F411267

General Info

Members Datasets Scaffolds Average Seq Length
333 174 328 246

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100283037|Ga0068867_1002830371
Length 245
Sequence MSTDVDVAARFAPTGTLRASINLGNPILAGRDARSGEPVGVSVDLARAFAQRLGVGIELVAFDTAIQSVQAVTDEKADIGFFAIDPLRGEGIAFTAAYVLIEGCYLVRDGSPIRANDEVDRAGRTVVVGKGSAYDLFLTRTLKQASIVRAPTSQAVVDTFIDGADVAAGVKQQLQADARRIGGVRLLEGRFMVIQQAMGMPKGRGAAAAAYLTRFVEEMKASGFVAAALKHHAIEGASVAPPAQP

Samples

Sample ID Description Type Environment
1 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
2 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
3 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
4 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
5 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
24 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
33 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
34 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
35 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
42 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
43 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
44 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
52 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
53 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
54 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
86 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
87 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
88 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
89 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
90 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
91 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
92 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
93 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
94 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
95 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
96 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
97 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
98 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
113 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
117 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
118 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
119 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
120 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
121 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
122 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
123 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
126 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
127 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
128 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
129 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
130 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
131 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
132 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
142 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
143 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
144 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
145 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
146 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
147 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
148 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
155 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
164 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
168 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
169 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
172 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
173 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
174 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.5
Metatranscriptomes 0
Isolates 1.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0.6
Rhizoplane 3
Rhizosphere 90.39
Stem 0
Stem Tuber 0
Unclassified 3.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001650 3300003215 Bacteria 13220
2 rootL2_10051643 3300003322 Bacteria 1750
3 Ga0055525_1000136 3300003759 Bacteria 107751
4 Ga0070658_10122253 3300005327 Bacteria 2164
5 Ga0070666_10013819 3300005335 Bacteria 5130
6 Ga0070680_100179780 3300005336 Bacteria 1782
7 Ga0070660_100163726 3300005339 Bacteria 1793
8 Ga0070669_100005552 3300005353 Bacteria 9109
9 Ga0070675_100180570 3300005354 Bacteria 1824
10 Ga0070659_100016850 3300005366 Bacteria 5490
11 Ga0070659_100061536 3300005366 Bacteria 2966
12 Ga0070667_100039828 3300005367 Bacteria 3939
13 Ga0070678_100161202 3300005456 Bacteria 1817
14 Ga0070678_100542345 3300005456 Bacteria 1031
15 Ga0070662_100025575 3300005457 Bacteria 4078
16 Ga0068867_100072128 3300005459 Bacteria 2584
17 Ga0068867_100283037 3300005459 Bacteria 1360
18 Ga0070672_100132306 3300005543 Bacteria 2051
19 Ga0068855_100157102 3300005563 Bacteria 2583
20 Ga0070664_100050453 3300005564 Bacteria 3521
21 Ga0070664_100196557 3300005564 Bacteria 1798
22 Ga0070664_100522505 3300005564 Bacteria 1096
23 Ga0070702_100548520 3300005615 Bacteria 858
24 Ga0068852_100219513 3300005616 Bacteria 1807
25 Ga0068859_100418676 3300005617 Bacteria 1436
26 Ga0068864_100032313 3300005618 Bacteria 4446
27 Ga0068864_100088639 3300005618 Bacteria 2725
