F411250
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 333 | 173 | 333 | 163 |
Family's Representative Sequence
| Representative Sequence | 3300005356|Ga0070674_100545539|Ga0070674_1005455392 |
| Length | 193 |
| Sequence | MISSISWLRGCWITWAWSIRWSRDGEPRPEVTGPNVTSRIVGLISDTHGLLRPDVHTAFAGVELILHAGDVGGDDILDELELIAPVRAVYGNTDAPGQPRLADAIDLSIGGVSIHVSHGHEIGSPVAAKLLERYAADVVVFGHTHRPLIARAGDRLVLNPGAAGPRRFEIMPSVARLTIQGGHADAELIALRA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 2 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 43 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 44 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 45 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 48 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 56 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 57 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 58 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 59 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 60 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 61 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 62 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 64 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 83 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 87 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 134 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 137 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 138 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 139 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 140 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 141 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 142 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 143 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 144 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 145 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 146 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 147 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 157 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 158 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 160 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 161 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 162 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 163 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 165 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 166 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 167 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 168 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 169 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 170 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 171 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 172 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 173 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.7 |
| Metatranscriptomes | 0.3 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.6 |
| Rhizosphere | 98.5 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10175176 | 3300005327 | Bacteria | 1803 |
| 2 | Ga0070676_10010045 | 3300005328 | Bacteria | 5126 |
| 3 | Ga0070683_100001197 | 3300005329 | Bacteria | 19738 |
| 4 | Ga0070683_100003932 | 3300005329 | Bacteria | 12153 |
| 5 | Ga0070683_100004138 | 3300005329 | Bacteria | 11889 |
| 6 | Ga0070683_100010166 | 3300005329 | Bacteria | 8076 |
| 7 | Ga0070683_100012025 | 3300005329 | Bacteria | 7507 |
| 8 | Ga0070683_100046550 | 3300005329 | Bacteria | 4008 |
| 9 | Ga0070683_100066304 | 3300005329 | Bacteria | 3363 |
| 10 | Ga0070683_100130635 | 3300005329 | Bacteria | 2377 |
| 11 | Ga0070683_100222681 | 3300005329 | Bacteria | 1793 |
| 12 | Ga0070690_101126651 | 3300005330 | Bacteria | 623 |
| 13 | Ga0070670_100017799 | 3300005331 | Bacteria | 6097 |
| 14 | Ga0070670_101588172 | 3300005331 | Bacteria | 601 |
| 15 | Ga0070677_10323015 | 3300005333 | Bacteria | 791 |
| 16 | Ga0068869_100120290 | 3300005334 | Unclassified | 2007 |
| 17 | Ga0070680_100107047 | 3300005336 | Bacteria | 2325 |
| 18 | Ga0070680_100109860 | 3300005336 | Unclassified | 2295 |
| 19 | Ga0070680_100144052 | 3300005336 | Bacteria | 1999 |
| 20 | Ga0070680_100354192 | 3300005336 | Bacteria | 1248 |
| 21 | Ga0068868_100053631 | 3300005338 | Bacteria | 3176 |
| 22 | Ga0068868_100832584 | 3300005338 | Unclassified | 835 |
| 23 | Ga0070660_100095037 | 3300005339 | Bacteria | 2355 |
| 24 | Ga0070660_100278648 | 3300005339 | Bacteria | 1368 |
| 25 | Ga0070689_100081066 | 3300005340 | Bacteria | 2547 |
| 26 | Ga0070689_100335668 | 3300005340 | Bacteria | 1265 |
| 27 | Ga0070661_100010151 | 3300005344 | Bacteria | 6540 |
| 28 | Ga0070661_100217638 | 3300005344 | Bacteria | 1464 |
| 29 | Ga0070661_100250283 | 3300005344 | Bacteria | 1367 |
| 30 | Ga0070692_10021465 | 3300005345 | Bacteria | 3141 |
| 31 | Ga0070668_100000182 | 3300005347 | Bacteria | 40680 |
| 32 | Ga0070668_100040826 | 3300005347 | Unclassified | 3552 |
| 33 | Ga0070669_100009204 | 3300005353 | Bacteria | 7038 |
| 34 | Ga0070669_100010402 | 3300005353 | Bacteria | 6607 |
| 35 | Ga0070669_100030374 | 3300005353 | Bacteria | 3899 |
| 36 | Ga0070675_100003899 | 3300005354 | Bacteria | 11305 |
| 37 | Ga0070675_100031259 | 3300005354 | Unclassified | 4303 |
| 38 | Ga0070675_100652240 | 3300005354 | Unclassified | 957 |
| 39 | Ga0070671_100095458 | 3300005355 | Bacteria | 2492 |
| 40 | Ga0070671_100204947 | 3300005355 | Bacteria | 1673 |
| 41 | Ga0070671_100303294 | 3300005355 | Bacteria | 1360 |
| 42 | Ga0070674_100052782 | 3300005356 | Bacteria | 2805 |
| 43 | Ga0070674_100055633 | 3300005356 | Unclassified | 2741 |
| 44 | Ga0070674_100545539 | 3300005356 | Unclassified | 972 |
| 45 | Ga0070674_100554160 | 3300005356 | Bacteria | 965 |
| 46 | Ga0070673_100412482 | 3300005364 | Bacteria | 1209 |
| 47 | Ga0070673_101084119 | 3300005364 | Bacteria | 748 |
