F411250

General Info

Members Datasets Scaffolds Average Seq Length
333 173 333 163

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100545539|Ga0070674_1005455392
Length 193
Sequence MISSISWLRGCWITWAWSIRWSRDGEPRPEVTGPNVTSRIVGLISDTHGLLRPDVHTAFAGVELILHAGDVGGDDILDELELIAPVRAVYGNTDAPGQPRLADAIDLSIGGVSIHVSHGHEIGSPVAAKLLERYAADVVVFGHTHRPLIARAGDRLVLNPGAAGPRRFEIMPSVARLTIQGGHADAELIALRA

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
144 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
145 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
152 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
153 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
164 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
165 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
167 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
168 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
169 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
173 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.6
Rhizosphere 98.5
Stem 0
Stem Tuber 0
Unclassified 0.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10175176 3300005327 Bacteria 1803
2 Ga0070676_10010045 3300005328 Bacteria 5126
3 Ga0070683_100001197 3300005329 Bacteria 19738
4 Ga0070683_100003932 3300005329 Bacteria 12153
5 Ga0070683_100004138 3300005329 Bacteria 11889
6 Ga0070683_100010166 3300005329 Bacteria 8076
7 Ga0070683_100012025 3300005329 Bacteria 7507
8 Ga0070683_100046550 3300005329 Bacteria 4008
9 Ga0070683_100066304 3300005329 Bacteria 3363
10 Ga0070683_100130635 3300005329 Bacteria 2377
11 Ga0070683_100222681 3300005329 Bacteria 1793
12 Ga0070690_101126651 3300005330 Bacteria 623
13 Ga0070670_100017799 3300005331 Bacteria 6097
14 Ga0070670_101588172 3300005331 Bacteria 601
15 Ga0070677_10323015 3300005333 Bacteria 791
16 Ga0068869_100120290 3300005334 Unclassified 2007
17 Ga0070680_100107047 3300005336 Bacteria 2325
18 Ga0070680_100109860 3300005336 Unclassified 2295
19 Ga0070680_100144052 3300005336 Bacteria 1999
20 Ga0070680_100354192 3300005336 Bacteria 1248
21 Ga0068868_100053631 3300005338 Bacteria 3176
22 Ga0068868_100832584 3300005338 Unclassified 835
23 Ga0070660_100095037 3300005339 Bacteria 2355
24 Ga0070660_100278648 3300005339 Bacteria 1368
25 Ga0070689_100081066 3300005340 Bacteria 2547
26 Ga0070689_100335668 3300005340 Bacteria 1265
27 Ga0070661_100010151 3300005344 Bacteria 6540
28 Ga0070661_100217638 3300005344 Bacteria 1464
29 Ga0070661_100250283 3300005344 Bacteria 1367
30 Ga0070692_10021465 3300005345 Bacteria 3141
31 Ga0070668_100000182 3300005347 Bacteria 40680
32 Ga0070668_100040826 3300005347 Unclassified 3552
33 Ga0070669_100009204 3300005353 Bacteria 7038
34 Ga0070669_100010402 3300005353 Bacteria 6607
35 Ga0070669_100030374 3300005353 Bacteria 3899
36 Ga0070675_100003899 3300005354 Bacteria 11305
37 Ga0070675_100031259 3300005354 Unclassified 4303
38 Ga0070675_100652240 3300005354 Unclassified 957
39 Ga0070671_100095458 3300005355 Bacteria 2492
40 Ga0070671_100204947 3300005355 Bacteria 1673
41 Ga0070671_100303294 3300005355 Bacteria 1360
42 Ga0070674_100052782 3300005356 Bacteria 2805
43 Ga0070674_100055633 3300005356 Unclassified 2741
44 Ga0070674_100545539 3300005356 Unclassified 972
45 Ga0070674_100554160 3300005356 Bacteria 965
46 Ga0070673_100412482 3300005364 Bacteria 1209
47 Ga0070673_101084119 3300005364 Bacteria 748
48 Ga0070688_100004471 3300005365 Bacteria 7280
49 Ga0070688_100486883 3300005365 Bacteria 928
50 Ga0070659_100047260 3300005366 Unclassified 3375
51 Ga0070659_100261063 3300005366 Unclassified 1437
52 Ga0070659_100375876 3300005366 Bacteria 1196
53 Ga0070667_100003820 3300005367 Bacteria 12800
54 Ga0070709_10012071 3300005434 Bacteria 4829
55 Ga0070714_100056112 3300005435 Bacteria 3368
56 Ga0070713_100019570 3300005436 Bacteria 5173
57 Ga0070701_10039819 3300005438 Unclassified 2386
58 Ga0070705_100540950 3300005440 Unclassified 891
59 Ga0070663_100129762 3300005455 Unclassified 1913
60 Ga0070663_100561933 3300005455 Bacteria 955
61 Ga0070662_100004561 3300005457 Bacteria 8768
62 Ga0070662_100072622 3300005457 Bacteria 2541
63 Ga0070662_100384940 3300005457 Bacteria 1155
64 Ga0070681_10003433 3300005458 Bacteria 14840
65 Ga0070681_10013661 3300005458 Bacteria 8081
66 Ga0070681_10022409 3300005458 Bacteria 6342
67 Ga0070681_10321559 3300005458 Bacteria 1457
68 Ga0068867_100012475 3300005459 Bacteria 6014
69 Ga0068867_100037842 3300005459 Bacteria 3509
70 Ga0068867_100342180 3300005459 Bacteria 1246
71 Ga0068867_100660897 3300005459 Bacteria 918
72 Ga0070685_10062474 3300005466 Unclassified 2184
73 Ga0070698_100078372 3300005471 Bacteria 3303
74 Ga0070679_100056961 3300005530 Bacteria 3895
75 Ga0070684_100004298 3300005535 Bacteria 10813
76 Ga0070684_100014420 3300005535 Bacteria 6403
77 Ga0070684_100014626 3300005535 Bacteria 6364
78 Ga0070684_100018463 3300005535 Bacteria 5745
