031242 Bacteria 3082
113 Ga0265339_10089407 3300031249 Bacteria 1616
114 Ga0265327_10100776 3300031251 Bacteria 1394
115 Ga0265316_10010875 3300031344 Bacteria 8263
116 Ga0307408_100233347 3300031548 Bacteria 1508
117 Ga0265313_10006591 3300031595 Bacteria 8171
118 Ga0265314_10003588 3300031711 Bacteria 14943
119 Ga0307405_10013795 3300031731 Bacteria 4321
120 Ga0307410_10119008 3300031852 Bacteria 1923
121 Ga0307410_10253254 3300031852 Bacteria 1370
122 Ga0307409_100027468 3300031995 Bacteria 4034
123 Ga0307409_100033487 3300031995 Bacteria 3740
124 Ga0307415_100008363 3300032126 Bacteria 5725
125 Ga0307415_100164494 3300032126 Bacteria 1724
126 Ga0373938_0001895 3300034957 Bacteria 3347
127 Ga0373928_0028632 3300035084 Bacteria 1220
128 Ga0373949_0006645 3300035090 Bacteria 2541
129 Ga0373951_0022120 3300035091 Bacteria 1462
130 Ga0373939_0030828 3300035114 Bacteria 1545
131 Ga0373941_0107518 3300035115 Bacteria 979
132 Ga0373941_0153841 3300035115 Bacteria 846
133 Ga0373953_0288400 3300035117 Bacteria 716
134 Ga0373960_0014312 3300035121 Bacteria 2007
135 Ga0373942_0012750 3300035207 Bacteria 2013
136 Ga0373961_0093800 3300035241 Bacteria 963
137 Ga0373924_0056983 3300035410 Bacteria 1629
138 Ga0373927_0104506 3300035695 Bacteria 1844
139 Ga0373933_0100964 3300035724 Bacteria 1790
140 Ga0373947_0052700 3300035725 Bacteria 2451
141 Ga0373937_0022014 3300036401 Bacteria 5724
142 Ga0373937_0038819 3300036401 Bacteria 4339
143 Ga0373925_0077901 3300037068 Bacteria 2517
144 Ga0395899_0167209 3300037312 Bacteria 1551
145 Ga0395899_0192986 3300037312 Bacteria 1424
146 Ga0395900_0005580 3300037418 Bacteria 13170
147 Ga0395900_0032834 3300037418 Bacteria 5339
148 Ga0395900_0045211 3300037418 Bacteria 4535
149 Ga0395900_0073791 3300037418 Unclassified 3508
150 Ga0395900_0127456 3300037418 Bacteria 2610
151 Ga0395900_0559249 3300037418 Bacteria 1088
152 Ga0395900_0797715 3300037418 Bacteria 872
153 Ga0395900_0881700 3300037418 Unclassified 819
154 Ga0395900_1056928 3300037418 Bacteria 730
155 Ga0395898_0002309 3300037466 Bacteria 22851
156 Ga0395898_0021265 3300037466 Bacteria 6580
157 Ga0395898_0033140 3300037466 Bacteria 5156
158 Ga0395898_0065368 3300037466 Bacteria 3526
159 Ga0395898_0739538 3300037466 Bacteria 925
160 Ga0395905_0003158 3300037471 Bacteria 17749
161 Ga0395905_0003664 3300037471 Bacteria 16295
162 Ga0395905_0062120 3300037471 Bacteria 3494
163 Ga0395905_0107059 3300037471 Bacteria 2625
164 Ga0395905_0288321 3300037471 Bacteria 1528
165 Ga0395901_0001426 3300038443 Bacteria 24921
166 Ga0395901_0007126 3300038443 Bacteria 11290
167 Ga0395901_0017777 3300038443 Bacteria 7258
168 Ga0395901_0036901 3300038443 Bacteria 5053
169 Ga0395901_0115612 3300038443 Bacteria 2818
170 Ga0395901_0182544 3300038443 Bacteria 2201
171 Ga0395901_0937383 3300038443 Bacteria 845
172 Ga0439463_032646 3300042016 Bacteria 1316
173 Ga0466965_0251958 3300044683 Bacteria 947
174 Ga0466964_0019846 3300044706 Bacteria 2586
175 Ga0466964_0027867 3300044706 Bacteria 2221