| 48 | Ga0070688_100004471 | 3300005365 | Bacteria | 7280 |
| 49 | Ga0070688_100486883 | 3300005365 | Bacteria | 928 |
| 50 | Ga0070659_100047260 | 3300005366 | Unclassified | 3375 |
| 51 | Ga0070659_100261063 | 3300005366 | Unclassified | 1437 |
| 52 | Ga0070659_100375876 | 3300005366 | Bacteria | 1196 |
| 53 | Ga0070667_100003820 | 3300005367 | Bacteria | 12800 |
| 54 | Ga0070709_10012071 | 3300005434 | Bacteria | 4829 |
| 55 | Ga0070714_100056112 | 3300005435 | Bacteria | 3368 |
| 56 | Ga0070713_100019570 | 3300005436 | Bacteria | 5173 |
| 57 | Ga0070701_10039819 | 3300005438 | Unclassified | 2386 |
| 58 | Ga0070705_100540950 | 3300005440 | Unclassified | 891 |
| 59 | Ga0070663_100129762 | 3300005455 | Unclassified | 1913 |
| 60 | Ga0070663_100561933 | 3300005455 | Bacteria | 955 |
| 61 | Ga0070662_100004561 | 3300005457 | Bacteria | 8768 |
| 62 | Ga0070662_100072622 | 3300005457 | Bacteria | 2541 |
| 63 | Ga0070662_100384940 | 3300005457 | Bacteria | 1155 |
| 64 | Ga0070681_10003433 | 3300005458 | Bacteria | 14840 |
| 65 | Ga0070681_10013661 | 3300005458 | Bacteria | 8081 |
| 66 | Ga0070681_10022409 | 3300005458 | Bacteria | 6342 |
| 67 | Ga0070681_10321559 | 3300005458 | Bacteria | 1457 |
| 68 | Ga0068867_100012475 | 3300005459 | Bacteria | 6014 |
| 69 | Ga0068867_100037842 | 3300005459 | Bacteria | 3509 |
| 70 | Ga0068867_100342180 | 3300005459 | Bacteria | 1246 |
| 71 | Ga0068867_100660897 | 3300005459 | Bacteria | 918 |
| 72 | Ga0070685_10062474 | 3300005466 | Unclassified | 2184 |
| 73 | Ga0070698_100078372 | 3300005471 | Bacteria | 3303 |
| 74 | Ga0070679_100056961 | 3300005530 | Bacteria | 3895 |
| 75 | Ga0070684_100004298 | 3300005535 | Bacteria | 10813 |
| 76 | Ga0070684_100014420 | 3300005535 | Bacteria | 6403 |
| 77 | Ga0070684_100014626 | 3300005535 | Bacteria | 6364 |
| 78 | Ga0070684_100018463 | 3300005535 | Bacteria | 5745 |
| 79 | Ga0070684_100102653 | 3300005535 | Unclassified | 2557 |
| 80 | Ga0070684_100114112 | 3300005535 | Bacteria | 2425 |
| 81 | Ga0070684_100115070 | 3300005535 | Bacteria | 2415 |
| 82 | Ga0070684_100174827 | 3300005535 | Bacteria | 1951 |
| 83 | Ga0070684_100234204 | 3300005535 | Bacteria | 1677 |
| 84 | Ga0068853_100082758 | 3300005539 | Unclassified | 2811 |
| 85 | Ga0068853_100570573 | 3300005539 | Bacteria | 1073 |
| 86 | Ga0068853_100707639 | 3300005539 | Bacteria | 961 |
| 87 | Ga0070672_100005523 | 3300005543 | Bacteria | 8391 |
| 88 | Ga0070672_100021821 | 3300005543 | Bacteria | 4690 |
| 89 | Ga0070672_100071005 | 3300005543 | Bacteria | 2768 |
| 90 | Ga0070672_100143250 | 3300005543 | Bacteria | 1973 |
| 91 | Ga0068855_100024080 | 3300005563 | Bacteria | 7288 |
| 92 | Ga0068855_100041422 | 3300005563 | Bacteria | 5458 |
| 93 | Ga0070664_100005063 | 3300005564 | Bacteria | 10569 |
| 94 | Ga0070664_100011373 | 3300005564 | Bacteria | 7218 |
| 95 | Ga0070664_100026601 | 3300005564 | Bacteria | 4800 |
| 96 | Ga0070664_100032202 | 3300005564 | Bacteria | 4385 |
| 97 | Ga0070664_100239912 | 3300005564 | Unclassified | 1627 |
| 98 | Ga0070664_100453247 | 3300005564 | Bacteria | 1178 |
| 99 | Ga0070664_100867538 | 3300005564 | Bacteria | 845 |
| 100 | Ga0068857_100001192 | 3300005577 | Bacteria | 20294 |
| 101 | Ga0068857_100320651 | 3300005577 | Unclassified | 1431 |
| 102 | Ga0068856_100085038 | 3300005614 | Bacteria | 3143 |
| 103 | Ga0068856_100141196 | 3300005614 | Bacteria | 2416 |
| 104 | Ga0068852_100030340 | 3300005616 | Unclassified | 4449 |
| 105 | Ga0068852_100083884 | 3300005616 | Bacteria | 2834 |
| 106 | Ga0068852_100641599 | 3300005616 | Bacteria | 1069 |
| 107 | Ga0068859_102010341 | 3300005617 | Bacteria | 638 |
| 108 | Ga0068864_100211682 | 3300005618 | Unclassified | 1785 |
| 109 | Ga0068866_10765236 | 3300005718 | Unclassified | 668 |
| 110 | Ga0068861_100000655 | 3300005719 | Bacteria | 20560 |
| 111 | Ga0068861_100284651 | 3300005719 | Bacteria | 1425 |
| 112 | Ga0068851_10003280 | 3300005834 | Bacteria | 7182 |
| 113 | Ga0068851_10031946 | 3300005834 | Bacteria | 2618 |
| 114 | Ga0068870_10035706 | 3300005840 | Bacteria | 2553 |
| 115 | Ga0068863_100118485 | 3300005841 | Bacteria | 2523 |
| 116 | Ga0068858_100090457 | 3300005842 | Unclassified | 2848 |
| 117 | Ga0068858_100428758 | 3300005842 | Bacteria | 1272 |
| 118 | Ga0068860_100003859 | 3300005843 | Bacteria | 15399 |
| 119 | Ga0068862_100000513 | 3300005844 | Bacteria | 41174 |
| 120 | Ga0068862_100006983 | 3300005844 | Bacteria | 9369 |
| 121 | Ga0097621_100169573 | 3300006237 | Bacteria | 1881 |
| 122 | Ga0097621_100759272 | 3300006237 | Bacteria | 896 |
| 123 | Ga0068871_100528478 | 3300006358 | Bacteria | 1066 |
| 124 | Ga0075428_100039210 | 3300006844 | Bacteria | 5213 |
| 125 | Ga0075428_100241914 | 3300006844 | Bacteria | 1947 |
| 126 | Ga0075430_100000568 | 3300006846 | Bacteria | 28042 |
| 127 | Ga0075430_100003791 | 3300006846 | Bacteria | 12716 |
| 128 | Ga0075431_100082479 | 3300006847 | Bacteria | 3319 |
| 129 | Ga0075431_100135848 | 3300006847 | Bacteria | 2535 |
| 130 | Ga0075431_101101290 | 3300006847 | Unclassified | 759 |
| 131 | Ga0075433_10016502 | 3300006852 | Bacteria | 6090 |
| 132 | Ga0075434_100110892 | 3300006871 | Bacteria | 2754 |
| 133 | Ga0075434_100143792 | 3300006871 | Bacteria | 2405 |
| 134 | Ga0075434_101085511 | 3300006871 | Unclassified | 814 |
| 135 | Ga0075429_100048213 | 3300006880 | Bacteria | 3705 |
| 136 | Ga0075429_100271060 | 3300006880 | Bacteria | 1487 |
| 137 | Ga0068865_100003243 | 3300006881 | Bacteria | 9741 |
| 138 | Ga0097620_102010527 | 3300006931 | Bacteria | 638 |
| 139 | Ga0075435_100103973 | 3300007076 | Bacteria | 2356 |
| 140 | Ga0105240_10013617 | 3300009093 | Bacteria | 11157 |
| 141 | Ga0105240_10199400 | 3300009093 | Bacteria | 2347 |
| 142 | Ga0105240_10623775 | 3300009093 | Bacteria | 1185 |
| 143 | Ga0111539_10038142 | 3300009094 | Bacteria | 5797 |