28 Ga0068861_100360088 3300005719 Bacteria 1279
29 Ga0068863_100069178 3300005841 Bacteria 3338
30 Ga0068858_100018000 3300005842 Bacteria 6617
31 Ga0068860_100259521 3300005843 Bacteria 1693
32 Ga0068862_100010600 3300005844 Bacteria 7618
33 Ga0068862_100105584 3300005844 Bacteria 2468
34 Ga0068862_100694068 3300005844 Bacteria 985
35 Ga0075364_10385080 3300006051 Bacteria 956
36 Ga0068871_100453927 3300006358 Bacteria 1149
37 Ga0068865_100262730 3300006881 Bacteria 1367
38 Ga0097620_100418671 3300006931 Bacteria 1436
39 Ga0111539_10548456 3300009094 Bacteria 1347
40 Ga0105243_10084395 3300009148 Bacteria 2601
41 Ga0105241_10004719 3300009174 Bacteria 10050
42 Ga0105242_10012297 3300009176 Bacteria 6587
43 Ga0105242_10035179 3300009176 Bacteria 4017
44 Ga0105248_10098096 3300009177 Bacteria 3301
45 Ga0105248_10658898 3300009177 Bacteria 1181
46 Ga0105249_10039012 3300009553 Bacteria 4311
47 Ga0105239_10474003 3300010375 Bacteria 1422
48 Ga0105246_10206705 3300011119 Bacteria 1530
49 Ga0157378_10181953 3300013297 Bacteria 1978
50 Ga0157375_10202626 3300013308 Bacteria 2140
51 Ga0157380_10062543 3300014326 Bacteria 2982
52 Ga0157377_10156113 3300014745 Bacteria 1415
53 Ga0157379_10107081 3300014968 Bacteria 2510
54 Ga0163161_10030108 3300017792 Bacteria 3861
55 Ga0209563_100003 3300025230 Bacteria 1932942
56 Ga0209026_1005301 3300025250 Bacteria 3505
57 Ga0209148_1002162 3300025254 Bacteria 7296
58 Ga0209758_1000057 3300025297 Bacteria 333111
59 Ga0207642_10106562 3300025899 Bacteria 1419
60 Ga0207680_10049646 3300025903 Bacteria 2498
61 Ga0207645_10007770 3300025907 Bacteria 7547
62 Ga0207705_10016533 3300025909 Bacteria 5286
63 Ga0207671_10074364 3300025914 Bacteria 2539
64 Ga0207662_10019648 3300025918 Bacteria 3848
65 Ga0207657_10005341 3300025919 Bacteria 13458
66 Ga0207690_10230571 3300025932 Bacteria 1421
67 Ga0207706_10278475 3300025933 Bacteria 1459
68 Ga0207709_10146660 3300025935 Bacteria 1629
69 Ga0207670_10444349 3300025936 Bacteria 1044
70 Ga0207669_10164527 3300025937 Bacteria 1571
71 Ga0207704_10060952 3300025938 Bacteria 2337
72 Ga0207711_10044974 3300025941 Bacteria 3772
73 Ga0207689_10002329 3300025942 Bacteria 17782
74 Ga0207679_10182522 3300025945 Bacteria 1737
75 Ga0207679_10477979 3300025945 Bacteria 1109
76 Ga0207667_10001769 3300025949 Bacteria 27197
77 Ga0207667_10331716 3300025949 Bacteria 1553
78 Ga0207712_10273302 3300025961 Bacteria 1376
79 Ga0207703_10017801 3300026035 Bacteria 5548
80 Ga0207639_10225472 3300026041 Bacteria 1621
81 Ga0207678_10044274 3300026067 Bacteria 3850
82 Ga0207708_10025051 3300026075 Bacteria 4513
83 Ga0207641_10183603 3300026088 Bacteria 1917
84 Ga0207641_10209342 3300026088 Bacteria 1803
85 Ga0207648_10100968 3300026089 Bacteria 2528
86 Ga0207676_10658281 3300026095 Bacteria 1011
87 Ga0207675_100019458 3300026118 Bacteria 6334
88 Ga0207675_100252563 3300026118 Bacteria 1707
89 Ga0207683_10086154 3300026121 Bacteria 2792
90 Ga0207683_10518623 3300026121 Bacteria 1101
91 Ga0209371_1003053 3300027312 Bacteria 8602
92 Ga0268266_10227725 3300028379 Bacteria 1716
93 Ga0268265_10015545 3300028380 Bacteria 5211
94 Ga0268265_10301381 3300028380 Bacteria 1443
95 Ga0268264_10057198 3300028381 Bacteria 3261
96 Ga0268256_1005177 3300030500 Bacteria 5182
97 Ga0307509_10167717 3300031507 Bacteria 2081
98 Ga0395899_0001309 3300037312 Bacteria 21492
99 Ga0395899_0002258 3300037312 Bacteria 15756
100 Ga0395899_0005125 3300037312 Bacteria 10199
101 Ga0395899_0036242 3300037312 Bacteria 3701
102 Ga0395899_0046924 3300037312 Bacteria 3216
103 Ga0395899_0139162 3300037312 Bacteria 1728
104 Ga0395899_0174830 3300037312 Bacteria 1510
105 Ga0395899_0394191 3300037312 Bacteria 917
106 Ga0395899_0394768 3300037312 Bacteria 917
107 Ga0395900_0000331 3300037418 Bacteria 69780
108 Ga0395900_0000525 3300037418 Bacteria 54176
109 Ga0395900_0004299 3300037418 Bacteria 15101
110 Ga0395900_0004426 3300037418 Bacteria 14897
111 Ga0395900_0005768 3300037418 Bacteria 12937
112 Ga0395900_0056845 3300037418 Bacteria 4027
113 Ga0395900_0177127 3300037418 Bacteria 2168
114 Ga0395900_0234985 3300037418 Bacteria 1841
115 Ga0395900_0235959 3300037418 Bacteria 1837
116 Ga0395900_0253650 3300037418 Bacteria 1759
117 Ga0395900_0728440 3300037418 Bacteria 923
118 Ga0395898_0006313 3300037466 Bacteria 12665
119 Ga0395898_0008744 3300037466 Bacteria 10679
120 Ga0395898_0084994 3300037466 Bacteria 3050
121 Ga0395898_0115292 3300037466 Bacteria 2574
122 Ga0395898_0166135 3300037466 Bacteria 2111
123 Ga0395898_0442943 3300037466 Bacteria 1237
124 Ga0395905_0033698 3300037471 Bacteria 4810
125 Ga0395905_0045475 3300037471 Bacteria 4117
126 Ga0395905_0137752 3300037471 Bacteria 2296
127 Ga0395905_0228401 3300037471 Bacteria 1740
128 Ga0395905_0922575 3300037471 Bacteria 776
129 Ga0395901_0000097 3300038443 Bacteria 118528
130 Ga0395901_0003993 3300038443 Bacteria 14853
131 Ga0395901_0004247 3300038443 Bacteria 14453
132 Ga0395901_0004298 3300038443 Bacteria 14368
133 Ga0395901_0016593 3300038443 Bacteria 7505
134 Ga0395901_0068829 3300038443 Bacteria 3687
135 Ga0395901_0103492 3300038443 Bacteria 2987
136 Ga0395901_0388752 3300038443 Bacteria 1435
137 Ga0395901_0500919 3300038443 Bacteria 1236
138 Ga0395901_0699902 3300038443 Bacteria 1011
139 Ga0395901_0781883 3300038443 Bacteria 945