176 Ga0466968_0077184 3300044735 Bacteria 1459
177 Ga0466960_0194795 3300044901 Bacteria 1104
178 Ga0466960_0499725 3300044901 Bacteria 712
179 Ga0451576_0009850 3300045051 Bacteria 11042
180 Ga0451576_0620982 3300045051 Bacteria 1136
181 Ga0466967_0026950 3300045976 Bacteria 4771
182 Ga0466967_0068288 3300045976 Bacteria 3173
183 Ga0466967_0100044 3300045976 Bacteria 2649
184 Ga0495592_0183553 3300046454 Bacteria 1423
185 Ga0495592_0332205 3300046454 Bacteria 979
186 Ga0495629_0129085 3300046459 Bacteria 1761
187 Ga0495629_0289263 3300046459 Bacteria 1123
188 Ga0495641_0025897 3300046461 Bacteria 2872
189 Ga0495641_0075603 3300046461 Bacteria 1510
190 Ga0495651_0068145 3300046462 Bacteria 2713
191 Ga0495651_0157824 3300046462 Bacteria 1628
192 Ga0495651_0237146 3300046462 Bacteria 1253
193 Ga0495582_0200747 3300046473 Bacteria 1139
194 Ga0495605_0062620 3300046474 Bacteria 1777
195 Ga0495664_0106428 3300046477 Bacteria 1691
196 Ga0495607_0315711 3300046501 Bacteria 731
197 Ga0495608_0073997 3300046511 Bacteria 2221
198 Ga0495608_0243891 3300046511 Bacteria 1122
199 Ga0495618_0250569 3300046514 Bacteria 1111
200 Ga0495628_0125403 3300046516 Bacteria 1968
201 Ga0495628_0566117 3300046516 Bacteria 814
202 Ga0495630_0008966 3300046517 Bacteria 7182
203 Ga0495630_0163648 3300046517 Bacteria 1693
204 Ga0495630_0414044 3300046517 Bacteria 1033
205 Ga0495630_0487038 3300046517 Bacteria 946
206 Ga0495631_0037006 3300046518 Bacteria 2176
207 Ga0495663_0013322 3300046525 Bacteria 2299
208 Ga0495666_0079980 3300046526 Bacteria 1547
209 Ga0495642_0023739 3300046528 Bacteria 2423
210 Ga0495652_0023242 3300046529 Bacteria 5496
211 Ga0495652_0257350 3300046529 Bacteria 1290
212 Ga0495640_0067917 3300046533 Bacteria 2400
213 Ga0495586_0283224 3300046535 Bacteria 949
214 Ga0495587_0070411 3300046536 Bacteria 2035
215 Ga0495587_0079895 3300046536 Bacteria 1896
216 Ga0495587_0138341 3300046536 Bacteria 1391
217 Ga0495645_0154508 3300046543 Bacteria 1591
218 Ga0495622_0260200 3300046557 Bacteria 762
219 Ga0495667_0101793 3300046559 Bacteria 1858
220 Ga0495667_0200537 3300046559 Bacteria 1277
221 Ga0495656_0034780 3300046615 Bacteria 2066
222 Ga0495635_0090743 3300046663 Bacteria 2090
223 Ga0495588_0183873 3300046674 Bacteria 1104
224 Ga0495657_0106449 3300046675 Bacteria 1781
225 Ga0495599_0024381 3300046678 Bacteria 3783
226 Ga0495599_0180696 3300046678 Bacteria 1300
227 Ga0495623_0139869 3300046679 Bacteria 1441
228 Ga0495623_0238890 3300046679 Bacteria 1027
229 Ga0495646_0105383 3300046680 Bacteria 1611
230 Ga0495658_0216031 3300046683 Bacteria 1199
231 Ga0495613_0143846 3300046689 Bacteria 1703
232 Ga0495624_0148536 3300046690 Bacteria 1434
233 Ga0495624_0268770 3300046690 Bacteria 1030
234 Ga0495581_0208542 3300047315 Bacteria 1143
235 Ga0495604_0011260 3300047317 Bacteria 7102
236 Ga0495604_0117706 3300047317 Bacteria 1927
237 Ga0495674_0036690 3300047319 Bacteria 4410
238 Ga0495674_0059380 3300047319 Bacteria 3340
239 Ga0495674_0064582 3300047319 Bacteria 3182