| 144 | Ga0111539_10056050 | 3300009094 | Bacteria | 4686 |
| 145 | Ga0111539_10156096 | 3300009094 | Bacteria | 2670 |
| 146 | Ga0114129_10192864 | 3300009147 | Bacteria | 2765 |
| 147 | Ga0114129_10398327 | 3300009147 | Bacteria | 1815 |
| 148 | Ga0105241_10298016 | 3300009174 | Bacteria | 1383 |
| 149 | Ga0105242_10576225 | 3300009176 | Bacteria | 1083 |
| 150 | Ga0105248_10016000 | 3300009177 | Bacteria | 8258 |
| 151 | Ga0105248_10317159 | 3300009177 | Bacteria | 1756 |
| 152 | Ga0105248_10325431 | 3300009177 | Bacteria | 1731 |
| 153 | Ga0105248_11061611 | 3300009177 | Bacteria | 915 |
| 154 | Ga0105237_10087684 | 3300009545 | Bacteria | 3101 |
| 155 | Ga0105249_10000251 | 3300009553 | Bacteria | 59080 |
| 156 | Ga0105249_10000572 | 3300009553 | Bacteria | 33735 |
| 157 | Ga0105239_10015318 | 3300010375 | Bacteria | 8495 |
| 158 | Ga0157373_10119183 | 3300013100 | Bacteria | 1855 |
| 159 | Ga0157371_10002578 | 3300013102 | Bacteria | 17195 |
| 160 | Ga0157370_10034246 | 3300013104 | Bacteria | 4948 |
| 161 | Ga0157370_10037790 | 3300013104 | Unclassified | 4675 |
| 162 | Ga0157369_10051417 | 3300013105 | Bacteria | 4459 |
| 163 | Ga0157369_10415678 | 3300013105 | Bacteria | 1394 |
| 164 | Ga0157369_10554341 | 3300013105 | Bacteria | 1188 |
| 165 | Ga0157374_10051943 | 3300013296 | Bacteria | 3815 |
| 166 | Ga0157374_10691593 | 3300013296 | Unclassified | 1033 |
| 167 | Ga0163162_10000718 | 3300013306 | Bacteria | 30727 |
| 168 | Ga0157372_10015297 | 3300013307 | Bacteria | 8220 |
| 169 | Ga0157372_10023304 | 3300013307 | Bacteria | 6710 |
| 170 | Ga0157372_10121709 | 3300013307 | Unclassified | 2998 |
| 171 | Ga0157372_10183097 | 3300013307 | Unclassified | 2425 |
| 172 | Ga0157372_10315777 | 3300013307 | Bacteria | 1819 |
| 173 | Ga0157375_10054996 | 3300013308 | Bacteria | 3922 |
| 174 | Ga0157375_10864477 | 3300013308 | Bacteria | 1050 |
| 175 | Ga0157375_11304672 | 3300013308 | Bacteria | 853 |
| 176 | Ga0157380_11863873 | 3300014326 | Bacteria | 661 |
| 177 | Ga0157380_12293861 | 3300014326 | Bacteria | 604 |
| 178 | Ga0182008_10153834 | 3300014497 | Bacteria | 1154 |
| 179 | Ga0157377_10002781 | 3300014745 | Bacteria | 7797 |
| 180 | Ga0157377_10604099 | 3300014745 | Bacteria | 783 |
| 181 | Ga0157379_10002786 | 3300014968 | Bacteria | 14733 |
| 182 | Ga0163161_10757006 | 3300017792 | Bacteria | 813 |
| 183 | Ga0154015_1549141 | 3300020610 | Unclassified | 920 |
| 184 | Ga0213876_10498290 | 3300021384 | Unclassified | 648 |
| 185 | Ga0207656_10007497 | 3300025321 | Bacteria | 3977 |
| 186 | Ga0207656_10023061 | 3300025321 | Bacteria | 2503 |
| 187 | Ga0207680_10130112 | 3300025903 | Unclassified | 1658 |
| 188 | Ga0207699_10005732 | 3300025906 | Bacteria | 5973 |
| 189 | Ga0207645_10001472 | 3300025907 | Bacteria | 19240 |
| 190 | Ga0207643_10002389 | 3300025908 | Bacteria | 10186 |
| 191 | Ga0207707_10007585 | 3300025912 | Bacteria | 9455 |
| 192 | Ga0207707_10010563 | 3300025912 | Bacteria | 8016 |
| 193 | Ga0207707_10154395 | 3300025912 | Bacteria | 2007 |
| 194 | Ga0207695_10008836 | 3300025913 | Bacteria | 12546 |
| 195 | Ga0207695_10031517 | 3300025913 | Bacteria | 5811 |
| 196 | Ga0207660_10198860 | 3300025917 | Unclassified | 1565 |
| 197 | Ga0207660_10277089 | 3300025917 | Bacteria | 1330 |
| 198 | Ga0207660_10402537 | 3300025917 | Bacteria | 1102 |
| 199 | Ga0207662_10002218 | 3300025918 | Bacteria | 9686 |
| 200 | Ga0207657_10177540 | 3300025919 | Bacteria | 1723 |
| 201 | Ga0207649_10072881 | 3300025920 | Unclassified | 2199 |
| 202 | Ga0207649_10313561 | 3300025920 | Unclassified | 1150 |
| 203 | Ga0207652_10015544 | 3300025921 | Bacteria | 6191 |
| 204 | Ga0207652_10024349 | 3300025921 | Bacteria | 5022 |
| 205 | Ga0207681_10001166 | 3300025923 | Bacteria | 16947 |
| 206 | Ga0207681_10022218 | 3300025923 | Bacteria | 4043 |
| 207 | Ga0207650_10030859 | 3300025925 | Bacteria | 3866 |
| 208 | Ga0207650_10257083 | 3300025925 | Bacteria | 1416 |
| 209 | Ga0207650_10454190 | 3300025925 | Bacteria | 1067 |
| 210 | Ga0207659_10028959 | 3300025926 | Bacteria | 3768 |
| 211 | Ga0207659_10513296 | 3300025926 | Unclassified | 1016 |
| 212 | Ga0207664_10091166 | 3300025929 | Bacteria | 2499 |
| 213 | Ga0207644_10060222 | 3300025931 | Bacteria | 2747 |
| 214 | Ga0207644_10308599 | 3300025931 | Bacteria | 1277 |
| 215 | Ga0207690_10686733 | 3300025932 | Unclassified | 841 |
| 216 | Ga0207706_10000364 | 3300025933 | Bacteria | 48974 |
| 217 | Ga0207706_10124371 | 3300025933 | Bacteria | 2269 |
| 218 | Ga0207706_10217713 | 3300025933 | Bacteria | 1673 |
| 219 | Ga0207706_10295335 | 3300025933 | Bacteria | 1412 |
| 220 | Ga0207670_10398352 | 3300025936 | Bacteria | 1100 |
| 221 | Ga0207669_10082513 | 3300025937 | Unclassified | 2064 |
| 222 | Ga0207669_10097501 | 3300025937 | Bacteria | 1933 |
| 223 | Ga0207669_11024969 | 3300025937 | Unclassified | 694 |
| 224 | Ga0207704_10016626 | 3300025938 | Bacteria | 3787 |
| 225 | Ga0207704_10395678 | 3300025938 | Bacteria | 1089 |
| 226 | Ga0207665_10294725 | 3300025939 | Unclassified | 1211 |
| 227 | Ga0207691_10000471 | 3300025940 | Bacteria | 39874 |
| 228 | Ga0207691_10000745 | 3300025940 | Bacteria | 32134 |
| 229 | Ga0207691_10011271 | 3300025940 | Bacteria | 8576 |
| 230 | Ga0207691_10595226 | 3300025940 | Unclassified | 936 |
| 231 | Ga0207711_10031990 | 3300025941 | Unclassified | 4445 |
| 232 | Ga0207689_10117974 | 3300025942 | Bacteria | 2182 |
| 233 | Ga0207661_10005179 | 3300025944 | Bacteria | 9164 |
| 234 | Ga0207661_10054660 | 3300025944 | Bacteria | 3199 |
| 235 | Ga0207661_10128995 | 3300025944 | Bacteria | 2163 |
| 236 | Ga0207661_10136913 | 3300025944 | Bacteria | 2104 |
| 237 | Ga0207661_10298224 | 3300025944 | Unclassified | 1444 |
| 238 | Ga0207661_10315916 | 3300025944 | Bacteria | 1403 |
| 239 | Ga0207661_10583158 | 3300025944 | Bacteria | 1026 |