140 Ga0395901_0939425 3300038443 Bacteria 844
141 Ga0439448_0002995 3300042005 Bacteria 4637
142 Ga0439450_003714 3300042008 Bacteria 2551
143 Ga0466969_0006380 3300044656 Bacteria 6275
144 Ga0466969_0043793 3300044656 Bacteria 2229
145 Ga0466972_0033947 3300044658 Bacteria 2502
146 Ga0466972_0178770 3300044658 Bacteria 995
147 Ga0466965_0008865 3300044683 Bacteria 4663
148 Ga0466966_0008840 3300044684 Bacteria 6669
149 Ga0466966_0047506 3300044684 Bacteria 2736
150 Ga0466966_0102255 3300044684 Bacteria 1771
151 Ga0466966_0137055 3300044684 Bacteria 1496
152 Ga0466961_0012272 3300044693 Bacteria 5478
153 Ga0466961_0036100 3300044693 Bacteria 3172
154 Ga0466963_0068882 3300044694 Bacteria 2377
155 Ga0466963_0109516 3300044694 Bacteria 1895
156 Ga0466963_0217756 3300044694 Bacteria 1337
157 Ga0466964_0001672 3300044706 Bacteria 7657
158 Ga0466964_0011662 3300044706 Bacteria 3323
159 Ga0466971_0028848 3300044719 Bacteria 2481
160 Ga0466971_0093817 3300044719 Bacteria 1375
161 Ga0466968_0001067 3300044735 Bacteria 9701
162 Ga0466970_0087181 3300044765 Bacteria 1692
163 Ga0466970_0225408 3300044765 Bacteria 1047
164 Ga0466957_0000010 3300044842 Bacteria 75391
165 Ga0466957_0023842 3300044842 Bacteria 3619
166 Ga0466957_0111620 3300044842 Bacteria 1734
167 Ga0466957_0126252 3300044842 Bacteria 1635
168 Ga0466960_0226827 3300044901 Bacteria 1030
169 Ga0466959_0006324 3300045049 Bacteria 8192
170 Ga0466959_0106994 3300045049 Bacteria 1999
171 Ga0466958_0007860 3300045836 Bacteria 5891
172 Ga0466958_0046704 3300045836 Bacteria 2613
173 Ga0466967_0009854 3300045976 Bacteria 7123
174 Ga0466967_0542798 3300045976 Bacteria 1144
175 Ga0466967_0610375 3300045976 Bacteria 1077
176 Ga0495617_009587 3300046452 Bacteria 3322
177 Ga0495603_0220064 3300046455 Bacteria 1096
178 Ga0495590_0009654 3300046457 Bacteria 3659
179 Ga0495638_0167345 3300046460 Bacteria 1264
180 Ga0495653_0012104 3300046463 Bacteria 7039
181 Ga0495650_0000001 3300046471 Bacteria 1085492
182 Ga0495650_0083744 3300046471 Bacteria 1225
183 Ga0495605_0000056 3300046474 Bacteria 155610
184 Ga0495605_0003528 3300046474 Bacteria 9283
185 Ga0495639_0006172 3300046475 Bacteria 5144
186 Ga0495584_0000618 3300046491 Bacteria 23785
187 Ga0495584_0005348 3300046491 Bacteria 6804
188 Ga0495584_0019839 3300046491 Bacteria 3415
189 Ga0495584_0068524 3300046491 Bacteria 1782
190 Ga0495585_0000002 3300046492 Bacteria 529316
191 Ga0495585_0000048 3300046492 Bacteria 120031
192 Ga0495585_0001020 3300046492 Bacteria 23305
193 Ga0495585_0001560 3300046492 Bacteria 17783
194 Ga0495585_0018030 3300046492 Bacteria 4073
195 Ga0495585_0098804 3300046492 Bacteria 1563
196 Ga0495594_0003614 3300046499 Bacteria 7952
197 Ga0495594_0044549 3300046499 Bacteria 2434
198 Ga0495596_0000284 3300046500 Bacteria 33837
199 Ga0495596_0001989 3300046500 Bacteria 11251
200 Ga0495596_0003025 3300046500 Bacteria 8705
201 Ga0495596_0077973 3300046500 Bacteria 1286
202 Ga0495607_0000096 3300046501 Bacteria 92031
203 Ga0495607_0000907 3300046501 Bacteria 27596
204 Ga0495607_0052684 3300046501 Bacteria 2355
205 Ga0495607_0057304 3300046501 Bacteria 2233
206 Ga0495583_0000416 3300046506 Bacteria 64790
207 Ga0495583_0025193 3300046506 Bacteria 2976
208 Ga0495583_0076119 3300046506 Bacteria 1466
209 Ga0495583_0123420 3300046506 Bacteria 1088
210 Ga0495606_0005988 3300046507 Bacteria 11398
211 Ga0495606_0028433 3300046507 Bacteria 3945
212 Ga0495606_0081598 3300046507 Bacteria 2010
213 Ga0495616_0000020 3300046513 Bacteria 162840
214 Ga0495616_0000330 3300046513 Bacteria 37446
215 Ga0495616_0000570 3300046513 Bacteria 27850
216 Ga0495616_0067278 3300046513 Bacteria 1742
217 Ga0495616_0083531 3300046513 Bacteria 1523
218 Ga0495616_0116973 3300046513 Bacteria 1233
219 Ga0495631_0016728 3300046518 Bacteria 3487
220 Ga0495631_0022527 3300046518 Bacteria 2928
221 Ga0495631_0023333 3300046518 Bacteria 2868
222 Ga0495631_0034628 3300046518 Bacteria 2263
223 Ga0495631_0049750 3300046518 Bacteria 1834
224 Ga0495631_0059101 3300046518 Bacteria 1666
225 Ga0495631_0065335 3300046518 Bacteria 1574
226 Ga0495631_0154930 3300046518 Bacteria 983
227 Ga0495632_0000194 3300046519 Bacteria 61534
228 Ga0495632_0001578 3300046519 Bacteria 18803
229 Ga0495632_0131855 3300046519 Bacteria 1162
230 Ga0495643_0000455 3300046522 Bacteria 52002
231 Ga0495643_0000757 3300046522 Bacteria 36364
232 Ga0495643_0005379 3300046522 Bacteria 8663
233 Ga0495643_0009089 3300046522 Bacteria 6226
234 Ga0495643_0029509 3300046522 Bacteria 3068
235 Ga0495648_0000012 3300046524 Bacteria 294111
236 Ga0495648_0012142 3300046524 Bacteria 6446
237 Ga0495648_0017817 3300046524 Bacteria 5063
238 Ga0495648_0073219 3300046524 Bacteria 1979
239 Ga0495666_0004600 3300046526 Bacteria 6976
240 Ga0495642_0000622 3300046528 Bacteria 17808
241 Ga0495642_0001651 3300046528 Bacteria 9675
242 Ga0495642_0015280 3300046528 Bacteria 2982
243 Ga0495642_0054135 3300046528 Bacteria 1654
244 Ga0495654_0002915 3300046530 Bacteria 10729
245 Ga0495640_0087542 3300046533 Bacteria 2060
246 Ga0495587_0041831 3300046536 Bacteria 2734
247 Ga0495609_0002117 3300046538 Bacteria 12475
248 Ga0495609_0006820 3300046538 Bacteria 5773
249 Ga0495621_0076583 3300046539 Bacteria 1241
250 Ga0495597_0000485 3300046542 Bacteria 33280