79 Ga0070684_100102653 3300005535 Unclassified 2557
80 Ga0070684_100114112 3300005535 Bacteria 2425
81 Ga0070684_100115070 3300005535 Bacteria 2415
82 Ga0070684_100174827 3300005535 Bacteria 1951
83 Ga0070684_100234204 3300005535 Bacteria 1677
84 Ga0068853_100082758 3300005539 Unclassified 2811
85 Ga0068853_100570573 3300005539 Bacteria 1073
86 Ga0068853_100707639 3300005539 Bacteria 961
87 Ga0070672_100005523 3300005543 Bacteria 8391
88 Ga0070672_100021821 3300005543 Bacteria 4690
89 Ga0070672_100071005 3300005543 Bacteria 2768
90 Ga0070672_100143250 3300005543 Bacteria 1973
91 Ga0068855_100024080 3300005563 Bacteria 7288
92 Ga0068855_100041422 3300005563 Bacteria 5458
93 Ga0070664_100005063 3300005564 Bacteria 10569
94 Ga0070664_100011373 3300005564 Bacteria 7218
95 Ga0070664_100026601 3300005564 Bacteria 4800
96 Ga0070664_100032202 3300005564 Bacteria 4385
97 Ga0070664_100239912 3300005564 Unclassified 1627
98 Ga0070664_100453247 3300005564 Bacteria 1178
99 Ga0070664_100867538 3300005564 Bacteria 845
100 Ga0068857_100001192 3300005577 Bacteria 20294
101 Ga0068857_100320651 3300005577 Unclassified 1431
102 Ga0068856_100085038 3300005614 Bacteria 3143
103 Ga0068856_100141196 3300005614 Bacteria 2416
104 Ga0068852_100030340 3300005616 Unclassified 4449
105 Ga0068852_100083884 3300005616 Bacteria 2834
106 Ga0068852_100641599 3300005616 Bacteria 1069
107 Ga0068859_102010341 3300005617 Bacteria 638
108 Ga0068864_100211682 3300005618 Unclassified 1785
109 Ga0068866_10765236 3300005718 Unclassified 668
110 Ga0068861_100000655 3300005719 Bacteria 20560
111 Ga0068861_100284651 3300005719 Bacteria 1425
112 Ga0068851_10003280 3300005834 Bacteria 7182
113 Ga0068851_10031946 3300005834 Bacteria 2618
114 Ga0068870_10035706 3300005840 Bacteria 2553
115 Ga0068863_100118485 3300005841 Bacteria 2523
116 Ga0068858_100090457 3300005842 Unclassified 2848
117 Ga0068858_100428758 3300005842 Bacteria 1272
118 Ga0068860_100003859 3300005843 Bacteria 15399
119 Ga0068862_100000513 3300005844 Bacteria 41174
120 Ga0068862_100006983 3300005844 Bacteria 9369
121 Ga0097621_100169573 3300006237 Bacteria 1881
122 Ga0097621_100759272 3300006237 Bacteria 896
123 Ga0068871_100528478 3300006358 Bacteria 1066
124 Ga0075428_100039210 3300006844 Bacteria 5213
125 Ga0075428_100241914 3300006844 Bacteria 1947
126 Ga0075430_100000568 3300006846 Bacteria 28042
127 Ga0075430_100003791 3300006846 Bacteria 12716
128 Ga0075431_100082479 3300006847 Bacteria 3319
129 Ga0075431_100135848 3300006847 Bacteria 2535
130 Ga0075431_101101290 3300006847 Unclassified 759
131 Ga0075433_10016502 3300006852 Bacteria 6090
132 Ga0075434_100110892 3300006871 Bacteria 2754
133 Ga0075434_100143792 3300006871 Bacteria 2405
134 Ga0075434_101085511 3300006871 Unclassified 814
135 Ga0075429_100048213 3300006880 Bacteria 3705
136 Ga0075429_100271060 3300006880 Bacteria 1487
137 Ga0068865_100003243 3300006881 Bacteria 9741
138 Ga0097620_102010527 3300006931 Bacteria 638
139 Ga0075435_100103973 3300007076 Bacteria 2356
140 Ga0105240_10013617 3300009093 Bacteria 11157
141 Ga0105240_10199400 3300009093 Bacteria 2347
142 Ga0105240_10623775 3300009093 Bacteria 1185
143 Ga0111539_10038142 3300009094 Bacteria 5797
144 Ga0111539_10056050 3300009094 Bacteria 4686
145 Ga0111539_10156096 3300009094 Bacteria 2670
146 Ga0114129_10192864 3300009147 Bacteria 2765
147 Ga0114129_10398327 3300009147 Bacteria 1815
148 Ga0105241_10298016 3300009174 Bacteria 1383
149 Ga0105242_10576225 3300009176 Bacteria 1083
150 Ga0105248_10016000 3300009177 Bacteria 8258
151 Ga0105248_10317159 3300009177 Bacteria 1756
152 Ga0105248_10325431 3300009177 Bacteria 1731
153 Ga0105248_11061611 3300009177 Bacteria 915
154 Ga0105237_10087684 3300009545 Bacteria 3101
155 Ga0105249_10000251 3300009553 Bacteria 59080
156 Ga0105249_10000572 3300009553 Bacteria 33735
157 Ga0105239_10015318 3300010375 Bacteria 8495
158 Ga0157373_10119183 3300013100 Bacteria 1855
159 Ga0157371_10002578 3300013102 Bacteria 17195
160 Ga0157370_10034246 3300013104 Bacteria 4948
161 Ga0157370_10037790 3300013104 Unclassified 4675
162 Ga0157369_10051417 3300013105 Bacteria 4459
163 Ga0157369_10415678 3300013105 Bacteria 1394
164 Ga0157369_10554341 3300013105 Bacteria 1188
165 Ga0157374_10051943 3300013296 Bacteria 3815
166 Ga0157374_10691593 3300013296 Unclassified 1033
167 Ga0163162_10000718 3300013306 Bacteria 30727
168 Ga0157372_10015297 3300013307 Bacteria 8220
169 Ga0157372_10023304 3300013307 Bacteria 6710
170 Ga0157372_10121709 3300013307 Unclassified 2998
171 Ga0157372_10183097 3300013307 Unclassified 2425
172 Ga0157372_10315777 3300013307 Bacteria 1819
173 Ga0157375_10054996 3300013308 Bacteria 3922
174 Ga0157375_10864477 3300013308 Bacteria 1050
175 Ga0157375_11304672 3300013308 Bacteria 853
176 Ga0157380_11863873 3300014326 Bacteria 661
177 Ga0157380_12293861 3300014326 Bacteria 604