240 Ga0495674_0718501 3300047319 Unclassified 783
241 Ga0495676_0580417 3300047321 Bacteria 731
242 Ga0495680_0054857 3300047322 Bacteria 3093
243 Ga0495680_0089518 3300047322 Bacteria 2310
244 Ga0495677_0036171 3300047445 Bacteria 1803
245 Ga0495684_0092666 3300047471 Bacteria 2288
246 Ga0495602_0116066 3300048088 Bacteria 2164
247 Ga0496100_0314969 3300048903 Bacteria 1174
248 Ga0496101_0009897 3300048904 Bacteria 6281
249 Ga0496101_0072595 3300048904 Bacteria 2526
250 Ga0496101_0163772 3300048904 Bacteria 1707
251 Ga0496102_0022308 3300048905 Bacteria 5610
252 Ga0496102_0032542 3300048905 Bacteria 4684
253 Ga0496102_0288734 3300048905 Bacteria 1546
254 Ga0496103_0035608 3300048906 Bacteria 3048
255 Ga0496104_0015535 3300048907 Bacteria 6897
256 Ga0496104_0404189 3300048907 Bacteria 1278
257 Ga0496105_0017992 3300048908 Bacteria 5671
258 Ga0496105_0021216 3300048908 Bacteria 5256
259 Ga0496105_0029780 3300048908 Bacteria 4469
260 Ga0496105_0053826 3300048908 Bacteria 3324
261 Ga0496105_0086201 3300048908 Bacteria 2595
262 Ga0496106_0017857 3300048909 Bacteria 5246
263 Ga0496107_0030870 3300048910 Bacteria 3821
264 Ga0496107_0099512 3300048910 Bacteria 2131
265 Ga0496107_0127239 3300048910 Bacteria 1879
266 Ga0496108_0044640 3300048911 Bacteria 3699
267 Ga0496108_0113734 3300048911 Bacteria 2316
268 Ga0496109_0006568 3300048912 Bacteria 9793
269 Ga0496109_0035919 3300048912 Bacteria 4473
270 Ga0496109_0452249 3300048912 Bacteria 1213
271 Ga0496109_0761653 3300048912 Bacteria 906
272 Ga0496110_0004628 3300048913 Bacteria 10688
273 Ga0496110_0248672 3300048913 Bacteria 1618
274 Ga0496110_0257711 3300048913 Bacteria 1587
275 Ga0496111_0003051 3300048914 Bacteria 10279
276 Ga0496111_0013643 3300048914 Bacteria 5535
277 Ga0496111_0019926 3300048914 Bacteria 4665
278 Ga0496111_0358878 3300048914 Bacteria 1079
279 Ga0496111_0493846 3300048914 Bacteria 901
280 Ga0496112_0019327 3300048915 Bacteria 6428
281 Ga0496112_0021949 3300048915 Bacteria 6075
282 Ga0496112_0089855 3300048915 Bacteria 3040
283 Ga0496112_1226199 3300048915 Bacteria 667
284 Ga0496113_0001932 3300048916 Bacteria 11862
285 Ga0496113_0262154 3300048916 Bacteria 1381
286 Ga0496114_0019329 3300048917 Bacteria 5519
287 Ga0496114_0043108 3300048917 Bacteria 3742
288 Ga0496114_0763101 3300048917 Bacteria 845
289 Ga0496115_0003888 3300048918 Bacteria 10768
290 Ga0496115_0007841 3300048918 Bacteria 7873
291 Ga0496115_0014417 3300048918 Bacteria 5983
292 Ga0501036_0228246 3300049572 Bacteria 1563
293 Ga0501039_0216227 3300049575 Bacteria 1507
294 Ga0501040_0080027 3300049576 Bacteria 2263
295 Ga0501041_0259305 3300049577 Bacteria 1093
296 Ga0501042_0235990 3300049578 Bacteria 1320
297 Ga0501043_0596198 3300049579 Bacteria 817
298 Ga0501047_0187762 3300049581 Bacteria 1931
299 Ga0501047_0315265 3300049581 Bacteria 1404
300 Ga0501048_0371417 3300049582 Bacteria 1021
301 Ga0501067_0277838 3300049583 Bacteria 933
302 Ga0501071_0131919 3300049587 Bacteria 1857
303 Ga0501072_0235346 3300049588 Bacteria 1459
304 Ga0501074_0185426 3300049590 Bacteria 1484