251 Ga0495597_0031209 3300046542 Bacteria 2426
252 Ga0495645_0051036 3300046543 Bacteria 3010
253 Ga0495668_0004624 3300046616 Bacteria 9674
254 Ga0495611_0000789 3300046648 Bacteria 17615
255 Ga0495611_0003086 3300046648 Bacteria 7397
256 Ga0495611_0052955 3300046648 Bacteria 1831
257 Ga0495625_0099086 3300046660 Bacteria 2004
258 Ga0495625_0270198 3300046660 Bacteria 1097
259 Ga0495661_0000916 3300046665 Bacteria 27044
260 Ga0495661_0005642 3300046665 Bacteria 8873
261 Ga0495661_0007873 3300046665 Bacteria 7405
262 Ga0495661_0028372 3300046665 Bacteria 3583
263 Ga0495661_0143022 3300046665 Bacteria 1299
264 Ga0495661_0204762 3300046665 Bacteria 1031
265 Ga0495661_0324865 3300046665 Bacteria 764
266 Ga0495588_0000062 3300046674 Bacteria 253674
267 Ga0495588_0000933 3300046674 Bacteria 12731
268 Ga0495588_0147045 3300046674 Bacteria 1245
269 Ga0495669_0000494 3300046684 Bacteria 18154
270 Ga0495669_0001233 3300046684 Bacteria 10620
271 Ga0495669_0075459 3300046684 Bacteria 1542
272 Ga0495670_0018447 3300046691 Bacteria 3434
273 Ga0495649_0090737 3300046694 Bacteria 1629
274 Ga0495589_0000154 3300046794 Bacteria 63333
275 Ga0495589_0000159 3300046794 Bacteria 62290
276 Ga0495660_0000055 3300046810 Bacteria 134615
277 Ga0495660_0001651 3300046810 Bacteria 14957
278 Ga0495660_0164757 3300046810 Bacteria 1084
279 Ga0495604_0031477 3300047317 Bacteria 4207
280 Ga0495672_0015366 3300047320 Bacteria 5200
281 Ga0495676_0000030 3300047321 Bacteria 133637
282 Ga0495680_0203010 3300047322 Bacteria 1421
283 Ga0495683_0003523 3300047323 Bacteria 9110
284 Ga0495683_0005867 3300047323 Bacteria 6750
285 Ga0495687_000016 3300047443 Bacteria 359237
286 Ga0495687_000030 3300047443 Bacteria 279992
287 Ga0495687_002549 3300047443 Bacteria 14413
288 Ga0495687_007402 3300047443 Bacteria 6469
289 Ga0495687_054577 3300047443 Bacteria 1676
290 Ga0495687_081387 3300047443 Bacteria 1267
291 Ga0495677_0002103 3300047445 Bacteria 7919
292 Ga0495677_0006505 3300047445 Bacteria 4414
293 Ga0495677_0031291 3300047445 Bacteria 1937
294 Ga0495677_0036184 3300047445 Bacteria 1802
295 Ga0495677_0045031 3300047445 Bacteria 1618
296 Ga0495677_0080886 3300047445 Bacteria 1218
297 Ga0495681_0001897 3300047470 Bacteria 15348
298 Ga0495681_0050902 3300047470 Bacteria 1950
299 Ga0495602_0166367 3300048088 Bacteria 1716
300 Ga0495626_0000053 3300048091 Bacteria 155543
301 Ga0495626_0000412 3300048091 Bacteria 43929
302 Ga0495626_0001342 3300048091 Bacteria 19900
303 Ga0495626_0002444 3300048091 Bacteria 12897
304 Ga0495626_0009024 3300048091 Bacteria 5407
305 Ga0495626_0012228 3300048091 Bacteria 4506
306 Ga0496101_0669767 3300048904 Bacteria 820
307 Ga0496102_0131005 3300048905 Bacteria 2347
308 Ga0496103_0109491 3300048906 Bacteria 1754
309 Ga0496105_0209404 3300048908 Bacteria 1590
310 Ga0496105_0348033 3300048908 Bacteria 1184
311 Ga0496106_0041051 3300048909 Bacteria 3466
312 Ga0496107_0022784 3300048910 Bacteria 4427
313 Ga0496110_0584347 3300048913 Bacteria 1014
314 Ga0496113_0000677 3300048916 Bacteria 17325
315 Ga0496115_0334975 3300048918 Bacteria 1236
316 Ga0496122_0001426 3300048925 Bacteria 38722
317 Ga0496122_0063089 3300048925 Bacteria 2707
318 Ga0496123_0049607 3300048926 Bacteria 2812
319 Ga0496123_0237857 3300048926 Bacteria 906
320 Ga0496124_0002290 3300048927 Bacteria 25312
321 Ga0496124_0076886 3300048927 Bacteria 2754
322 Ga0496124_0088147 3300048927 Bacteria 2537
323 Ga0496125_0045004 3300048928 Bacteria 3722
324 nmdc:mga00v17_8406_c1 3300050491 Bacteria 5555
325 nmdc:mga0a205_648538_c1 3300050515 Bacteria 907
326 Ga0500651_0295919 3300053093 Bacteria 930
327 Ga0466962_0024489 3300061719 Bacteria 2899
328 Ga0466962_0030575 3300061719 Bacteria 2579

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044656 Ga0466969_0043793 Ga0466969_0043793_279_983 234
2 3300044765 Ga0466970_0225408 Ga0466970_0225408_102_806 234
3 3300046507 Ga0495606_0028433 Ga0495606_0028433_1253_1987 234
4 3300046542 Ga0495597_0000485 Ga0495597_0000485_12151_12885 234
5 3300046794 Ga0495589_0000159 Ga0495589_0000159_48913_49647 234
6 3300003322 rootL2_10051643 rootL2_100516432 235
7 3300037312 Ga0395899_0139162 Ga0395899_0139162_414_1121 235
8 3300037418 Ga0395900_0235959 Ga0395900_0235959_707_1414 235
9 3300037471 Ga0395905_0228401 Ga0395905_0228401_809_1516 235
10 3300037471 Ga0395905_0922575 Ga0395905_0922575_48_755 235
11 3300044684 Ga0466966_0137055 Ga0466966_0137055_96_803 235
12 3300044842 Ga0466957_0126252 Ga0466957_0126252_311_1018 235
13 3300046457 Ga0495590_0009654 Ga0495590_0009654_2176_2883 235
14 3300046474 Ga0495605_0000056 Ga0495605_0000056_147085_147792 235
15 3300046501 Ga0495607_0052684 Ga0495607_0052684_842_1549 235
16 3300046513 Ga0495616_0000570 Ga0495616_0000570_6179_6913 235
17 3300046519 Ga0495632_0131855 Ga0495632_0131855_313_1020 235
18 3300046522 Ga0495643_0005379 Ga0495643_0005379_5684_6391 235
19 3300046528 Ga0495642_0001651 Ga0495642_0001651_7544_8251 235
20 3300046694 Ga0495649_0090737 Ga0495649_0090737_170_877 235
21 3300046794 Ga0495589_0000154 Ga0495589_0000154_7627_8334 235
22 3300046810 Ga0495660_0000055 Ga0495660_0000055_7627_8334 235
23 3300046810 Ga0495660_0164757 Ga0495660_0164757_34_741 235
24 3300047320 Ga0495672_0015366 Ga0495672_0015366_1286_1993 235