178 Ga0182008_10153834 3300014497 Bacteria 1154
179 Ga0157377_10002781 3300014745 Bacteria 7797
180 Ga0157377_10604099 3300014745 Bacteria 783
181 Ga0157379_10002786 3300014968 Bacteria 14733
182 Ga0163161_10757006 3300017792 Bacteria 813
183 Ga0154015_1549141 3300020610 Unclassified 920
184 Ga0213876_10498290 3300021384 Unclassified 648
185 Ga0207656_10007497 3300025321 Bacteria 3977
186 Ga0207656_10023061 3300025321 Bacteria 2503
187 Ga0207680_10130112 3300025903 Unclassified 1658
188 Ga0207699_10005732 3300025906 Bacteria 5973
189 Ga0207645_10001472 3300025907 Bacteria 19240
190 Ga0207643_10002389 3300025908 Bacteria 10186
191 Ga0207707_10007585 3300025912 Bacteria 9455
192 Ga0207707_10010563 3300025912 Bacteria 8016
193 Ga0207707_10154395 3300025912 Bacteria 2007
194 Ga0207695_10008836 3300025913 Bacteria 12546
195 Ga0207695_10031517 3300025913 Bacteria 5811
196 Ga0207660_10198860 3300025917 Unclassified 1565
197 Ga0207660_10277089 3300025917 Bacteria 1330
198 Ga0207660_10402537 3300025917 Bacteria 1102
199 Ga0207662_10002218 3300025918 Bacteria 9686
200 Ga0207657_10177540 3300025919 Bacteria 1723
201 Ga0207649_10072881 3300025920 Unclassified 2199
202 Ga0207649_10313561 3300025920 Unclassified 1150
203 Ga0207652_10015544 3300025921 Bacteria 6191
204 Ga0207652_10024349 3300025921 Bacteria 5022
205 Ga0207681_10001166 3300025923 Bacteria 16947
206 Ga0207681_10022218 3300025923 Bacteria 4043
207 Ga0207650_10030859 3300025925 Bacteria 3866
208 Ga0207650_10257083 3300025925 Bacteria 1416
209 Ga0207650_10454190 3300025925 Bacteria 1067
210 Ga0207659_10028959 3300025926 Bacteria 3768
211 Ga0207659_10513296 3300025926 Unclassified 1016
212 Ga0207664_10091166 3300025929 Bacteria 2499
213 Ga0207644_10060222 3300025931 Bacteria 2747
214 Ga0207644_10308599 3300025931 Bacteria 1277
215 Ga0207690_10686733 3300025932 Unclassified 841
216 Ga0207706_10000364 3300025933 Bacteria 48974
217 Ga0207706_10124371 3300025933 Bacteria 2269
218 Ga0207706_10217713 3300025933 Bacteria 1673
219 Ga0207706_10295335 3300025933 Bacteria 1412
220 Ga0207670_10398352 3300025936 Bacteria 1100
221 Ga0207669_10082513 3300025937 Unclassified 2064
222 Ga0207669_10097501 3300025937 Bacteria 1933
223 Ga0207669_11024969 3300025937 Unclassified 694
224 Ga0207704_10016626 3300025938 Bacteria 3787
225 Ga0207704_10395678 3300025938 Bacteria 1089
226 Ga0207665_10294725 3300025939 Unclassified 1211
227 Ga0207691_10000471 3300025940 Bacteria 39874
228 Ga0207691_10000745 3300025940 Bacteria 32134
229 Ga0207691_10011271 3300025940 Bacteria 8576
230 Ga0207691_10595226 3300025940 Unclassified 936
231 Ga0207711_10031990 3300025941 Unclassified 4445
232 Ga0207689_10117974 3300025942 Bacteria 2182
233 Ga0207661_10005179 3300025944 Bacteria 9164
234 Ga0207661_10054660 3300025944 Bacteria 3199
235 Ga0207661_10128995 3300025944 Bacteria 2163
236 Ga0207661_10136913 3300025944 Bacteria 2104
237 Ga0207661_10298224 3300025944 Unclassified 1444
238 Ga0207661_10315916 3300025944 Bacteria 1403
239 Ga0207661_10583158 3300025944 Bacteria 1026
240 Ga0207661_11325310 3300025944 Unclassified 661
241 Ga0207661_11683555 3300025944 Unclassified 579
242 Ga0207679_10003752 3300025945 Bacteria 9418
243 Ga0207679_10004479 3300025945 Bacteria 8707
244 Ga0207679_10017576 3300025945 Bacteria 4774
245 Ga0207679_10029129 3300025945 Bacteria 3841
246 Ga0207679_10415170 3300025945 Bacteria 1187
247 Ga0207679_10574638 3300025945 Bacteria 1013
248 Ga0207679_10630413 3300025945 Bacteria 968
249 Ga0207667_10307961 3300025949 Unclassified 1618
250 Ga0207651_11314948 3300025960 Bacteria 650
251 Ga0207712_10005013 3300025961 Bacteria 8375
252 Ga0207712_10009001 3300025961 Bacteria 6315
253 Ga0207668_10006562 3300025972 Bacteria 6877
254 Ga0207640_10017566 3300025981 Unclassified 4188
255 Ga0207658_10272994 3300025986 Bacteria 1446
256 Ga0207703_10089093 3300026035 Bacteria 2591
257 Ga0207703_10816215 3300026035 Bacteria 891
258 Ga0207639_10702284 3300026041 Bacteria 938
259 Ga0207639_10713140 3300026041 Bacteria 931
260 Ga0207639_10809836 3300026041 Bacteria 873
261 Ga0207678_10033619 3300026067 Bacteria 4466
262 Ga0207678_11510736 3300026067 Bacteria 593
263 Ga0207708_10005639 3300026075 Bacteria 9243
264 Ga0207702_10126232 3300026078 Bacteria 2297
265 Ga0207641_10151194 3300026088 Bacteria 2102
266 Ga0207648_10003275 3300026089 Bacteria 17030
267 Ga0207648_10011164 3300026089 Bacteria 8474
268 Ga0207648_10226686 3300026089 Bacteria 1662
269 Ga0207648_10300682 3300026089 Bacteria 1439
270 Ga0207648_10870306 3300026089 Unclassified 841
271 Ga0207676_10094390 3300026095 Bacteria 2465
272 Ga0207676_10107365 3300026095 Unclassified 2328
273 Ga0207676_10309415 3300026095 Bacteria 1446
274 Ga0207676_10617132 3300026095 Unclassified 1043
275 Ga0207674_10000658 3300026116 Bacteria 44902
276 Ga0207674_10003423 3300026116 Bacteria 19422
277 Ga0207675_100000030 3300026118 Bacteria 109178