305 Ga0501076_0233683 3300049592 Bacteria 1503
306 Ga0501076_0347978 3300049592 Bacteria 1217
307 Ga0501077_0125497 3300049593 Bacteria 1627
308 Ga0501081_0507999 3300049743 Bacteria 898
309 nmdc:mga03683_144180_c1 3300050489 Bacteria 1072
310 nmdc:mga00v17_118314_c1 3300050491 Bacteria 1686
311 nmdc:mga0yw44_383836_c1 3300050492 Bacteria 949
312 nmdc:mga0k408_305137_c1 3300050493 Bacteria 950
313 nmdc:mga05p37_134338_c1 3300050507 Bacteria 3035
314 nmdc:mga05p37_482393_c1 3300050507 Bacteria 1428
315 nmdc:mga09592_185122_c1 3300050508 Bacteria 1802
316 nmdc:mga09592_37186_c1 3300050508 Bacteria 4082
317 nmdc:mga06r32_545298_c1 3300050510 Bacteria 1134
318 nmdc:mga08y16_764393_c1 3300050511 Bacteria 961
319 nmdc:mga0n895_134052_c1 3300050512 Bacteria 2503
320 nmdc:mga0rr50_121336_c1 3300050513 Bacteria 2081
321 nmdc:mga0rr50_650293_c1 3300050513 Bacteria 900
322 nmdc:mga08x19_27641_c1 3300050514 Bacteria 3549
323 nmdc:mga0a205_124580_c1 3300050515 Bacteria 2477
324 nmdc:mga0a205_861403_c1 3300050515 Bacteria 753
325 Ga0495612_0098022 3300053078 Bacteria 1246
326 Ga0495595_0151823 3300053084 Bacteria 1140
327 Ga0495619_0053202 3300053085 Bacteria 2677
328 Ga0495619_0223276 3300053085 Bacteria 1305
329 Ga0501084_0117907 3300054114 Bacteria 2232
330 Ga0501084_0451166 3300054114 Bacteria 1087
331 Ga0501084_0649866 3300054114 Bacteria 890
332 Ga0501082_0422648 3300060353 Bacteria 1164
333 Ga0501082_1283409 3300060353 Bacteria 640
334 Ga0070697_100002143
335 Ga0070658_10035266
336 Ga0070683_100080488
337 Ga0070666_10415967
338 Ga0068868_100408540
339 Ga0070660_100024852
340 Ga0070691_10252240
341 Ga0070714_100030610
342 Ga0070710_10028766
343 Ga0070705_100278197
344 Ga0070700_100111735
345 Ga0070681_10547051
346 Ga0070706_100271356
347 Ga0070707_100577926
348 Ga0070698_100027076
349 Ga0070698_100093723
350 Ga0070698_100179766
351 Ga0070679_100078672
352 Ga0070684_100024941
353 Ga0070684_100031766
354 Ga0070684_100249416
355 Ga0068853_100168909
356 Ga0070686_100440221
357 Ga0070693_100012922
358 Ga0070693_100055902
359 Ga0068855_100181087
360 Ga0068855_100674926
361 Ga0068856_100074385
362 Ga0068856_100145861
363 Ga0081455_10026165
364 Ga0081455_10056615
365 Ga0081538_10054016
366 Ga0081540_1008476
367 Ga0070717_10331824
368 Ga0070717_10891365
369 Ga0075432_10020364
370 Ga0070715_10090073
371 Ga0070716_100135446
372 Ga0070712_100034520
373 Ga0070712_100142926
374 Ga0070712_100336253
375 Ga0075367_10178952
376 Ga0075366_10129830
377 Ga0068871_100055758
378 Ga0075430_100088303
379 Ga0075431_100273654
380 Ga0075429_100119609
381 Ga0075429_100187324
382 Ga0075436_100015463
383 Ga0075435_100138825
384 Ga0075435_100810159
385 Ga0105240_10294641
386 Ga0111539_10406086
387 Ga0105245_10039950
388 Ga0105245_10346793
389 Ga0114129_10001381
390 Ga0114129_10137036
391 Ga0105241_10083861
392 Ga0105242_10413422
393 Ga0105248_10181703
394 Ga0099796_10045926
395 Ga0105246_10717793
396 Ga0157336_1012584
397 Ga0157370_10052939
398 Ga0157369_10316007
399 Ga0157372_10207362