25 3300047443 Ga0495687_002549 Ga0495687_002549_5684_6391 235
26 3300047443 Ga0495687_054577 Ga0495687_054577_45_779 235
27 3300047445 Ga0495677_0002103 Ga0495677_0002103_5965_6672 235
28 3300048091 Ga0495626_0000053 Ga0495626_0000053_147210_147917 235
29 3300048927 Ga0496124_0076886 Ga0496124_0076886_544_1251 235
30 3300044658 Ga0466972_0033947 Ga0466972_0033947_1136_1867 236
31 3300044706 Ga0466964_0011662 Ga0466964_0011662_1158_1889 236
32 3300044735 Ga0466968_0001067 Ga0466968_0001067_7583_8314 236
33 3300044842 Ga0466957_0111620 Ga0466957_0111620_503_1234 236
34 3300046522 Ga0495643_0000455 Ga0495643_0000455_11630_12364 236
35 3300037312 Ga0395899_0174830 Ga0395899_0174830_660_1373 237
36 3300037312 Ga0395899_0394191 Ga0395899_0394191_78_791 237
37 3300037418 Ga0395900_0234985 Ga0395900_0234985_1033_1746 237
38 3300045049 Ga0466959_0006324 Ga0466959_0006324_6340_7056 237
39 3300046507 Ga0495606_0005988 Ga0495606_0005988_3878_4591 237
40 3300046665 Ga0495661_0028372 Ga0495661_0028372_1753_2466 237
41 3300047443 Ga0495687_000016 Ga0495687_000016_103368_104081 237
42 3300048904 Ga0496101_0669767 Ga0496101_0669767_70_783 237
43 3300048909 Ga0496106_0041051 Ga0496106_0041051_2462_3175 237
44 3300048910 Ga0496107_0022784 Ga0496107_0022784_3478_4191 237
45 3300048925 Ga0496122_0063089 Ga0496122_0063089_1002_1715 237
46 3300048926 Ga0496123_0049607 Ga0496123_0049607_967_1680 237
47 3300053093 Ga0500651_0295919 Ga0500651_0295919_130_843 237
48 3300025949 Ga0207667_10001769 Ga0207667_1000176915 238
49 3300037418 Ga0395900_0728440 Ga0395900_0728440_41_772 238
50 3300038443 Ga0395901_0699902 Ga0395901_0699902_202_933 238
51 3300046500 Ga0495596_0003025 Ga0495596_0003025_4407_5156 240
52 3300046648 Ga0495611_0003086 Ga0495611_0003086_685_1434 240
53 3300046684 Ga0495669_0075459 Ga0495669_0075459_719_1468 240
54 iso_pu_bacteria 2808606418 2809142807 240
55 3300037466 Ga0395898_0084994 Ga0395898_0084994_1329_2054 241
56 3300038443 Ga0395901_0016593 Ga0395901_0016593_5466_6191 241
57 3300038443 Ga0395901_0781883 Ga0395901_0781883_39_764 241
58 3300046518 Ga0495631_0049750 Ga0495631_0049750_519_1268 241
59 3300046528 Ga0495642_0054135 Ga0495642_0054135_508_1257 241
60 3300046691 Ga0495670_0018447 Ga0495670_0018447_2001_2726 241
61 3300047470 Ga0495681_0050902 Ga0495681_0050902_874_1623 241
62 3300003759 Ga0055525_1000136 Ga0055525_10001362 242
63 3300005336 Ga0070680_100179780 Ga0070680_1001797802 242
64 3300005339 Ga0070660_100163726 Ga0070660_1001637262 242
65 3300005366 Ga0070659_100016850 Ga0070659_1000168503 242
66 3300005366 Ga0070659_100061536 Ga0070659_1000615362 242
67 3300005457 Ga0070662_100025575 Ga0070662_1000255752 242
68 3300005563 Ga0068855_100157102 Ga0068855_1001571023 242
69 3300005564 Ga0070664_100050453 Ga0070664_1000504532 242
70 3300013297 Ga0157378_10181953 Ga0157378_101819532 242
71 3300025230 Ga0209563_100003 Ga0209563_1000031688 242
72 3300025250 Ga0209026_1005301 Ga0209026_10053012 242
73 3300025919 Ga0207657_10005341 Ga0207657_100053416 242
74 3300025932 Ga0207690_10230571 Ga0207690_102305712 242
75 3300025949 Ga0207667_10331716 Ga0207667_103317162 242
76 3300037312 Ga0395899_0046924 Ga0395899_0046924_658_1386 242
77 3300037312 Ga0395899_0394768 Ga0395899_0394768_141_872 242
78 3300037418 Ga0395900_0000525 Ga0395900_0000525_7871_8599 242
79 3300037418 Ga0395900_0056845 Ga0395900_0056845_1180_1911 242
80 3300037466 Ga0395898_0442943 Ga0395898_0442943_232_963 242
81 3300038443 Ga0395901_0500919 Ga0395901_0500919_385_1113 242
82 3300044658 Ga0466972_0178770 Ga0466972_0178770_41_769 242
83 3300044684 Ga0466966_0047506 Ga0466966_0047506_168_896 242
84 3300044693 Ga0466961_0036100 Ga0466961_0036100_2406_3134 242
85 3300048905 Ga0496102_0131005 Ga0496102_0131005_281_1012 242
86 3300048906 Ga0496103_0109491 Ga0496103_0109491_355_1089 242
87 3300048916 Ga0496113_0000677 Ga0496113_0000677_16531_17259 242
88 3300048925 Ga0496122_0001426 Ga0496122_0001426_36798_37526 242
89 3300048926 Ga0496123_0237857 Ga0496123_0237857_24_752 242
90 3300048928 Ga0496125_0045004 Ga0496125_0045004_2368_3096 242
91 3300005564 Ga0070664_100196557 Ga0070664_1001965572 243
92 3300006358 Ga0068871_100453927 Ga0068871_1004539271 243
93 3300025945 Ga0207679_10182522 Ga0207679_101825221 243
94 3300037312 Ga0395899_0005125 Ga0395899_0005125_1888_2619 243
95 3300037312 Ga0395899_0036242 Ga0395899_0036242_1123_1854 243
96 3300037418 Ga0395900_0177127 Ga0395900_0177127_156_887 243
97 3300037418 Ga0395900_0253650 Ga0395900_0253650_887_1618 243
98 3300037466 Ga0395898_0166135 Ga0395898_0166135_58_789 243
99 3300037471 Ga0395905_0137752 Ga0395905_0137752_274_1005 243
100 3300038443 Ga0395901_0068829 Ga0395901_0068829_2893_3624 243
101 3300044684 Ga0466966_0008840 Ga0466966_0008840_1790_2521 243
102 3300044706 Ga0466964_0001672 Ga0466964_0001672_5509_6240 243
103 3300044842 Ga0466957_0000010 Ga0466957_0000010_290_1021 243
104 3300045049 Ga0466959_0106994 Ga0466959_0106994_967_1698 243
105 3300045976 Ga0466967_0009854 Ga0466967_0009854_5787_6518 243
106 3300046460 Ga0495638_0167345 Ga0495638_0167345_149_880 243
107 3300046491 Ga0495584_0068524 Ga0495584_0068524_329_1060 243
108 3300046492 Ga0495585_0018030 Ga0495585_0018030_483_1214 243
109 3300046500 Ga0495596_0077973 Ga0495596_0077973_176_907 243