278 Ga0207698_10031284 3300026142 Unclassified 3839
279 Ga0207698_10072882 3300026142 Bacteria 2732
280 Ga0207698_10555560 3300026142 Bacteria 1126
281 Ga0207428_10039029 3300027907 Bacteria 3856
282 Ga0207428_10067384 3300027907 Unclassified 2818
283 Ga0268266_10141072 3300028379 Unclassified 2163
284 Ga0268266_10415393 3300028379 Unclassified 1274
285 Ga0268265_10001595 3300028380 Bacteria 18725
286 Ga0268265_10017277 3300028380 Bacteria 4974
287 Ga0307406_10003353 3300031901 Bacteria 8724
288 Ga0307409_100468178 3300031995 Bacteria 1220
289 Ga0307409_100962171 3300031995 Bacteria 870
290 Ga0307416_100170781 3300032002 Bacteria 2024
291 Ga0307416_100478187 3300032002 Bacteria 1305
292 Ga0307414_10285525 3300032004 Bacteria 1389
293 Ga0307415_100528637 3300032126 Bacteria 1037
294 Ga0307415_100941594 3300032126 Bacteria 799
295 Ga0373947_0171024 3300035725 Unclassified 1410
296 Ga0436365_0651245 3300039437 Unclassified 812
297 Ga0436365_1197150 3300039437 Bacteria 4647
298 Ga0439461_0135281 3300041410 Bacteria 626
299 Ga0466961_0375496 3300044693 Unclassified 864
300 Ga0466963_0186869 3300044694 Bacteria 1447
301 Ga0466967_0053122 3300045976 Unclassified 3560
302 Ga0466967_0667929 3300045976 Bacteria 1028
303 Ga0495629_0165318 3300046459 Bacteria 1536
304 Ga0495594_0030066 3300046499 Bacteria 2937
305 Ga0495630_0061439 3300046517 Bacteria 2821
306 Ga0495666_0163411 3300046526 Unclassified 1032
307 Ga0495586_0017888 3300046535 Bacteria 3770
308 Ga0495633_0462282 3300046558 Bacteria 573
309 Ga0495659_0271192 3300046664 Bacteria 711
310 Ga0495588_0087613 3300046674 Unclassified 1629
311 Ga0495670_0354382 3300046691 Bacteria 790
312 Ga0496108_0650686 3300048911 Unclassified 916
313 Ga0496109_0377991 3300048912 Unclassified 1338
314 Ga0501033_0014123 3300049570 Bacteria 6071
315 Ga0501034_0068530 3300049571 Bacteria 3558
316 Ga0501038_0275375 3300049574 Unclassified 1326
317 Ga0501043_0315954 3300049579 Bacteria 1191
318 Ga0501047_0045161 3300049581 Bacteria 4259
319 Ga0501070_0103151 3300049586 Bacteria 2359
320 Ga0501261_036224 3300049690 Bacteria 763
321 Ga0501035_0022570 3300049822 Bacteria 5780
322 Ga0501044_0057879 3300049823 Bacteria 3976
323 Ga0501044_0253870 3300049823 Bacteria 1698
324 nmdc:mga05p37_173139_c1 3300050507 Bacteria 2631
325 nmdc:mga05p37_231395_c1 3300050507 Bacteria 2226
326 nmdc:mga09592_108307_c1 3300050508 Unclassified 1846
327 nmdc:mga09592_136202_c1 3300050508 Bacteria 2115
328 nmdc:mga0qj67_35455_c1 3300050509 Bacteria 3901
329 nmdc:mga08y16_176433_c1 3300050511 Bacteria 2219
330 nmdc:mga08y16_23008_c2 3300050511 Bacteria 6222
331 nmdc:mga0n895_4969_c1 3300050512 Bacteria 11032
332 nmdc:mga08x19_26334_c1 3300050514 Bacteria 1464
333 nmdc:mga0a205_244973_c1 3300050515 Bacteria 1673

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10317159 Ga0105248_103171591 156
2 3300013296 Ga0157374_10691593 Ga0157374_106915932 156
3 3300026095 Ga0207676_10309415 Ga0207676_103094152 156
4 3300032126 Ga0307415_100528637 Ga0307415_1005286372 156
5 3300041410 Ga0439461_0135281 Ga0439461_0135281_47_520 156
6 3300048911 Ga0496108_0650686 Ga0496108_0650686_431_901 156
7 3300048912 Ga0496109_0377991 Ga0496109_0377991_829_1299 156
8 3300045976 Ga0466967_0667929 Ga0466967_0667929_110_583 157
9 3300005336 Ga0070680_100354192 Ga0070680_1003541922 158
10 3300005535 Ga0070684_100018463 Ga0070684_1000184634 158
11 3300005543 Ga0070672_100071005 Ga0070672_1000710053 158
12 3300005617 Ga0068859_102010341 Ga0068859_1020103411 158
13 3300005719 Ga0068861_100284651 Ga0068861_1002846512 158
14 3300005840 Ga0068870_10035706 Ga0068870_100357063 158
15 3300006844 Ga0075428_100241914 Ga0075428_1002419143 158
16 3300006931 Ga0097620_102010527 Ga0097620_1020105272 158
17 3300009094 Ga0111539_10156096 Ga0111539_101560963 158
18 3300009147 Ga0114129_10398327 Ga0114129_103983272 158
19 3300009553 Ga0105249_10000251 Ga0105249_1000025120 158
20 3300013308 Ga0157375_10054996 Ga0157375_100549963 158
21 3300017792 Ga0163161_10757006 Ga0163161_107570062 158
22 3300025933 Ga0207706_10217713 Ga0207706_102177133 158
23 3300025944 Ga0207661_10583158 Ga0207661_105831582 158
24 3300026089 Ga0207648_10226686 Ga0207648_102266863 158
25 3300032002 Ga0307416_100170781 Ga0307416_1001707813 158
26 3300050507 nmdc:mga05p37_173139_c1 nmdc:mga05p37_173139_c1_1053_1529 158
27 3300050511 nmdc:mga08y16_176433_c1 nmdc:mga08y16_176433_c1_881_1357 158
28 3300028379 Ga0268266_10415393 Ga0268266_104153932 159
29 3300044693 Ga0466961_0375496 Ga0466961_0375496_368_847 159
30 3300005327 Ga0070658_10175176 Ga0070658_101751763 160
31 3300005328 Ga0070676_10010045 Ga0070676_100100455 160
32 3300005329 Ga0070683_100001197 Ga0070683_10000119717 160
33 3300005329 Ga0070683_100003932 Ga0070683_1000039325 160
34 3300005329 Ga0070683_100004138 Ga0070683_1000041389 160
35 3300005329 Ga0070683_100010166 Ga0070683_1000101662 160