| 240 | Ga0207661_11325310 | 3300025944 | Unclassified | 661 |
| 241 | Ga0207661_11683555 | 3300025944 | Unclassified | 579 |
| 242 | Ga0207679_10003752 | 3300025945 | Bacteria | 9418 |
| 243 | Ga0207679_10004479 | 3300025945 | Bacteria | 8707 |
| 244 | Ga0207679_10017576 | 3300025945 | Bacteria | 4774 |
| 245 | Ga0207679_10029129 | 3300025945 | Bacteria | 3841 |
| 246 | Ga0207679_10415170 | 3300025945 | Bacteria | 1187 |
| 247 | Ga0207679_10574638 | 3300025945 | Bacteria | 1013 |
| 248 | Ga0207679_10630413 | 3300025945 | Bacteria | 968 |
| 249 | Ga0207667_10307961 | 3300025949 | Unclassified | 1618 |
| 250 | Ga0207651_11314948 | 3300025960 | Bacteria | 650 |
| 251 | Ga0207712_10005013 | 3300025961 | Bacteria | 8375 |
| 252 | Ga0207712_10009001 | 3300025961 | Bacteria | 6315 |
| 253 | Ga0207668_10006562 | 3300025972 | Bacteria | 6877 |
| 254 | Ga0207640_10017566 | 3300025981 | Unclassified | 4188 |
| 255 | Ga0207658_10272994 | 3300025986 | Bacteria | 1446 |
| 256 | Ga0207703_10089093 | 3300026035 | Bacteria | 2591 |
| 257 | Ga0207703_10816215 | 3300026035 | Bacteria | 891 |
| 258 | Ga0207639_10702284 | 3300026041 | Bacteria | 938 |
| 259 | Ga0207639_10713140 | 3300026041 | Bacteria | 931 |
| 260 | Ga0207639_10809836 | 3300026041 | Bacteria | 873 |
| 261 | Ga0207678_10033619 | 3300026067 | Bacteria | 4466 |
| 262 | Ga0207678_11510736 | 3300026067 | Bacteria | 593 |
| 263 | Ga0207708_10005639 | 3300026075 | Bacteria | 9243 |
| 264 | Ga0207702_10126232 | 3300026078 | Bacteria | 2297 |
| 265 | Ga0207641_10151194 | 3300026088 | Bacteria | 2102 |
| 266 | Ga0207648_10003275 | 3300026089 | Bacteria | 17030 |
| 267 | Ga0207648_10011164 | 3300026089 | Bacteria | 8474 |
| 268 | Ga0207648_10226686 | 3300026089 | Bacteria | 1662 |
| 269 | Ga0207648_10300682 | 3300026089 | Bacteria | 1439 |
| 270 | Ga0207648_10870306 | 3300026089 | Unclassified | 841 |
| 271 | Ga0207676_10094390 | 3300026095 | Bacteria | 2465 |
| 272 | Ga0207676_10107365 | 3300026095 | Unclassified | 2328 |
| 273 | Ga0207676_10309415 | 3300026095 | Bacteria | 1446 |
| 274 | Ga0207676_10617132 | 3300026095 | Unclassified | 1043 |
| 275 | Ga0207674_10000658 | 3300026116 | Bacteria | 44902 |
| 276 | Ga0207674_10003423 | 3300026116 | Bacteria | 19422 |
| 277 | Ga0207675_100000030 | 3300026118 | Bacteria | 109178 |
| 278 | Ga0207698_10031284 | 3300026142 | Unclassified | 3839 |
| 279 | Ga0207698_10072882 | 3300026142 | Bacteria | 2732 |
| 280 | Ga0207698_10555560 | 3300026142 | Bacteria | 1126 |
| 281 | Ga0207428_10039029 | 3300027907 | Bacteria | 3856 |
| 282 | Ga0207428_10067384 | 3300027907 | Unclassified | 2818 |
| 283 | Ga0268266_10141072 | 3300028379 | Unclassified | 2163 |
| 284 | Ga0268266_10415393 | 3300028379 | Unclassified | 1274 |
| 285 | Ga0268265_10001595 | 3300028380 | Bacteria | 18725 |
| 286 | Ga0268265_10017277 | 3300028380 | Bacteria | 4974 |
| 287 | Ga0307406_10003353 | 3300031901 | Bacteria | 8724 |
| 288 | Ga0307409_100468178 | 3300031995 | Bacteria | 1220 |
| 289 | Ga0307409_100962171 | 3300031995 | Bacteria | 870 |
| 290 | Ga0307416_100170781 | 3300032002 | Bacteria | 2024 |
| 291 | Ga0307416_100478187 | 3300032002 | Bacteria | 1305 |
| 292 | Ga0307414_10285525 | 3300032004 | Bacteria | 1389 |
| 293 | Ga0307415_100528637 | 3300032126 | Bacteria | 1037 |
| 294 | Ga0307415_100941594 | 3300032126 | Bacteria | 799 |
| 295 | Ga0373947_0171024 | 3300035725 | Unclassified | 1410 |
| 296 | Ga0436365_0651245 | 3300039437 | Unclassified | 812 |
| 297 | Ga0436365_1197150 | 3300039437 | Bacteria | 4647 |
| 298 | Ga0439461_0135281 | 3300041410 | Bacteria | 626 |
| 299 | Ga0466961_0375496 | 3300044693 | Unclassified | 864 |
| 300 | Ga0466963_0186869 | 3300044694 | Bacteria | 1447 |
| 301 | Ga0466967_0053122 | 3300045976 | Unclassified | 3560 |
| 302 | Ga0466967_0667929 | 3300045976 | Bacteria | 1028 |
| 303 | Ga0495629_0165318 | 3300046459 | Bacteria | 1536 |
| 304 | Ga0495594_0030066 | 3300046499 | Bacteria | 2937 |
| 305 | Ga0495630_0061439 | 3300046517 | Bacteria | 2821 |
| 306 | Ga0495666_0163411 | 3300046526 | Unclassified | 1032 |
| 307 | Ga0495586_0017888 | 3300046535 | Bacteria | 3770 |
| 308 | Ga0495633_0462282 | 3300046558 | Bacteria | 573 |
| 309 | Ga0495659_0271192 | 3300046664 | Bacteria | 711 |
| 310 | Ga0495588_0087613 | 3300046674 | Unclassified | 1629 |
| 311 | Ga0495670_0354382 | 3300046691 | Bacteria | 790 |
| 312 | Ga0496108_0650686 | 3300048911 | Unclassified | 916 |
| 313 | Ga0496109_0377991 | 3300048912 | Unclassified | 1338 |
| 314 | Ga0501033_0014123 | 3300049570 | Bacteria | 6071 |
| 315 | Ga0501034_0068530 | 3300049571 | Bacteria | 3558 |
| 316 | Ga0501038_0275375 | 3300049574 | Unclassified | 1326 |
| 317 | Ga0501043_0315954 | 3300049579 | Bacteria | 1191 |
| 318 | Ga0501047_0045161 | 3300049581 | Bacteria | 4259 |
| 319 | Ga0501070_0103151 | 3300049586 | Bacteria | 2359 |
| 320 | Ga0501261_036224 | 3300049690 | Bacteria | 763 |
| 321 | Ga0501035_0022570 | 3300049822 | Bacteria | 5780 |
| 322 | Ga0501044_0057879 | 3300049823 | Bacteria | 3976 |
| 323 | Ga0501044_0253870 | 3300049823 | Bacteria | 1698 |
| 324 | nmdc:mga05p37_173139_c1 | 3300050507 | Bacteria | 2631 |
| 325 | nmdc:mga05p37_231395_c1 | 3300050507 | Bacteria | 2226 |
| 326 | nmdc:mga09592_108307_c1 | 3300050508 | Unclassified | 1846 |
| 327 | nmdc:mga09592_136202_c1 | 3300050508 | Bacteria | 2115 |
| 328 | nmdc:mga0qj67_35455_c1 | 3300050509 | Bacteria | 3901 |
| 329 | nmdc:mga08y16_176433_c1 | 3300050511 | Bacteria | 2219 |
| 330 | nmdc:mga08y16_23008_c2 | 3300050511 | Bacteria | 6222 |
| 331 | nmdc:mga0n895_4969_c1 | 3300050512 | Bacteria | 11032 |
| 332 | nmdc:mga08x19_26334_c1 | 3300050514 | Bacteria | 1464 |
| 333 | nmdc:mga0a205_244973_c1 | 3300050515 | Bacteria | 1673 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10317159 | Ga0105248_103171591 | 156 |