400 Ga0157375_10450729
401 Ga0157377_10646805
402 Ga0157376_10285130
403 Ga0197907_10342160
404 Ga0206356_11389976
405 Ga0206354_10963030
406 Ga0206353_10822813
407 Ga0207692_10055452
408 Ga0207685_10112745
409 Ga0207684_10248424
410 Ga0207707_10050945
411 Ga0207695_10335503
412 Ga0207693_10041676
413 Ga0207693_10075843
414 Ga0207660_10206460
415 Ga0207657_10000073
416 Ga0207652_10109217
417 Ga0207646_10489452
418 Ga0207687_10401356
419 Ga0207664_10026274
420 Ga0207665_10024924
421 Ga0207689_10274384
422 Ga0207661_10689481
423 Ga0207667_10122012
424 Ga0207640_10227623
425 Ga0207658_10509742
426 Ga0207678_10094559
427 Ga0207708_10008947
428 Ga0207708_10177900
429 Ga0207702_10374271
430 Ga0207702_10486257
431 Ga0207648_10889451
432 Ga0207683_10059244
433 Ga0207683_10089731
434 Ga0207683_10133228
435 Ga0207428_10218979
436 Ga0265319_1032821
437 Ga0265318_10004085
438 Ga0265318_10099892
439 Ga0265322_10021564
440 Ga0265338_10058467
441 Ga0265338_10131455
442 Ga0265338_10147619
443 Ga0265330_10075874
444 Ga0265330_10097825
445 Ga0265329_10012288
446 Ga0265339_10089407
447 Ga0265327_10100776
448 Ga0265316_10010875
449 Ga0307408_100233347
450 Ga0265313_10006591
451 Ga0265314_10003588
452 Ga0307405_10013795
453 Ga0307410_10119008
454 Ga0307410_10253254
455 Ga0307409_100027468
456 Ga0307409_100033487
457 Ga0307415_100008363
458 Ga0307415_100164494
459 Ga0373938_0001895
460 Ga0373928_0028632
461 Ga0373949_0006645
462 Ga0373951_0022120
463 Ga0373939_0030828
464 Ga0373941_0107518
465 Ga0373941_0153841
466 Ga0373953_0288400
467 Ga0373960_0014312
468 Ga0373942_0012750
469 Ga0373961_0093800
470 Ga0373924_0056983
471 Ga0373927_0104506
472 Ga0373933_0100964
473 Ga0373947_0052700
474 Ga0373937_0022014
475 Ga0373937_0038819
476 Ga0373925_0077901
477 Ga0395899_0167209
478 Ga0395899_0192986
479 Ga0395900_0005580
480 Ga0395900_0032834
481 Ga0395900_0045211
482 Ga0395900_0073791
483 Ga0395900_0127456
484 Ga0395900_0559249
485 Ga0395900_0797715
486 Ga0395900_0881700
487 Ga0395900_1056928
488 Ga0395898_0002309
489 Ga0395898_0021265
490 Ga0395898_0033140
491 Ga0395898_0065368
492 Ga0395898_0739538
493 Ga0395905_0003158
494 Ga0395905_0003664
495 Ga0395905_0062120
496 Ga0395905_0107059
497 Ga0395905_0288321
498 Ga0395901_0001426
499 Ga0395901_0007126
500 Ga0395901_0017777
501 Ga0395901_0036901
502 Ga0395901_0115612
503 Ga0395901_0182544
504 Ga0395901_0937383
505 Ga0439463_032646
506 Ga0466965_0251958
507 Ga0466964_0019846
508 Ga0466964_0027867
509 Ga0466968_0077184
510 Ga0466960_0194795
511 Ga0466960_0499725
512 Ga0451576_0009850
513 Ga0451576_0620982
514 Ga0466967_0026950
515 Ga0466967_0068288
516 Ga0466967_0100044
517 Ga0495592_0183553
518 Ga0495592_0332205
519 Ga0495629_0129085
520 Ga0495629_0289263
521 Ga0495641_0025897
522 Ga0495641_0075603
523 Ga0495651_0068145
524 Ga0495651_0157824
525 Ga0495651_0237146
526 Ga0495582_0200747
527 Ga0495605_0062620
528 Ga0495664_0106428
529 Ga0495607_0315711
530 Ga0495608_0073997
531 Ga0495608_0243891
532 Ga0495618_0250569
533 Ga0495628_0125403