36 3300005329 Ga0070683_100012025 Ga0070683_1000120252 160
37 3300005329 Ga0070683_100046550 Ga0070683_1000465502 160
38 3300005329 Ga0070683_100066304 Ga0070683_1000663043 160
39 3300005329 Ga0070683_100130635 Ga0070683_1001306354 160
40 3300005329 Ga0070683_100222681 Ga0070683_1002226811 160
41 3300005330 Ga0070690_101126651 Ga0070690_1011266511 160
42 3300005331 Ga0070670_100017799 Ga0070670_1000177993 160
43 3300005331 Ga0070670_101588172 Ga0070670_1015881721 160
44 3300005333 Ga0070677_10323015 Ga0070677_103230152 160
45 3300005334 Ga0068869_100120290 Ga0068869_1001202901 160
46 3300005336 Ga0070680_100107047 Ga0070680_1001070471 160
47 3300005336 Ga0070680_100109860 Ga0070680_1001098603 160
48 3300005336 Ga0070680_100144052 Ga0070680_1001440522 160
49 3300005338 Ga0068868_100053631 Ga0068868_1000536311 160
50 3300005338 Ga0068868_100832584 Ga0068868_1008325842 160
51 3300005339 Ga0070660_100095037 Ga0070660_1000950373 160
52 3300005339 Ga0070660_100278648 Ga0070660_1002786482 160
53 3300005340 Ga0070689_100081066 Ga0070689_1000810664 160
54 3300005340 Ga0070689_100335668 Ga0070689_1003356682 160
55 3300005344 Ga0070661_100010151 Ga0070661_1000101513 160
56 3300005344 Ga0070661_100217638 Ga0070661_1002176383 160
57 3300005344 Ga0070661_100250283 Ga0070661_1002502832 160
58 3300005345 Ga0070692_10021465 Ga0070692_100214653 160
59 3300005347 Ga0070668_100000182 Ga0070668_10000018218 160
60 3300005347 Ga0070668_100040826 Ga0070668_1000408263 160
61 3300005353 Ga0070669_100009204 Ga0070669_1000092047 160
62 3300005353 Ga0070669_100010402 Ga0070669_1000104023 160
63 3300005353 Ga0070669_100030374 Ga0070669_1000303742 160
64 3300005354 Ga0070675_100003899 Ga0070675_10000389913 160
65 3300005354 Ga0070675_100031259 Ga0070675_1000312593 160
66 3300005354 Ga0070675_100652240 Ga0070675_1006522402 160
67 3300005355 Ga0070671_100095458 Ga0070671_1000954583 160
68 3300005355 Ga0070671_100204947 Ga0070671_1002049473 160
69 3300005355 Ga0070671_100303294 Ga0070671_1003032942 160
70 3300005356 Ga0070674_100052782 Ga0070674_1000527823 160
71 3300005356 Ga0070674_100055633 Ga0070674_1000556333 160
72 3300005356 Ga0070674_100545539 Ga0070674_1005455392 160
73 3300005356 Ga0070674_100554160 Ga0070674_1005541602 160
74 3300005364 Ga0070673_100412482 Ga0070673_1004124823 160
75 3300005364 Ga0070673_101084119 Ga0070673_1010841191 160
76 3300005365 Ga0070688_100004471 Ga0070688_1000044713 160
77 3300005365 Ga0070688_100486883 Ga0070688_1004868831 160
78 3300005366 Ga0070659_100047260 Ga0070659_1000472603 160
79 3300005366 Ga0070659_100261063 Ga0070659_1002610633 160
80 3300005366 Ga0070659_100375876 Ga0070659_1003758762 160
81 3300005367 Ga0070667_100003820 Ga0070667_1000038207 160
82 3300005434 Ga0070709_10012071 Ga0070709_100120714 160
83 3300005435 Ga0070714_100056112 Ga0070714_1000561123 160
84 3300005436 Ga0070713_100019570 Ga0070713_1000195704 160
85 3300005438 Ga0070701_10039819 Ga0070701_100398193 160
86 3300005440 Ga0070705_100540950 Ga0070705_1005409502 160
87 3300005455 Ga0070663_100129762 Ga0070663_1001297622 160
88 3300005455 Ga0070663_100561933 Ga0070663_1005619332 160
89 3300005457 Ga0070662_100004561 Ga0070662_1000045614 160
90 3300005457 Ga0070662_100072622 Ga0070662_1000726224 160
91 3300005457 Ga0070662_100384940 Ga0070662_1003849401 160
92 3300005458 Ga0070681_10003433 Ga0070681_1000343314 160
93 3300005458 Ga0070681_10013661 Ga0070681_100136615 160
94 3300005458 Ga0070681_10022409 Ga0070681_100224096 160
95 3300005458 Ga0070681_10321559 Ga0070681_103215592 160
96 3300005459 Ga0068867_100012475 Ga0068867_1000124754 160
97 3300005459 Ga0068867_100037842 Ga0068867_1000378422 160
98 3300005459 Ga0068867_100342180 Ga0068867_1003421802 160
99 3300005459 Ga0068867_100660897 Ga0068867_1006608972 160
100 3300005466 Ga0070685_10062474 Ga0070685_100624743 160
101 3300005471 Ga0070698_100078372 Ga0070698_1000783722 160
102 3300005530 Ga0070679_100056961 Ga0070679_1000569614 160
103 3300005535 Ga0070684_100004298 Ga0070684_1000042985 160
104 3300005535 Ga0070684_100014420 Ga0070684_1000144207 160
105 3300005535 Ga0070684_100014626 Ga0070684_1000146266 160
106 3300005535 Ga0070684_100102653 Ga0070684_1001026532 160
107 3300005535 Ga0070684_100114112 Ga0070684_1001141123 160
108 3300005535 Ga0070684_100115070 Ga0070684_1001150703 160
109 3300005535 Ga0070684_100174827 Ga0070684_1001748272 160
110 3300005535 Ga0070684_100234204 Ga0070684_1002342041 160
111 3300005539 Ga0068853_100082758 Ga0068853_1000827582 160
112 3300005539 Ga0068853_100570573 Ga0068853_1005705732 160
113 3300005539 Ga0068853_100707639 Ga0068853_1007076392 160
114 3300005543 Ga0070672_100005523 Ga0070672_1000055237 160
115 3300005543 Ga0070672_100021821 Ga0070672_1000218215 160
116 3300005543 Ga0070672_100143250 Ga0070672_1001432504 160
117 3300005563 Ga0068855_100024080 Ga0068855_1000240805 160
118 3300005563 Ga0068855_100041422 Ga0068855_1000414224 160