| 2 | 3300013296 | Ga0157374_10691593 | Ga0157374_106915932 | 156 |
| 3 | 3300026095 | Ga0207676_10309415 | Ga0207676_103094152 | 156 |
| 4 | 3300032126 | Ga0307415_100528637 | Ga0307415_1005286372 | 156 |
| 5 | 3300041410 | Ga0439461_0135281 | Ga0439461_0135281_47_520 | 156 |
| 6 | 3300048911 | Ga0496108_0650686 | Ga0496108_0650686_431_901 | 156 |
| 7 | 3300048912 | Ga0496109_0377991 | Ga0496109_0377991_829_1299 | 156 |
| 8 | 3300045976 | Ga0466967_0667929 | Ga0466967_0667929_110_583 | 157 |
| 9 | 3300005336 | Ga0070680_100354192 | Ga0070680_1003541922 | 158 |
| 10 | 3300005535 | Ga0070684_100018463 | Ga0070684_1000184634 | 158 |
| 11 | 3300005543 | Ga0070672_100071005 | Ga0070672_1000710053 | 158 |
| 12 | 3300005617 | Ga0068859_102010341 | Ga0068859_1020103411 | 158 |
| 13 | 3300005719 | Ga0068861_100284651 | Ga0068861_1002846512 | 158 |
| 14 | 3300005840 | Ga0068870_10035706 | Ga0068870_100357063 | 158 |
| 15 | 3300006844 | Ga0075428_100241914 | Ga0075428_1002419143 | 158 |
| 16 | 3300006931 | Ga0097620_102010527 | Ga0097620_1020105272 | 158 |
| 17 | 3300009094 | Ga0111539_10156096 | Ga0111539_101560963 | 158 |
| 18 | 3300009147 | Ga0114129_10398327 | Ga0114129_103983272 | 158 |
| 19 | 3300009553 | Ga0105249_10000251 | Ga0105249_1000025120 | 158 |
| 20 | 3300013308 | Ga0157375_10054996 | Ga0157375_100549963 | 158 |
| 21 | 3300017792 | Ga0163161_10757006 | Ga0163161_107570062 | 158 |
| 22 | 3300025933 | Ga0207706_10217713 | Ga0207706_102177133 | 158 |
| 23 | 3300025944 | Ga0207661_10583158 | Ga0207661_105831582 | 158 |
| 24 | 3300026089 | Ga0207648_10226686 | Ga0207648_102266863 | 158 |
| 25 | 3300032002 | Ga0307416_100170781 | Ga0307416_1001707813 | 158 |
| 26 | 3300050507 | nmdc:mga05p37_173139_c1 | nmdc:mga05p37_173139_c1_1053_1529 | 158 |
| 27 | 3300050511 | nmdc:mga08y16_176433_c1 | nmdc:mga08y16_176433_c1_881_1357 | 158 |
| 28 | 3300028379 | Ga0268266_10415393 | Ga0268266_104153932 | 159 |
| 29 | 3300044693 | Ga0466961_0375496 | Ga0466961_0375496_368_847 | 159 |
| 30 | 3300005327 | Ga0070658_10175176 | Ga0070658_101751763 | 160 |
| 31 | 3300005328 | Ga0070676_10010045 | Ga0070676_100100455 | 160 |
| 32 | 3300005329 | Ga0070683_100001197 | Ga0070683_10000119717 | 160 |
| 33 | 3300005329 | Ga0070683_100003932 | Ga0070683_1000039325 | 160 |
| 34 | 3300005329 | Ga0070683_100004138 | Ga0070683_1000041389 | 160 |
| 35 | 3300005329 | Ga0070683_100010166 | Ga0070683_1000101662 | 160 |
| 36 | 3300005329 | Ga0070683_100012025 | Ga0070683_1000120252 | 160 |
| 37 | 3300005329 | Ga0070683_100046550 | Ga0070683_1000465502 | 160 |
| 38 | 3300005329 | Ga0070683_100066304 | Ga0070683_1000663043 | 160 |
| 39 | 3300005329 | Ga0070683_100130635 | Ga0070683_1001306354 | 160 |
| 40 | 3300005329 | Ga0070683_100222681 | Ga0070683_1002226811 | 160 |
| 41 | 3300005330 | Ga0070690_101126651 | Ga0070690_1011266511 | 160 |
| 42 | 3300005331 | Ga0070670_100017799 | Ga0070670_1000177993 | 160 |
| 43 | 3300005331 | Ga0070670_101588172 | Ga0070670_1015881721 | 160 |
| 44 | 3300005333 | Ga0070677_10323015 | Ga0070677_103230152 | 160 |
| 45 | 3300005334 | Ga0068869_100120290 | Ga0068869_1001202901 | 160 |
| 46 | 3300005336 | Ga0070680_100107047 | Ga0070680_1001070471 | 160 |
| 47 | 3300005336 | Ga0070680_100109860 | Ga0070680_1001098603 | 160 |
| 48 | 3300005336 | Ga0070680_100144052 | Ga0070680_1001440522 | 160 |
| 49 | 3300005338 | Ga0068868_100053631 | Ga0068868_1000536311 | 160 |
| 50 | 3300005338 | Ga0068868_100832584 | Ga0068868_1008325842 | 160 |
| 51 | 3300005339 | Ga0070660_100095037 | Ga0070660_1000950373 | 160 |
| 52 | 3300005339 | Ga0070660_100278648 | Ga0070660_1002786482 | 160 |
| 53 | 3300005340 | Ga0070689_100081066 | Ga0070689_1000810664 | 160 |
| 54 | 3300005340 | Ga0070689_100335668 | Ga0070689_1003356682 | 160 |
| 55 | 3300005344 | Ga0070661_100010151 | Ga0070661_1000101513 | 160 |
| 56 | 3300005344 | Ga0070661_100217638 | Ga0070661_1002176383 | 160 |
| 57 | 3300005344 | Ga0070661_100250283 | Ga0070661_1002502832 | 160 |
| 58 | 3300005345 | Ga0070692_10021465 | Ga0070692_100214653 | 160 |
| 59 | 3300005347 | Ga0070668_100000182 | Ga0070668_10000018218 | 160 |
| 60 | 3300005347 | Ga0070668_100040826 | Ga0070668_1000408263 | 160 |
| 61 | 3300005353 | Ga0070669_100009204 | Ga0070669_1000092047 | 160 |
| 62 | 3300005353 | Ga0070669_100010402 | Ga0070669_1000104023 | 160 |
| 63 | 3300005353 | Ga0070669_100030374 | Ga0070669_1000303742 | 160 |
| 64 | 3300005354 | Ga0070675_100003899 | Ga0070675_10000389913 | 160 |
| 65 | 3300005354 | Ga0070675_100031259 | Ga0070675_1000312593 | 160 |
| 66 | 3300005354 | Ga0070675_100652240 | Ga0070675_1006522402 | 160 |
| 67 | 3300005355 | Ga0070671_100095458 | Ga0070671_1000954583 | 160 |
| 68 | 3300005355 | Ga0070671_100204947 | Ga0070671_1002049473 | 160 |
| 69 | 3300005355 | Ga0070671_100303294 | Ga0070671_1003032942 | 160 |
| 70 | 3300005356 | Ga0070674_100052782 | Ga0070674_1000527823 | 160 |
| 71 | 3300005356 | Ga0070674_100055633 | Ga0070674_1000556333 | 160 |
| 72 | 3300005356 | Ga0070674_100545539 | Ga0070674_1005455392 | 160 |
| 73 | 3300005356 | Ga0070674_100554160 | Ga0070674_1005541602 | 160 |
| 74 | 3300005364 | Ga0070673_100412482 | Ga0070673_1004124823 | 160 |
| 75 | 3300005364 | Ga0070673_101084119 | Ga0070673_1010841191 | 160 |
| 76 | 3300005365 | Ga0070688_100004471 | Ga0070688_1000044713 | 160 |
| 77 | 3300005365 | Ga0070688_100486883 | Ga0070688_1004868831 | 160 |
| 78 | 3300005366 | Ga0070659_100047260 | Ga0070659_1000472603 | 160 |
| 79 | 3300005366 | Ga0070659_100261063 | Ga0070659_1002610633 | 160 |
| 80 | 3300005366 | Ga0070659_100375876 | Ga0070659_1003758762 | 160 |
| 81 | 3300005367 | Ga0070667_100003820 | Ga0070667_1000038207 | 160 |
| 82 | 3300005434 | Ga0070709_10012071 | Ga0070709_100120714 | 160 |
| 83 | 3300005435 | Ga0070714_100056112 | Ga0070714_1000561123 | 160 |
| 84 | 3300005436 | Ga0070713_100019570 | Ga0070713_1000195704 | 160 |