534 Ga0495628_0566117
535 Ga0495630_0008966
536 Ga0495630_0163648
537 Ga0495630_0414044
538 Ga0495630_0487038
539 Ga0495631_0037006
540 Ga0495663_0013322
541 Ga0495666_0079980
542 Ga0495642_0023739
543 Ga0495652_0023242
544 Ga0495652_0257350
545 Ga0495640_0067917
546 Ga0495586_0283224
547 Ga0495587_0070411
548 Ga0495587_0079895
549 Ga0495587_0138341
550 Ga0495645_0154508
551 Ga0495622_0260200
552 Ga0495667_0101793
553 Ga0495667_0200537
554 Ga0495656_0034780
555 Ga0495635_0090743
556 Ga0495588_0183873
557 Ga0495657_0106449
558 Ga0495599_0024381
559 Ga0495599_0180696
560 Ga0495623_0139869
561 Ga0495623_0238890
562 Ga0495646_0105383
563 Ga0495658_0216031
564 Ga0495613_0143846
565 Ga0495624_0148536
566 Ga0495624_0268770
567 Ga0495581_0208542
568 Ga0495604_0011260
569 Ga0495604_0117706
570 Ga0495674_0036690
571 Ga0495674_0059380
572 Ga0495674_0064582
573 Ga0495674_0718501
574 Ga0495676_0580417
575 Ga0495680_0054857
576 Ga0495680_0089518
577 Ga0495677_0036171
578 Ga0495684_0092666
579 Ga0495602_0116066
580 Ga0496100_0314969
581 Ga0496101_0009897
582 Ga0496101_0072595
583 Ga0496101_0163772
584 Ga0496102_0022308
585 Ga0496102_0032542
586 Ga0496102_0288734
587 Ga0496103_0035608
588 Ga0496104_0015535
589 Ga0496104_0404189
590 Ga0496105_0017992
591 Ga0496105_0021216
592 Ga0496105_0029780
593 Ga0496105_0053826
594 Ga0496105_0086201
595 Ga0496106_0017857
596 Ga0496107_0030870
597 Ga0496107_0099512
598 Ga0496107_0127239
599 Ga0496108_0044640
600 Ga0496108_0113734
601 Ga0496109_0006568
602 Ga0496109_0035919
603 Ga0496109_0452249
604 Ga0496109_0761653
605 Ga0496110_0004628
606 Ga0496110_0248672
607 Ga0496110_0257711
608 Ga0496111_0003051
609 Ga0496111_0013643
610 Ga0496111_0019926
611 Ga0496111_0358878
612 Ga0496111_0493846
613 Ga0496112_0019327
614 Ga0496112_0021949
615 Ga0496112_0089855
616 Ga0496112_1226199
617 Ga0496113_0001932
618 Ga0496113_0262154
619 Ga0496114_0019329
620 Ga0496114_0043108
621 Ga0496114_0763101
622 Ga0496115_0003888
623 Ga0496115_0007841
624 Ga0496115_0014417
625 Ga0501036_0228246
626 Ga0501039_0216227
627 Ga0501040_0080027
628 Ga0501041_0259305
629 Ga0501042_0235990
630 Ga0501043_0596198
631 Ga0501047_0187762
632 Ga0501047_0315265
633 Ga0501048_0371417
634 Ga0501067_0277838
635 Ga0501071_0131919
636 Ga0501072_0235346
637 Ga0501074_0185426
638 Ga0501076_0233683
639 Ga0501076_0347978
640 Ga0501077_0125497
641 Ga0501081_0507999
642 nmdc:mga03683_144180_c1
643 nmdc:mga00v17_118314_c1
644 nmdc:mga0yw44_383836_c1
645 nmdc:mga0k408_305137_c1
646 nmdc:mga05p37_134338_c1
647 nmdc:mga05p37_482393_c1
648 nmdc:mga09592_185122_c1
649 nmdc:mga09592_37186_c1
650 nmdc:mga06r32_545298_c1
651 nmdc:mga08y16_764393_c1
652 nmdc:mga0n895_134052_c1
653 nmdc:mga0rr50_121336_c1
654 nmdc:mga0rr50_650293_c1
655 nmdc:mga08x19_27641_c1
656 nmdc:mga0a205_124580_c1
657 nmdc:mga0a205_861403_c1
658 Ga0495612_0098022
659 Ga0495595_0151823
660 Ga0495619_0053202
661 Ga0495619_0223276
662 Ga0501084_0117907
663 Ga0501084_0451166
664 Ga0501084_0649866
665 Ga0501082_0422648
666 Ga0501082_1283409