119 3300005564 Ga0070664_100005063 Ga0070664_1000050637 160
120 3300005564 Ga0070664_100011373 Ga0070664_1000113734 160
121 3300005564 Ga0070664_100026601 Ga0070664_1000266014 160
122 3300005564 Ga0070664_100032202 Ga0070664_1000322022 160
123 3300005564 Ga0070664_100239912 Ga0070664_1002399123 160
124 3300005564 Ga0070664_100453247 Ga0070664_1004532472 160
125 3300005564 Ga0070664_100867538 Ga0070664_1008675382 160
126 3300005577 Ga0068857_100001192 Ga0068857_1000011929 160
127 3300005577 Ga0068857_100320651 Ga0068857_1003206513 160
128 3300005614 Ga0068856_100085038 Ga0068856_1000850383 160
129 3300005614 Ga0068856_100141196 Ga0068856_1001411962 160
130 3300005616 Ga0068852_100030340 Ga0068852_1000303403 160
131 3300005616 Ga0068852_100083884 Ga0068852_1000838843 160
132 3300005616 Ga0068852_100641599 Ga0068852_1006415994 160
133 3300005618 Ga0068864_100211682 Ga0068864_1002116822 160
134 3300005718 Ga0068866_10765236 Ga0068866_107652361 160
135 3300005719 Ga0068861_100000655 Ga0068861_1000006558 160
136 3300005834 Ga0068851_10003280 Ga0068851_100032805 160
137 3300005834 Ga0068851_10031946 Ga0068851_100319463 160
138 3300005841 Ga0068863_100118485 Ga0068863_1001184852 160
139 3300005842 Ga0068858_100090457 Ga0068858_1000904572 160
140 3300005842 Ga0068858_100428758 Ga0068858_1004287582 160
141 3300005843 Ga0068860_100003859 Ga0068860_10000385911 160
142 3300005844 Ga0068862_100000513 Ga0068862_10000051333 160
143 3300005844 Ga0068862_100006983 Ga0068862_1000069839 160
144 3300006237 Ga0097621_100169573 Ga0097621_1001695732 160
145 3300006237 Ga0097621_100759272 Ga0097621_1007592722 160
146 3300006358 Ga0068871_100528478 Ga0068871_1005284782 160
147 3300006844 Ga0075428_100039210 Ga0075428_1000392105 160
148 3300006846 Ga0075430_100000568 Ga0075430_1000005684 160
149 3300006846 Ga0075430_100003791 Ga0075430_1000037915 160
150 3300006847 Ga0075431_100082479 Ga0075431_1000824794 160
151 3300006847 Ga0075431_100135848 Ga0075431_1001358483 160
152 3300006847 Ga0075431_101101290 Ga0075431_1011012901 160
153 3300006852 Ga0075433_10016502 Ga0075433_100165027 160
154 3300006871 Ga0075434_100110892 Ga0075434_1001108924 160
155 3300006871 Ga0075434_100143792 Ga0075434_1001437922 160
156 3300006871 Ga0075434_101085511 Ga0075434_1010855112 160
157 3300006880 Ga0075429_100048213 Ga0075429_1000482134 160
158 3300006880 Ga0075429_100271060 Ga0075429_1002710603 160
159 3300006881 Ga0068865_100003243 Ga0068865_1000032437 160
160 3300007076 Ga0075435_100103973 Ga0075435_1001039733 160
161 3300009093 Ga0105240_10013617 Ga0105240_100136179 160
162 3300009093 Ga0105240_10199400 Ga0105240_101994002 160
163 3300009093 Ga0105240_10623775 Ga0105240_106237752 160
164 3300009094 Ga0111539_10038142 Ga0111539_100381426 160
165 3300009094 Ga0111539_10056050 Ga0111539_100560503 160
166 3300009147 Ga0114129_10192864 Ga0114129_101928643 160
167 3300009174 Ga0105241_10298016 Ga0105241_102980163 160
168 3300009176 Ga0105242_10576225 Ga0105242_105762252 160
169 3300009177 Ga0105248_10016000 Ga0105248_100160007 160
170 3300009177 Ga0105248_10325431 Ga0105248_103254312 160
171 3300009177 Ga0105248_11061611 Ga0105248_110616112 160
172 3300009545 Ga0105237_10087684 Ga0105237_100876842 160
173 3300009553 Ga0105249_10000572 Ga0105249_1000057229 160
174 3300010375 Ga0105239_10015318 Ga0105239_100153185 160
175 3300013100 Ga0157373_10119183 Ga0157373_101191833 160
176 3300013102 Ga0157371_10002578 Ga0157371_1000257818 160
177 3300013104 Ga0157370_10034246 Ga0157370_100342462 160
178 3300013104 Ga0157370_10037790 Ga0157370_100377904 160
179 3300013105 Ga0157369_10051417 Ga0157369_100514171 160
180 3300013105 Ga0157369_10415678 Ga0157369_104156783 160
181 3300013105 Ga0157369_10554341 Ga0157369_105543412 160
182 3300013296 Ga0157374_10051943 Ga0157374_100519433 160
183 3300013306 Ga0163162_10000718 Ga0163162_100007187 160
184 3300013307 Ga0157372_10015297 Ga0157372_100152975 160
185 3300013307 Ga0157372_10023304 Ga0157372_100233044 160
186 3300013307 Ga0157372_10121709 Ga0157372_101217093 160
187 3300013307 Ga0157372_10183097 Ga0157372_101830974 160
188 3300013307 Ga0157372_10315777 Ga0157372_103157772 160
189 3300013308 Ga0157375_10864477 Ga0157375_108644772 160
190 3300013308 Ga0157375_11304672 Ga0157375_113046722 160
191 3300014326 Ga0157380_11863873 Ga0157380_118638732 160
192 3300014326 Ga0157380_12293861 Ga0157380_122938611 160
193 3300014497 Ga0182008_10153834 Ga0182008_101538341 160
194 3300014745 Ga0157377_10002781 Ga0157377_100027815 160
195 3300014745 Ga0157377_10604099 Ga0157377_106040991 160
196 3300014968 Ga0157379_10002786 Ga0157379_100027867 160
197 3300020610 Ga0154015_1549141 Ga0154015_15491412 160
198 3300021384 Ga0213876_10498290 Ga0213876_104982902 160
199 3300025321 Ga0207656_10007497 Ga0207656_100074972 160
200 3300025321 Ga0207656_10023061 Ga0207656_100230614 160