| 85 | 3300005438 | Ga0070701_10039819 | Ga0070701_100398193 | 160 |
| 86 | 3300005440 | Ga0070705_100540950 | Ga0070705_1005409502 | 160 |
| 87 | 3300005455 | Ga0070663_100129762 | Ga0070663_1001297622 | 160 |
| 88 | 3300005455 | Ga0070663_100561933 | Ga0070663_1005619332 | 160 |
| 89 | 3300005457 | Ga0070662_100004561 | Ga0070662_1000045614 | 160 |
| 90 | 3300005457 | Ga0070662_100072622 | Ga0070662_1000726224 | 160 |
| 91 | 3300005457 | Ga0070662_100384940 | Ga0070662_1003849401 | 160 |
| 92 | 3300005458 | Ga0070681_10003433 | Ga0070681_1000343314 | 160 |
| 93 | 3300005458 | Ga0070681_10013661 | Ga0070681_100136615 | 160 |
| 94 | 3300005458 | Ga0070681_10022409 | Ga0070681_100224096 | 160 |
| 95 | 3300005458 | Ga0070681_10321559 | Ga0070681_103215592 | 160 |
| 96 | 3300005459 | Ga0068867_100012475 | Ga0068867_1000124754 | 160 |
| 97 | 3300005459 | Ga0068867_100037842 | Ga0068867_1000378422 | 160 |
| 98 | 3300005459 | Ga0068867_100342180 | Ga0068867_1003421802 | 160 |
| 99 | 3300005459 | Ga0068867_100660897 | Ga0068867_1006608972 | 160 |
| 100 | 3300005466 | Ga0070685_10062474 | Ga0070685_100624743 | 160 |
| 101 | 3300005471 | Ga0070698_100078372 | Ga0070698_1000783722 | 160 |
| 102 | 3300005530 | Ga0070679_100056961 | Ga0070679_1000569614 | 160 |
| 103 | 3300005535 | Ga0070684_100004298 | Ga0070684_1000042985 | 160 |
| 104 | 3300005535 | Ga0070684_100014420 | Ga0070684_1000144207 | 160 |
| 105 | 3300005535 | Ga0070684_100014626 | Ga0070684_1000146266 | 160 |
| 106 | 3300005535 | Ga0070684_100102653 | Ga0070684_1001026532 | 160 |
| 107 | 3300005535 | Ga0070684_100114112 | Ga0070684_1001141123 | 160 |
| 108 | 3300005535 | Ga0070684_100115070 | Ga0070684_1001150703 | 160 |
| 109 | 3300005535 | Ga0070684_100174827 | Ga0070684_1001748272 | 160 |
| 110 | 3300005535 | Ga0070684_100234204 | Ga0070684_1002342041 | 160 |
| 111 | 3300005539 | Ga0068853_100082758 | Ga0068853_1000827582 | 160 |
| 112 | 3300005539 | Ga0068853_100570573 | Ga0068853_1005705732 | 160 |
| 113 | 3300005539 | Ga0068853_100707639 | Ga0068853_1007076392 | 160 |
| 114 | 3300005543 | Ga0070672_100005523 | Ga0070672_1000055237 | 160 |
| 115 | 3300005543 | Ga0070672_100021821 | Ga0070672_1000218215 | 160 |
| 116 | 3300005543 | Ga0070672_100143250 | Ga0070672_1001432504 | 160 |
| 117 | 3300005563 | Ga0068855_100024080 | Ga0068855_1000240805 | 160 |
| 118 | 3300005563 | Ga0068855_100041422 | Ga0068855_1000414224 | 160 |
| 119 | 3300005564 | Ga0070664_100005063 | Ga0070664_1000050637 | 160 |
| 120 | 3300005564 | Ga0070664_100011373 | Ga0070664_1000113734 | 160 |
| 121 | 3300005564 | Ga0070664_100026601 | Ga0070664_1000266014 | 160 |
| 122 | 3300005564 | Ga0070664_100032202 | Ga0070664_1000322022 | 160 |
| 123 | 3300005564 | Ga0070664_100239912 | Ga0070664_1002399123 | 160 |
| 124 | 3300005564 | Ga0070664_100453247 | Ga0070664_1004532472 | 160 |
| 125 | 3300005564 | Ga0070664_100867538 | Ga0070664_1008675382 | 160 |
| 126 | 3300005577 | Ga0068857_100001192 | Ga0068857_1000011929 | 160 |
| 127 | 3300005577 | Ga0068857_100320651 | Ga0068857_1003206513 | 160 |
| 128 | 3300005614 | Ga0068856_100085038 | Ga0068856_1000850383 | 160 |
| 129 | 3300005614 | Ga0068856_100141196 | Ga0068856_1001411962 | 160 |
| 130 | 3300005616 | Ga0068852_100030340 | Ga0068852_1000303403 | 160 |
| 131 | 3300005616 | Ga0068852_100083884 | Ga0068852_1000838843 | 160 |
| 132 | 3300005616 | Ga0068852_100641599 | Ga0068852_1006415994 | 160 |
| 133 | 3300005618 | Ga0068864_100211682 | Ga0068864_1002116822 | 160 |
| 134 | 3300005718 | Ga0068866_10765236 | Ga0068866_107652361 | 160 |
| 135 | 3300005719 | Ga0068861_100000655 | Ga0068861_1000006558 | 160 |
| 136 | 3300005834 | Ga0068851_10003280 | Ga0068851_100032805 | 160 |
| 137 | 3300005834 | Ga0068851_10031946 | Ga0068851_100319463 | 160 |
| 138 | 3300005841 | Ga0068863_100118485 | Ga0068863_1001184852 | 160 |
| 139 | 3300005842 | Ga0068858_100090457 | Ga0068858_1000904572 | 160 |
| 140 | 3300005842 | Ga0068858_100428758 | Ga0068858_1004287582 | 160 |
| 141 | 3300005843 | Ga0068860_100003859 | Ga0068860_10000385911 | 160 |
| 142 | 3300005844 | Ga0068862_100000513 | Ga0068862_10000051333 | 160 |
| 143 | 3300005844 | Ga0068862_100006983 | Ga0068862_1000069839 | 160 |
| 144 | 3300006237 | Ga0097621_100169573 | Ga0097621_1001695732 | 160 |
| 145 | 3300006237 | Ga0097621_100759272 | Ga0097621_1007592722 | 160 |
| 146 | 3300006358 | Ga0068871_100528478 | Ga0068871_1005284782 | 160 |
| 147 | 3300006844 | Ga0075428_100039210 | Ga0075428_1000392105 | 160 |
| 148 | 3300006846 | Ga0075430_100000568 | Ga0075430_1000005684 | 160 |
| 149 | 3300006846 | Ga0075430_100003791 | Ga0075430_1000037915 | 160 |
| 150 | 3300006847 | Ga0075431_100082479 | Ga0075431_1000824794 | 160 |
| 151 | 3300006847 | Ga0075431_100135848 | Ga0075431_1001358483 | 160 |
| 152 | 3300006847 | Ga0075431_101101290 | Ga0075431_1011012901 | 160 |
| 153 | 3300006852 | Ga0075433_10016502 | Ga0075433_100165027 | 160 |
| 154 | 3300006871 | Ga0075434_100110892 | Ga0075434_1001108924 | 160 |
| 155 | 3300006871 | Ga0075434_100143792 | Ga0075434_1001437922 | 160 |
| 156 | 3300006871 | Ga0075434_101085511 | Ga0075434_1010855112 | 160 |
| 157 | 3300006880 | Ga0075429_100048213 | Ga0075429_1000482134 | 160 |
| 158 | 3300006880 | Ga0075429_100271060 | Ga0075429_1002710603 | 160 |
| 159 | 3300006881 | Ga0068865_100003243 | Ga0068865_1000032437 | 160 |
| 160 | 3300007076 | Ga0075435_100103973 | Ga0075435_1001039733 | 160 |
| 161 | 3300009093 | Ga0105240_10013617 | Ga0105240_100136179 | 160 |
| 162 | 3300009093 | Ga0105240_10199400 | Ga0105240_101994002 | 160 |
| 163 | 3300009093 | Ga0105240_10623775 | Ga0105240_106237752 | 160 |
| 164 | 3300009094 | Ga0111539_10038142 | Ga0111539_100381426 | 160 |
| 165 | 3300009094 | Ga0111539_10056050 | Ga0111539_100560503 | 160 |
| 166 | 3300009147 | Ga0114129_10192864 | Ga0114129_101928643 | 160 |