110 3300046501 Ga0495607_0057304 Ga0495607_0057304_430_1161 243
111 3300046506 Ga0495583_0000416 Ga0495583_0000416_26133_26864 243
112 3300046506 Ga0495583_0123420 Ga0495583_0123420_82_813 243
113 3300046513 Ga0495616_0067278 Ga0495616_0067278_814_1545 243
114 3300046518 Ga0495631_0023333 Ga0495631_0023333_1094_1825 243
115 3300046648 Ga0495611_0052955 Ga0495611_0052955_827_1558 243
116 3300046665 Ga0495661_0324865 Ga0495661_0324865_14_745 243
117 3300047323 Ga0495683_0005867 Ga0495683_0005867_3477_4208 243
118 3300047443 Ga0495687_081387 Ga0495687_081387_18_749 243
119 3300047445 Ga0495677_0031291 Ga0495677_0031291_47_778 243
120 3300047470 Ga0495681_0001897 Ga0495681_0001897_13790_14521 243
121 3300048091 Ga0495626_0002444 Ga0495626_0002444_10729_11460 243
122 3300009174 Ga0105241_10004719 Ga0105241_100047198 244
123 3300009176 Ga0105242_10012297 Ga0105242_100122974 244
124 3300010375 Ga0105239_10474003 Ga0105239_104740032 244
125 3300011119 Ga0105246_10206705 Ga0105246_102067051 244
126 3300025909 Ga0207705_10016533 Ga0207705_100165332 244
127 3300025914 Ga0207671_10074364 Ga0207671_100743642 244
128 3300031507 Ga0307509_10167717 Ga0307509_101677172 244
129 3300037312 Ga0395899_0002258 Ga0395899_0002258_11310_12050 244
130 3300037418 Ga0395900_0000331 Ga0395900_0000331_9073_9810 244
131 3300037418 Ga0395900_0004299 Ga0395900_0004299_2095_2835 244
132 3300037418 Ga0395900_0005768 Ga0395900_0005768_11309_12097 244
133 3300037466 Ga0395898_0006313 Ga0395898_0006313_1206_1946 244
134 3300037466 Ga0395898_0115292 Ga0395898_0115292_543_1331 244
135 3300037471 Ga0395905_0033698 Ga0395905_0033698_1260_2000 244
136 3300038443 Ga0395901_0000097 Ga0395901_0000097_42701_43438 244
137 3300038443 Ga0395901_0004247 Ga0395901_0004247_446_1186 244
138 3300038443 Ga0395901_0004298 Ga0395901_0004298_5411_6199 244
139 3300038443 Ga0395901_0388752 Ga0395901_0388752_633_1367 244
140 3300038443 Ga0395901_0939425 Ga0395901_0939425_22_762 244
141 3300044684 Ga0466966_0102255 Ga0466966_0102255_710_1444 244
142 3300044694 Ga0466963_0109516 Ga0466963_0109516_971_1705 244
143 3300044719 Ga0466971_0093817 Ga0466971_0093817_207_941 244
144 3300044901 Ga0466960_0226827 Ga0466960_0226827_219_953 244
145 3300045836 Ga0466958_0007860 Ga0466958_0007860_446_1186 244
146 3300045976 Ga0466967_0542798 Ga0466967_0542798_95_829 244
147 3300046452 Ga0495617_009587 Ga0495617_009587_175_915 244
148 3300046463 Ga0495653_0012104 Ga0495653_0012104_4940_5674 244
149 3300046471 Ga0495650_0083744 Ga0495650_0083744_137_871 244
150 3300046474 Ga0495605_0003528 Ga0495605_0003528_3781_4515 244
151 3300046491 Ga0495584_0000618 Ga0495584_0000618_5480_6220 244
152 3300046491 Ga0495584_0005348 Ga0495584_0005348_3003_3791 244
153 3300046491 Ga0495584_0019839 Ga0495584_0019839_2032_2778 244
154 3300046492 Ga0495585_0000002 Ga0495585_0000002_500573_501313 244
155 3300046492 Ga0495585_0000048 Ga0495585_0000048_103157_103900 244
156 3300046492 Ga0495585_0001020 Ga0495585_0001020_15508_16242 244
157 3300046492 Ga0495585_0001560 Ga0495585_0001560_6441_7181 244
158 3300046492 Ga0495585_0098804 Ga0495585_0098804_729_1463 244
159 3300046499 Ga0495594_0003614 Ga0495594_0003614_5884_6618 244
160 3300046500 Ga0495596_0000284 Ga0495596_0000284_20577_21365 244
161 3300046500 Ga0495596_0001989 Ga0495596_0001989_5265_6011 244
162 3300046501 Ga0495607_0000096 Ga0495607_0000096_52373_53107 244
163 3300046501 Ga0495607_0000907 Ga0495607_0000907_23902_24636 244
164 3300046506 Ga0495583_0025193 Ga0495583_0025193_1482_2216 244
165 3300046506 Ga0495583_0076119 Ga0495583_0076119_159_947 244
166 3300046507 Ga0495606_0081598 Ga0495606_0081598_455_1195 244
167 3300046513 Ga0495616_0000020 Ga0495616_0000020_115788_116522 244
168 3300046513 Ga0495616_0000330 Ga0495616_0000330_4339_5079 244
169 3300046513 Ga0495616_0083531 Ga0495616_0083531_195_929 244
170 3300046513 Ga0495616_0116973 Ga0495616_0116973_272_1006 244
171 3300046518 Ga0495631_0016728 Ga0495631_0016728_411_1151 244
172 3300046518 Ga0495631_0022527 Ga0495631_0022527_1631_2365 244
173 3300046518 Ga0495631_0034628 Ga0495631_0034628_1084_1872 244
174 3300046518 Ga0495631_0059101 Ga0495631_0059101_139_873 244
175 3300046518 Ga0495631_0065335 Ga0495631_0065335_674_1420 244
176 3300046518 Ga0495631_0154930 Ga0495631_0154930_192_926 244
177 3300046519 Ga0495632_0000194 Ga0495632_0000194_28439_29173 244
178 3300046519 Ga0495632_0001578 Ga0495632_0001578_247_981 244
179 3300046522 Ga0495643_0000757 Ga0495643_0000757_33741_34475 244
180 3300046522 Ga0495643_0009089 Ga0495643_0009089_3087_3821 244
181 3300046522 Ga0495643_0029509 Ga0495643_0029509_2142_2876 244
182 3300046524 Ga0495648_0000012 Ga0495648_0000012_28004_28744 244
183 3300046524 Ga0495648_0012142 Ga0495648_0012142_5486_6220 244
184 3300046524 Ga0495648_0017817 Ga0495648_0017817_4162_4902 244
185 3300046524 Ga0495648_0073219 Ga0495648_0073219_1027_1761 244
186 3300046526 Ga0495666_0004600 Ga0495666_0004600_4449_5183 244
187 3300046528 Ga0495642_0000622 Ga0495642_0000622_10231_10965 244
188 3300046528 Ga0495642_0015280 Ga0495642_0015280_973_1761 244
189 3300046530 Ga0495654_0002915 Ga0495654_0002915_4156_4890 244
190 3300046533 Ga0495640_0087542 Ga0495640_0087542_1309_2043 244
191 3300046536 Ga0495587_0041831 Ga0495587_0041831_402_1136 244