201 3300025903 Ga0207680_10130112 Ga0207680_101301122 160
202 3300025906 Ga0207699_10005732 Ga0207699_100057326 160
203 3300025907 Ga0207645_10001472 Ga0207645_1000147220 160
204 3300025908 Ga0207643_10002389 Ga0207643_100023894 160
205 3300025912 Ga0207707_10007585 Ga0207707_100075853 160
206 3300025912 Ga0207707_10010563 Ga0207707_100105635 160
207 3300025912 Ga0207707_10154395 Ga0207707_101543952 160
208 3300025913 Ga0207695_10008836 Ga0207695_1000883612 160
209 3300025913 Ga0207695_10031517 Ga0207695_100315175 160
210 3300025917 Ga0207660_10198860 Ga0207660_101988602 160
211 3300025917 Ga0207660_10277089 Ga0207660_102770892 160
212 3300025917 Ga0207660_10402537 Ga0207660_104025372 160
213 3300025918 Ga0207662_10002218 Ga0207662_100022188 160
214 3300025919 Ga0207657_10177540 Ga0207657_101775403 160
215 3300025920 Ga0207649_10072881 Ga0207649_100728813 160
216 3300025920 Ga0207649_10313561 Ga0207649_103135612 160
217 3300025921 Ga0207652_10015544 Ga0207652_100155445 160
218 3300025921 Ga0207652_10024349 Ga0207652_100243493 160
219 3300025923 Ga0207681_10001166 Ga0207681_1000116615 160
220 3300025923 Ga0207681_10022218 Ga0207681_100222184 160
221 3300025925 Ga0207650_10030859 Ga0207650_100308592 160
222 3300025925 Ga0207650_10257083 Ga0207650_102570832 160
223 3300025925 Ga0207650_10454190 Ga0207650_104541902 160
224 3300025926 Ga0207659_10028959 Ga0207659_100289595 160
225 3300025926 Ga0207659_10513296 Ga0207659_105132962 160
226 3300025929 Ga0207664_10091166 Ga0207664_100911664 160
227 3300025931 Ga0207644_10060222 Ga0207644_100602223 160
228 3300025931 Ga0207644_10308599 Ga0207644_103085992 160
229 3300025932 Ga0207690_10686733 Ga0207690_106867331 160
230 3300025933 Ga0207706_10000364 Ga0207706_1000036419 160
231 3300025933 Ga0207706_10124371 Ga0207706_101243713 160
232 3300025933 Ga0207706_10295335 Ga0207706_102953353 160
233 3300025936 Ga0207670_10398352 Ga0207670_103983522 160
234 3300025937 Ga0207669_10082513 Ga0207669_100825133 160
235 3300025937 Ga0207669_10097501 Ga0207669_100975013 160
236 3300025937 Ga0207669_11024969 Ga0207669_110249691 160
237 3300025938 Ga0207704_10016626 Ga0207704_100166261 160
238 3300025938 Ga0207704_10395678 Ga0207704_103956782 160
239 3300025939 Ga0207665_10294725 Ga0207665_102947253 160
240 3300025940 Ga0207691_10000471 Ga0207691_100004713 160
241 3300025940 Ga0207691_10000745 Ga0207691_1000074510 160
242 3300025940 Ga0207691_10011271 Ga0207691_100112716 160
243 3300025940 Ga0207691_10595226 Ga0207691_105952263 160
244 3300025941 Ga0207711_10031990 Ga0207711_100319903 160
245 3300025942 Ga0207689_10117974 Ga0207689_101179743 160
246 3300025944 Ga0207661_10005179 Ga0207661_100051795 160
247 3300025944 Ga0207661_10054660 Ga0207661_100546603 160
248 3300025944 Ga0207661_10128995 Ga0207661_101289953 160
249 3300025944 Ga0207661_10136913 Ga0207661_101369133 160
250 3300025944 Ga0207661_10298224 Ga0207661_102982243 160
251 3300025944 Ga0207661_10315916 Ga0207661_103159161 160
252 3300025944 Ga0207661_11325310 Ga0207661_113253102 160
253 3300025944 Ga0207661_11683555 Ga0207661_116835552 160
254 3300025945 Ga0207679_10003752 Ga0207679_100037529 160
255 3300025945 Ga0207679_10004479 Ga0207679_100044796 160
256 3300025945 Ga0207679_10017576 Ga0207679_100175765 160
257 3300025945 Ga0207679_10029129 Ga0207679_100291295 160
258 3300025945 Ga0207679_10415170 Ga0207679_104151703 160
259 3300025945 Ga0207679_10574638 Ga0207679_105746382 160
260 3300025945 Ga0207679_10630413 Ga0207679_106304132 160
261 3300025949 Ga0207667_10307961 Ga0207667_103079612 160
262 3300025960 Ga0207651_11314948 Ga0207651_113149481 160
263 3300025961 Ga0207712_10005013 Ga0207712_100050139 160
264 3300025961 Ga0207712_10009001 Ga0207712_100090016 160
265 3300025972 Ga0207668_10006562 Ga0207668_100065624 160
266 3300025981 Ga0207640_10017566 Ga0207640_100175664 160
267 3300025986 Ga0207658_10272994 Ga0207658_102729941 160
268 3300026035 Ga0207703_10089093 Ga0207703_100890932 160
269 3300026035 Ga0207703_10816215 Ga0207703_108162151 160
270 3300026041 Ga0207639_10702284 Ga0207639_107022842 160
271 3300026041 Ga0207639_10713140 Ga0207639_107131402 160
272 3300026041 Ga0207639_10809836 Ga0207639_108098361 160
273 3300026067 Ga0207678_10033619 Ga0207678_100336195 160
274 3300026067 Ga0207678_11510736 Ga0207678_115107361 160
275 3300026075 Ga0207708_10005639 Ga0207708_100056395 160
276 3300026078 Ga0207702_10126232 Ga0207702_101262323 160
277 3300026088 Ga0207641_10151194 Ga0207641_101511943 160
278 3300026089 Ga0207648_10003275 Ga0207648_100032755 160
279 3300026089 Ga0207648_10011164 Ga0207648_100111644 160
280 3300026089 Ga0207648_10300682 Ga0207648_103006823 160
281 3300026089 Ga0207648_10870306 Ga0207648_108703061 160
282 3300026095 Ga0207676_10094390 Ga0207676_100943902 160
283 3300026095 Ga0207676_10107365 Ga0207676_101073652 160
284 3300026095 Ga0207676_10617132 Ga0207676_106171322 160