| 167 | 3300009174 | Ga0105241_10298016 | Ga0105241_102980163 | 160 |
| 168 | 3300009176 | Ga0105242_10576225 | Ga0105242_105762252 | 160 |
| 169 | 3300009177 | Ga0105248_10016000 | Ga0105248_100160007 | 160 |
| 170 | 3300009177 | Ga0105248_10325431 | Ga0105248_103254312 | 160 |
| 171 | 3300009177 | Ga0105248_11061611 | Ga0105248_110616112 | 160 |
| 172 | 3300009545 | Ga0105237_10087684 | Ga0105237_100876842 | 160 |
| 173 | 3300009553 | Ga0105249_10000572 | Ga0105249_1000057229 | 160 |
| 174 | 3300010375 | Ga0105239_10015318 | Ga0105239_100153185 | 160 |
| 175 | 3300013100 | Ga0157373_10119183 | Ga0157373_101191833 | 160 |
| 176 | 3300013102 | Ga0157371_10002578 | Ga0157371_1000257818 | 160 |
| 177 | 3300013104 | Ga0157370_10034246 | Ga0157370_100342462 | 160 |
| 178 | 3300013104 | Ga0157370_10037790 | Ga0157370_100377904 | 160 |
| 179 | 3300013105 | Ga0157369_10051417 | Ga0157369_100514171 | 160 |
| 180 | 3300013105 | Ga0157369_10415678 | Ga0157369_104156783 | 160 |
| 181 | 3300013105 | Ga0157369_10554341 | Ga0157369_105543412 | 160 |
| 182 | 3300013296 | Ga0157374_10051943 | Ga0157374_100519433 | 160 |
| 183 | 3300013306 | Ga0163162_10000718 | Ga0163162_100007187 | 160 |
| 184 | 3300013307 | Ga0157372_10015297 | Ga0157372_100152975 | 160 |
| 185 | 3300013307 | Ga0157372_10023304 | Ga0157372_100233044 | 160 |
| 186 | 3300013307 | Ga0157372_10121709 | Ga0157372_101217093 | 160 |
| 187 | 3300013307 | Ga0157372_10183097 | Ga0157372_101830974 | 160 |
| 188 | 3300013307 | Ga0157372_10315777 | Ga0157372_103157772 | 160 |
| 189 | 3300013308 | Ga0157375_10864477 | Ga0157375_108644772 | 160 |
| 190 | 3300013308 | Ga0157375_11304672 | Ga0157375_113046722 | 160 |
| 191 | 3300014326 | Ga0157380_11863873 | Ga0157380_118638732 | 160 |
| 192 | 3300014326 | Ga0157380_12293861 | Ga0157380_122938611 | 160 |
| 193 | 3300014497 | Ga0182008_10153834 | Ga0182008_101538341 | 160 |
| 194 | 3300014745 | Ga0157377_10002781 | Ga0157377_100027815 | 160 |
| 195 | 3300014745 | Ga0157377_10604099 | Ga0157377_106040991 | 160 |
| 196 | 3300014968 | Ga0157379_10002786 | Ga0157379_100027867 | 160 |
| 197 | 3300020610 | Ga0154015_1549141 | Ga0154015_15491412 | 160 |
| 198 | 3300021384 | Ga0213876_10498290 | Ga0213876_104982902 | 160 |
| 199 | 3300025321 | Ga0207656_10007497 | Ga0207656_100074972 | 160 |
| 200 | 3300025321 | Ga0207656_10023061 | Ga0207656_100230614 | 160 |
| 201 | 3300025903 | Ga0207680_10130112 | Ga0207680_101301122 | 160 |
| 202 | 3300025906 | Ga0207699_10005732 | Ga0207699_100057326 | 160 |
| 203 | 3300025907 | Ga0207645_10001472 | Ga0207645_1000147220 | 160 |
| 204 | 3300025908 | Ga0207643_10002389 | Ga0207643_100023894 | 160 |
| 205 | 3300025912 | Ga0207707_10007585 | Ga0207707_100075853 | 160 |
| 206 | 3300025912 | Ga0207707_10010563 | Ga0207707_100105635 | 160 |
| 207 | 3300025912 | Ga0207707_10154395 | Ga0207707_101543952 | 160 |
| 208 | 3300025913 | Ga0207695_10008836 | Ga0207695_1000883612 | 160 |
| 209 | 3300025913 | Ga0207695_10031517 | Ga0207695_100315175 | 160 |
| 210 | 3300025917 | Ga0207660_10198860 | Ga0207660_101988602 | 160 |
| 211 | 3300025917 | Ga0207660_10277089 | Ga0207660_102770892 | 160 |
| 212 | 3300025917 | Ga0207660_10402537 | Ga0207660_104025372 | 160 |
| 213 | 3300025918 | Ga0207662_10002218 | Ga0207662_100022188 | 160 |
| 214 | 3300025919 | Ga0207657_10177540 | Ga0207657_101775403 | 160 |
| 215 | 3300025920 | Ga0207649_10072881 | Ga0207649_100728813 | 160 |
| 216 | 3300025920 | Ga0207649_10313561 | Ga0207649_103135612 | 160 |
| 217 | 3300025921 | Ga0207652_10015544 | Ga0207652_100155445 | 160 |
| 218 | 3300025921 | Ga0207652_10024349 | Ga0207652_100243493 | 160 |
| 219 | 3300025923 | Ga0207681_10001166 | Ga0207681_1000116615 | 160 |
| 220 | 3300025923 | Ga0207681_10022218 | Ga0207681_100222184 | 160 |
| 221 | 3300025925 | Ga0207650_10030859 | Ga0207650_100308592 | 160 |
| 222 | 3300025925 | Ga0207650_10257083 | Ga0207650_102570832 | 160 |
| 223 | 3300025925 | Ga0207650_10454190 | Ga0207650_104541902 | 160 |
| 224 | 3300025926 | Ga0207659_10028959 | Ga0207659_100289595 | 160 |
| 225 | 3300025926 | Ga0207659_10513296 | Ga0207659_105132962 | 160 |
| 226 | 3300025929 | Ga0207664_10091166 | Ga0207664_100911664 | 160 |
| 227 | 3300025931 | Ga0207644_10060222 | Ga0207644_100602223 | 160 |
| 228 | 3300025931 | Ga0207644_10308599 | Ga0207644_103085992 | 160 |
| 229 | 3300025932 | Ga0207690_10686733 | Ga0207690_106867331 | 160 |
| 230 | 3300025933 | Ga0207706_10000364 | Ga0207706_1000036419 | 160 |
| 231 | 3300025933 | Ga0207706_10124371 | Ga0207706_101243713 | 160 |
| 232 | 3300025933 | Ga0207706_10295335 | Ga0207706_102953353 | 160 |
| 233 | 3300025936 | Ga0207670_10398352 | Ga0207670_103983522 | 160 |
| 234 | 3300025937 | Ga0207669_10082513 | Ga0207669_100825133 | 160 |
| 235 | 3300025937 | Ga0207669_10097501 | Ga0207669_100975013 | 160 |
| 236 | 3300025937 | Ga0207669_11024969 | Ga0207669_110249691 | 160 |
| 237 | 3300025938 | Ga0207704_10016626 | Ga0207704_100166261 | 160 |
| 238 | 3300025938 | Ga0207704_10395678 | Ga0207704_103956782 | 160 |
| 239 | 3300025939 | Ga0207665_10294725 | Ga0207665_102947253 | 160 |
| 240 | 3300025940 | Ga0207691_10000471 | Ga0207691_100004713 | 160 |
| 241 | 3300025940 | Ga0207691_10000745 | Ga0207691_1000074510 | 160 |
| 242 | 3300025940 | Ga0207691_10011271 | Ga0207691_100112716 | 160 |
| 243 | 3300025940 | Ga0207691_10595226 | Ga0207691_105952263 | 160 |
| 244 | 3300025941 | Ga0207711_10031990 | Ga0207711_100319903 | 160 |
| 245 | 3300025942 | Ga0207689_10117974 | Ga0207689_101179743 | 160 |
| 246 | 3300025944 | Ga0207661_10005179 | Ga0207661_100051795 | 160 |
| 247 | 3300025944 | Ga0207661_10054660 | Ga0207661_100546603 | 160 |
| 248 | 3300025944 | Ga0207661_10128995 | Ga0207661_101289953 | 160 |
| 249 | 3300025944 | Ga0207661_10136913 | Ga0207661_101369133 | 160 |