192 3300046538 Ga0495609_0002117 Ga0495609_0002117_8681_9415 244
193 3300046538 Ga0495609_0006820 Ga0495609_0006820_3174_3908 244
194 3300046542 Ga0495597_0031209 Ga0495597_0031209_1194_1982 244
195 3300046543 Ga0495645_0051036 Ga0495645_0051036_289_1023 244
196 3300046616 Ga0495668_0004624 Ga0495668_0004624_149_937 244
197 3300046648 Ga0495611_0000789 Ga0495611_0000789_6441_7181 244
198 3300046660 Ga0495625_0099086 Ga0495625_0099086_809_1543 244
199 3300046660 Ga0495625_0270198 Ga0495625_0270198_128_862 244
200 3300046665 Ga0495661_0000916 Ga0495661_0000916_4742_5476 244
201 3300046665 Ga0495661_0005642 Ga0495661_0005642_3737_4471 244
202 3300046665 Ga0495661_0007873 Ga0495661_0007873_240_980 244
203 3300046665 Ga0495661_0143022 Ga0495661_0143022_541_1275 244
204 3300046665 Ga0495661_0204762 Ga0495661_0204762_145_879 244
205 3300046674 Ga0495588_0000062 Ga0495588_0000062_173122_173862 244
206 3300046674 Ga0495588_0000933 Ga0495588_0000933_10424_11158 244
207 3300046674 Ga0495588_0147045 Ga0495588_0147045_376_1110 244
208 3300046684 Ga0495669_0000494 Ga0495669_0000494_14782_15528 244
209 3300046684 Ga0495669_0001233 Ga0495669_0001233_5260_5994 244
210 3300046810 Ga0495660_0001651 Ga0495660_0001651_6010_6744 244
211 3300047317 Ga0495604_0031477 Ga0495604_0031477_2817_3551 244
212 3300047321 Ga0495676_0000030 Ga0495676_0000030_19157_19891 244
213 3300047322 Ga0495680_0203010 Ga0495680_0203010_616_1350 244
214 3300047323 Ga0495683_0003523 Ga0495683_0003523_2383_3123 244
215 3300047443 Ga0495687_000030 Ga0495687_000030_174479_175213 244
216 3300047443 Ga0495687_007402 Ga0495687_007402_2529_3263 244
217 3300047445 Ga0495677_0006505 Ga0495677_0006505_1963_2751 244
218 3300047445 Ga0495677_0036184 Ga0495677_0036184_651_1385 244
219 3300047445 Ga0495677_0045031 Ga0495677_0045031_820_1566 244
220 3300047445 Ga0495677_0080886 Ga0495677_0080886_453_1196 244
221 3300048088 Ga0495602_0166367 Ga0495602_0166367_904_1638 244
222 3300048091 Ga0495626_0000412 Ga0495626_0000412_37023_37757 244
223 3300048091 Ga0495626_0001342 Ga0495626_0001342_13313_14047 244
224 3300048091 Ga0495626_0009024 Ga0495626_0009024_4593_5339 244
225 3300048091 Ga0495626_0012228 Ga0495626_0012228_3690_4433 244
226 3300048908 Ga0496105_0209404 Ga0496105_0209404_359_1099 244
227 3300048908 Ga0496105_0348033 Ga0496105_0348033_395_1129 244
228 3300048918 Ga0496115_0334975 Ga0496115_0334975_252_986 244
229 3300048927 Ga0496124_0002290 Ga0496124_0002290_12626_13360 244
230 3300048927 Ga0496124_0088147 Ga0496124_0088147_1396_2136 244
231 3300061719 Ga0466962_0024489 Ga0466962_0024489_2111_2845 244
232 3300005459 Ga0068867_100283037 Ga0068867_1002830371 245
233 3300005844 Ga0068862_100105584 Ga0068862_1001055842 245
234 3300006881 Ga0068865_100262730 Ga0068865_1002627302 245
235 3300009148 Ga0105243_10084395 Ga0105243_100843952 245
236 3300009176 Ga0105242_10035179 Ga0105242_100351793 245
237 3300025935 Ga0207709_10146660 Ga0207709_101466602 245
238 3300026089 Ga0207648_10100968 Ga0207648_101009683 245
239 3300028380 Ga0268265_10301381 Ga0268265_103013812 245
240 3300037471 Ga0395905_0045475 Ga0395905_0045475_1482_2357 245
241 3300038443 Ga0395901_0103492 Ga0395901_0103492_352_1227 245
242 3300046475 Ga0495639_0006172 Ga0495639_0006172_1914_2654 246
243 3300046539 Ga0495621_0076583 Ga0495621_0076583_173_916 246
244 3300050515 nmdc:mga0a205_648538_c1 nmdc:mga0a205_648538_c1_57_797 246
245 iso_pu_bacteria 2537561587 2537873950 246
246 iso_pu_bacteria 2841859092 2841861647 246
247 iso_pu_bacteria 2842515876 2842518087 246
248 iso_pu_bacteria 2933011516 2933013716 246
249 3300005327 Ga0070658_10122253 Ga0070658_101222532 247
250 3300005564 Ga0070664_100522505 Ga0070664_1005225051 247
251 3300005618 Ga0068864_100032313 Ga0068864_1000323132 247
252 3300005719 Ga0068861_100360088 Ga0068861_1003600881 247
253 3300005844 Ga0068862_100694068 Ga0068862_1006940681 247
254 3300025254 Ga0209148_1002162 Ga0209148_10021623 247
255 3300025945 Ga0207679_10477979 Ga0207679_104779792 247
256 3300026088 Ga0207641_10209342 Ga0207641_102093423 247
257 3300026095 Ga0207676_10658281 Ga0207676_106582812 247
258 3300026118 Ga0207675_100252563 Ga0207675_1002525632 247
259 3300028380 Ga0268265_10015545 Ga0268265_100155455 247
260 3300037312 Ga0395899_0001309 Ga0395899_0001309_18751_19506 247
261 3300037418 Ga0395900_0004426 Ga0395900_0004426_12051_12806 247
262 3300037466 Ga0395898_0008744 Ga0395898_0008744_9714_10469 247
263 3300038443 Ga0395901_0003993 Ga0395901_0003993_12293_13048 247
264 3300042005 Ga0439448_0002995 Ga0439448_0002995_47_802 247
265 3300042008 Ga0439450_003714 Ga0439450_003714_177_932 247
266 3300044656 Ga0466969_0006380 Ga0466969_0006380_3175_3927 247
267 3300044683 Ga0466965_0008865 Ga0466965_0008865_2292_3044 247
268 3300044693 Ga0466961_0012272 Ga0466961_0012272_3138_3890 247
269 3300044694 Ga0466963_0068882 Ga0466963_0068882_875_1630 247
270 3300044694 Ga0466963_0217756 Ga0466963_0217756_234_986 247
271 3300044719 Ga0466971_0028848 Ga0466971_0028848_704_1456 247
272 3300044765 Ga0466970_0087181 Ga0466970_0087181_696_1448 247
273 3300044842 Ga0466957_0023842 Ga0466957_0023842_2608_3360 247
274 3300045836 Ga0466958_0046704 Ga0466958_0046704_89_841 247