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

2

76

0.92

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

123

187

0.92

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

9

76

0.91

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

94

192

0.9

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

4

77

0.9

PF14497

GST_C_3

Glutathione S-transferase, C-terminal domain

102

194

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9691 2 199
3m3m-assembly1.cif.gz_A crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5] 0.9596 2 199
3m8n-assembly1.cif.gz_A crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9509 2 199
4hz2-assembly1.cif.gz_A crystal structure of glutathione s-transferase xaut_3756 (target efi-507152) from xanthobacter autotrophicus py2 0.9474 2 197
3m8n-assembly2.cif.gz_D crystal structure of a possible gutathione s-tranferase from rhodopseudomonas palustris 0.9471 2 197
ID Description Score Start End Superfamily
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9685 81 196 1.20.1050.10
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.968 81 196 1.20.1050.10
4hz2B02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9605 81 196 1.20.1050.10
3m3mA02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9597 81 196 1.20.1050.10
3m8nC02 Mainly Alpha;Up-down Bundle;Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2; 0.9399 83 196 1.20.1050.10
ID Description Score Start End GO Terms
AF-A0A7W0TRF7-F1-model_v4 Glutathione S-transferase family protein 0.9953 2 199 GO:0016740
AF-A0A538H0F7-F1-model_v4 Glutathione S-transferase family protein 0.9947 2 199 GO:0016740
AF-A0A7V9S0C6-F1-model_v4 Glutathione S-transferase family protein 0.9927 2 199 GO:0016740
AF-A0A538FWA9-F1-model_v4 Glutathione S-transferase family protein 0.9893 2 146 GO:0016740
AF-A0A7W0PX12-F1-model_v4 Glutathione S-transferase family protein 0.9856 1 118 GO:0016740

Map