285 3300026116 Ga0207674_10000658 Ga0207674_1000065816 160
286 3300026116 Ga0207674_10003423 Ga0207674_1000342319 160
287 3300026118 Ga0207675_100000030 Ga0207675_10000003072 160
288 3300026142 Ga0207698_10031284 Ga0207698_100312844 160
289 3300026142 Ga0207698_10072882 Ga0207698_100728823 160
290 3300026142 Ga0207698_10555560 Ga0207698_105555602 160
291 3300027907 Ga0207428_10039029 Ga0207428_100390291 160
292 3300027907 Ga0207428_10067384 Ga0207428_100673844 160
293 3300028379 Ga0268266_10141072 Ga0268266_101410722 160
294 3300028380 Ga0268265_10001595 Ga0268265_1000159516 160
295 3300028380 Ga0268265_10017277 Ga0268265_100172773 160
296 3300031901 Ga0307406_10003353 Ga0307406_100033538 160
297 3300031995 Ga0307409_100468178 Ga0307409_1004681782 160
298 3300031995 Ga0307409_100962171 Ga0307409_1009621712 160
299 3300032002 Ga0307416_100478187 Ga0307416_1004781872 160
300 3300032004 Ga0307414_10285525 Ga0307414_102855253 160
301 3300032126 Ga0307415_100941594 Ga0307415_1009415941 160
302 3300035725 Ga0373947_0171024 Ga0373947_0171024_726_1211 160
303 3300039437 Ga0436365_0651245 Ga0436365_0651245_169_651 160
304 3300039437 Ga0436365_1197150 Ga0436365_1197150_2174_2659 160
305 3300044694 Ga0466963_0186869 Ga0466963_0186869_298_789 160
306 3300045976 Ga0466967_0053122 Ga0466967_0053122_2745_3230 160
307 3300046459 Ga0495629_0165318 Ga0495629_0165318_853_1338 160
308 3300046499 Ga0495594_0030066 Ga0495594_0030066_2401_2883 160
309 3300046517 Ga0495630_0061439 Ga0495630_0061439_420_905 160
310 3300046526 Ga0495666_0163411 Ga0495666_0163411_299_784 160
311 3300046535 Ga0495586_0017888 Ga0495586_0017888_2802_3287 160
312 3300046558 Ga0495633_0462282 Ga0495633_0462282_32_523 160
313 3300046664 Ga0495659_0271192 Ga0495659_0271192_169_657 160
314 3300046674 Ga0495588_0087613 Ga0495588_0087613_52_537 160
315 3300046691 Ga0495670_0354382 Ga0495670_0354382_135_623 160
316 3300049570 Ga0501033_0014123 Ga0501033_0014123_1496_1978 160
317 3300049571 Ga0501034_0068530 Ga0501034_0068530_1899_2381 160
318 3300049574 Ga0501038_0275375 Ga0501038_0275375_732_1217 160
319 3300049579 Ga0501043_0315954 Ga0501043_0315954_145_627 160
320 3300049581 Ga0501047_0045161 Ga0501047_0045161_3218_3700 160
321 3300049586 Ga0501070_0103151 Ga0501070_0103151_1088_1573 160
322 3300049690 Ga0501261_036224 Ga0501261_036224_217_705 160
323 3300049822 Ga0501035_0022570 Ga0501035_0022570_3754_4236 160
324 3300049823 Ga0501044_0057879 Ga0501044_0057879_2448_2930 160
325 3300049823 Ga0501044_0253870 Ga0501044_0253870_367_852 160
326 3300050507 nmdc:mga05p37_231395_c1 nmdc:mga05p37_231395_c1_762_1253 160
327 3300050508 nmdc:mga09592_108307_c1 nmdc:mga09592_108307_c1_164_655 160
328 3300050508 nmdc:mga09592_136202_c1 nmdc:mga09592_136202_c1_1137_1628 160
329 3300050509 nmdc:mga0qj67_35455_c1 nmdc:mga0qj67_35455_c1_1032_1523 160
330 3300050511 nmdc:mga08y16_23008_c2 nmdc:mga08y16_23008_c2_2850_3341 160
331 3300050512 nmdc:mga0n895_4969_c1 nmdc:mga0n895_4969_c1_10358_10849 160
332 3300050514 nmdc:mga08x19_26334_c1 nmdc:mga08x19_26334_c1_680_1165 160
333 3300050515 nmdc:mga0a205_244973_c1 nmdc:mga0a205_244973_c1_139_630 160

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12850

Metallophos_2

Calcineurin-like phosphoesterase superfamily domain

40

182

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a22-assembly1.cif.gz_A structure of vacuolar protein sorting 29 from cryptosporidium parvum 0.8395 5 158
6tl0-assembly1.cif.gz_A solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 0.8217 1 158
5w8m-assembly5.cif.gz_E error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.817 7 158
5w8m-assembly6.cif.gz_F error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8128 6 158
6xs5-assembly1.cif.gz_A crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 0.8112 4 159
ID Description Score Start End Superfamily
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8842 7 157 3.60.21.10
af_A4I7S2_2_176_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8779 7 158 3.60.21.10
af_Q58040_34_189_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8523 7 157 3.60.21.10
af_Q5AB94_1_173_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8434 8 137 3.60.21.10
2a22A00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.8395 5 158 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V8IR48-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9935 7 158 GO:0016787
GO:0046872
AF-A0A843SM23-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9871 5 158 GO:0016787
GO:0046872
AF-A0A7W1PFF9-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9865 17 160 GO:0016787
GO:0046872
AF-A0A2V7ZQQ1-F1-model_v4 YfcE family phosphodiesterase 0.9823 6 120
AF-A0A143BK12-F1-model_v4 Phosphoesterase (EC 3.1.4.-) 0.9813 1 160 GO:0016787
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.36 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map