275 3300045976 Ga0466967_0610375 Ga0466967_0610375_65_817 247
276 3300046471 Ga0495650_0000001 Ga0495650_0000001_443553_444305 247
277 3300046499 Ga0495594_0044549 Ga0495594_0044549_1605_2372 247
278 3300048913 Ga0496110_0584347 Ga0496110_0584347_88_837 247
279 3300061719 Ga0466962_0030575 Ga0466962_0030575_208_960 247
280 3300003215 JGI25153J46596_10001650 JGI25153J46596_1000165013 248
281 3300005335 Ga0070666_10013819 Ga0070666_100138195 248
282 3300005353 Ga0070669_100005552 Ga0070669_1000055526 248
283 3300005354 Ga0070675_100180570 Ga0070675_1001805702 248
284 3300005367 Ga0070667_100039828 Ga0070667_1000398282 248
285 3300005456 Ga0070678_100161202 Ga0070678_1001612022 248
286 3300005456 Ga0070678_100542345 Ga0070678_1005423451 248
287 3300005459 Ga0068867_100072128 Ga0068867_1000721283 248
288 3300005543 Ga0070672_100132306 Ga0070672_1001323062 248
289 3300005615 Ga0070702_100548520 Ga0070702_1005485201 248
290 3300005616 Ga0068852_100219513 Ga0068852_1002195132 248
291 3300005617 Ga0068859_100418676 Ga0068859_1004186762 248
292 3300005618 Ga0068864_100088639 Ga0068864_1000886393 248
293 3300005841 Ga0068863_100069178 Ga0068863_1000691784 248
294 3300005842 Ga0068858_100018000 Ga0068858_1000180007 248
295 3300005843 Ga0068860_100259521 Ga0068860_1002595212 248
296 3300005844 Ga0068862_100010600 Ga0068862_1000106004 248
297 3300006051 Ga0075364_10385080 Ga0075364_103850801 248
298 3300006931 Ga0097620_100418671 Ga0097620_1004186712 248
299 3300009094 Ga0111539_10548456 Ga0111539_105484562 248
300 3300009177 Ga0105248_10098096 Ga0105248_100980961 248
301 3300009177 Ga0105248_10658898 Ga0105248_106588981 248
302 3300009553 Ga0105249_10039012 Ga0105249_100390122 248
303 3300013308 Ga0157375_10202626 Ga0157375_102026262 248
304 3300014326 Ga0157380_10062543 Ga0157380_100625435 248
305 3300014745 Ga0157377_10156113 Ga0157377_101561132 248
306 3300014968 Ga0157379_10107081 Ga0157379_101070812 248
307 3300017792 Ga0163161_10030108 Ga0163161_100301082 248
308 3300025297 Ga0209758_1000057 Ga0209758_1000057235 248
309 3300025899 Ga0207642_10106562 Ga0207642_101065622 248
310 3300025903 Ga0207680_10049646 Ga0207680_100496463 248
311 3300025907 Ga0207645_10007770 Ga0207645_100077705 248
312 3300025918 Ga0207662_10019648 Ga0207662_100196485 248
313 3300025933 Ga0207706_10278475 Ga0207706_102784752 248
314 3300025936 Ga0207670_10444349 Ga0207670_104443491 248
315 3300025937 Ga0207669_10164527 Ga0207669_101645272 248
316 3300025938 Ga0207704_10060952 Ga0207704_100609522 248
317 3300025941 Ga0207711_10044974 Ga0207711_100449745 248
318 3300025942 Ga0207689_10002329 Ga0207689_100023295 248
319 3300025961 Ga0207712_10273302 Ga0207712_102733022 248
320 3300026035 Ga0207703_10017801 Ga0207703_100178014 248
321 3300026041 Ga0207639_10225472 Ga0207639_102254722 248
322 3300026067 Ga0207678_10044274 Ga0207678_100442742 248
323 3300026075 Ga0207708_10025051 Ga0207708_100250514 248
324 3300026088 Ga0207641_10183603 Ga0207641_101836032 248
325 3300026118 Ga0207675_100019458 Ga0207675_1000194582 248
326 3300026121 Ga0207683_10086154 Ga0207683_100861543 248
327 3300026121 Ga0207683_10518623 Ga0207683_105186232 248
328 3300027312 Ga0209371_1003053 Ga0209371_10030532 248
329 3300028379 Ga0268266_10227725 Ga0268266_102277251 248
330 3300028381 Ga0268264_10057198 Ga0268264_100571982 248
331 3300030500 Ga0268256_1005177 Ga0268256_10051772 248
332 3300046455 Ga0495603_0220064 Ga0495603_0220064_97_843 248
333 3300050491 nmdc:mga00v17_8406_c1 nmdc:mga00v17_8406_c1_45_797 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00497

SBP_bac_3

Bacterial extracellular solute-binding proteins, family 3

25

233

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3kbr-assembly1.cif.gz_A the crystal structure of cyclohexadienyl dehydratase precursor from pseudomonas aeruginosa pa01 0.8388 8 232
6wup-assembly1.cif.gz_A crystal structure of an ancestral cyclohexadienyl dehydratase, anccdt-5 0.8336 4 232
6gpm-assembly1.cif.gz_A crystal structure of domain 2 from tmargbp 0.8269 103 190
3k4u-assembly1.cif.gz_A crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine 0.8185 14 232
3kbr-assembly1.cif.gz_A the crystal structure of cyclohexadienyl dehydratase precursor from pseudomonas aeruginosa pa01 0.8163 8 232
ID Description Score Start End Superfamily
5eyfB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8824 101 193 3.40.190.10
af_P0AEU0_25_107_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8781 15 77 3.40.190.10
2y7iB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8654 16 98 3.40.190.10
3h7mA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8616 16 99 3.40.190.10
2y7iB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.8585 103 193 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A7W8K3E1-F1-model_v4 Polar amino acid transport system substrate-binding protein 0.9605 1 248
AF-A0A7W8K3E1-F1-model_v4 Polar amino acid transport system substrate-binding protein 0.953 1 248
AF-A0A848JUK3-F1-model_v4 deleted 0.9495 1 244
AF-A0A554W812-F1-model_v4 Cyclohexadienyl dehydratase 0.9443 10 248
AF-J3DLG1-F1-model_v4 Periplasmic component of amino acid ABC-type transporter/signal transduction system 0.9418 1 246

Feature Viewer

pLDDT pTM Quality
92.46 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map