| 250 | 3300025944 | Ga0207661_10298224 | Ga0207661_102982243 | 160 |
| 251 | 3300025944 | Ga0207661_10315916 | Ga0207661_103159161 | 160 |
| 252 | 3300025944 | Ga0207661_11325310 | Ga0207661_113253102 | 160 |
| 253 | 3300025944 | Ga0207661_11683555 | Ga0207661_116835552 | 160 |
| 254 | 3300025945 | Ga0207679_10003752 | Ga0207679_100037529 | 160 |
| 255 | 3300025945 | Ga0207679_10004479 | Ga0207679_100044796 | 160 |
| 256 | 3300025945 | Ga0207679_10017576 | Ga0207679_100175765 | 160 |
| 257 | 3300025945 | Ga0207679_10029129 | Ga0207679_100291295 | 160 |
| 258 | 3300025945 | Ga0207679_10415170 | Ga0207679_104151703 | 160 |
| 259 | 3300025945 | Ga0207679_10574638 | Ga0207679_105746382 | 160 |
| 260 | 3300025945 | Ga0207679_10630413 | Ga0207679_106304132 | 160 |
| 261 | 3300025949 | Ga0207667_10307961 | Ga0207667_103079612 | 160 |
| 262 | 3300025960 | Ga0207651_11314948 | Ga0207651_113149481 | 160 |
| 263 | 3300025961 | Ga0207712_10005013 | Ga0207712_100050139 | 160 |
| 264 | 3300025961 | Ga0207712_10009001 | Ga0207712_100090016 | 160 |
| 265 | 3300025972 | Ga0207668_10006562 | Ga0207668_100065624 | 160 |
| 266 | 3300025981 | Ga0207640_10017566 | Ga0207640_100175664 | 160 |
| 267 | 3300025986 | Ga0207658_10272994 | Ga0207658_102729941 | 160 |
| 268 | 3300026035 | Ga0207703_10089093 | Ga0207703_100890932 | 160 |
| 269 | 3300026035 | Ga0207703_10816215 | Ga0207703_108162151 | 160 |
| 270 | 3300026041 | Ga0207639_10702284 | Ga0207639_107022842 | 160 |
| 271 | 3300026041 | Ga0207639_10713140 | Ga0207639_107131402 | 160 |
| 272 | 3300026041 | Ga0207639_10809836 | Ga0207639_108098361 | 160 |
| 273 | 3300026067 | Ga0207678_10033619 | Ga0207678_100336195 | 160 |
| 274 | 3300026067 | Ga0207678_11510736 | Ga0207678_115107361 | 160 |
| 275 | 3300026075 | Ga0207708_10005639 | Ga0207708_100056395 | 160 |
| 276 | 3300026078 | Ga0207702_10126232 | Ga0207702_101262323 | 160 |
| 277 | 3300026088 | Ga0207641_10151194 | Ga0207641_101511943 | 160 |
| 278 | 3300026089 | Ga0207648_10003275 | Ga0207648_100032755 | 160 |
| 279 | 3300026089 | Ga0207648_10011164 | Ga0207648_100111644 | 160 |
| 280 | 3300026089 | Ga0207648_10300682 | Ga0207648_103006823 | 160 |
| 281 | 3300026089 | Ga0207648_10870306 | Ga0207648_108703061 | 160 |
| 282 | 3300026095 | Ga0207676_10094390 | Ga0207676_100943902 | 160 |
| 283 | 3300026095 | Ga0207676_10107365 | Ga0207676_101073652 | 160 |
| 284 | 3300026095 | Ga0207676_10617132 | Ga0207676_106171322 | 160 |
| 285 | 3300026116 | Ga0207674_10000658 | Ga0207674_1000065816 | 160 |
| 286 | 3300026116 | Ga0207674_10003423 | Ga0207674_1000342319 | 160 |
| 287 | 3300026118 | Ga0207675_100000030 | Ga0207675_10000003072 | 160 |
| 288 | 3300026142 | Ga0207698_10031284 | Ga0207698_100312844 | 160 |
| 289 | 3300026142 | Ga0207698_10072882 | Ga0207698_100728823 | 160 |
| 290 | 3300026142 | Ga0207698_10555560 | Ga0207698_105555602 | 160 |
| 291 | 3300027907 | Ga0207428_10039029 | Ga0207428_100390291 | 160 |
| 292 | 3300027907 | Ga0207428_10067384 | Ga0207428_100673844 | 160 |
| 293 | 3300028379 | Ga0268266_10141072 | Ga0268266_101410722 | 160 |
| 294 | 3300028380 | Ga0268265_10001595 | Ga0268265_1000159516 | 160 |
| 295 | 3300028380 | Ga0268265_10017277 | Ga0268265_100172773 | 160 |
| 296 | 3300031901 | Ga0307406_10003353 | Ga0307406_100033538 | 160 |
| 297 | 3300031995 | Ga0307409_100468178 | Ga0307409_1004681782 | 160 |
| 298 | 3300031995 | Ga0307409_100962171 | Ga0307409_1009621712 | 160 |
| 299 | 3300032002 | Ga0307416_100478187 | Ga0307416_1004781872 | 160 |
| 300 | 3300032004 | Ga0307414_10285525 | Ga0307414_102855253 | 160 |
| 301 | 3300032126 | Ga0307415_100941594 | Ga0307415_1009415941 | 160 |
| 302 | 3300035725 | Ga0373947_0171024 | Ga0373947_0171024_726_1211 | 160 |
| 303 | 3300039437 | Ga0436365_0651245 | Ga0436365_0651245_169_651 | 160 |
| 304 | 3300039437 | Ga0436365_1197150 | Ga0436365_1197150_2174_2659 | 160 |
| 305 | 3300044694 | Ga0466963_0186869 | Ga0466963_0186869_298_789 | 160 |
| 306 | 3300045976 | Ga0466967_0053122 | Ga0466967_0053122_2745_3230 | 160 |
| 307 | 3300046459 | Ga0495629_0165318 | Ga0495629_0165318_853_1338 | 160 |
| 308 | 3300046499 | Ga0495594_0030066 | Ga0495594_0030066_2401_2883 | 160 |
| 309 | 3300046517 | Ga0495630_0061439 | Ga0495630_0061439_420_905 | 160 |
| 310 | 3300046526 | Ga0495666_0163411 | Ga0495666_0163411_299_784 | 160 |
| 311 | 3300046535 | Ga0495586_0017888 | Ga0495586_0017888_2802_3287 | 160 |
| 312 | 3300046558 | Ga0495633_0462282 | Ga0495633_0462282_32_523 | 160 |
| 313 | 3300046664 | Ga0495659_0271192 | Ga0495659_0271192_169_657 | 160 |
| 314 | 3300046674 | Ga0495588_0087613 | Ga0495588_0087613_52_537 | 160 |
| 315 | 3300046691 | Ga0495670_0354382 | Ga0495670_0354382_135_623 | 160 |
| 316 | 3300049570 | Ga0501033_0014123 | Ga0501033_0014123_1496_1978 | 160 |
| 317 | 3300049571 | Ga0501034_0068530 | Ga0501034_0068530_1899_2381 | 160 |
| 318 | 3300049574 | Ga0501038_0275375 | Ga0501038_0275375_732_1217 | 160 |
| 319 | 3300049579 | Ga0501043_0315954 | Ga0501043_0315954_145_627 | 160 |
| 320 | 3300049581 | Ga0501047_0045161 | Ga0501047_0045161_3218_3700 | 160 |
| 321 | 3300049586 | Ga0501070_0103151 | Ga0501070_0103151_1088_1573 | 160 |
| 322 | 3300049690 | Ga0501261_036224 | Ga0501261_036224_217_705 | 160 |
| 323 | 3300049822 | Ga0501035_0022570 | Ga0501035_0022570_3754_4236 | 160 |
| 324 | 3300049823 | Ga0501044_0057879 | Ga0501044_0057879_2448_2930 | 160 |
| 325 | 3300049823 | Ga0501044_0253870 | Ga0501044_0253870_367_852 | 160 |
| 326 | 3300050507 | nmdc:mga05p37_231395_c1 | nmdc:mga05p37_231395_c1_762_1253 | 160 |
| 327 | 3300050508 | nmdc:mga09592_108307_c1 | nmdc:mga09592_108307_c1_164_655 | 160 |
| 328 | 3300050508 | nmdc:mga09592_136202_c1 | nmdc:mga09592_136202_c1_1137_1628 | 160 |
| 329 | 3300050509 | nmdc:mga0qj67_35455_c1 | nmdc:mga0qj67_35455_c1_1032_1523 | 160 |
| 330 | 3300050511 | nmdc:mga08y16_23008_c2 | nmdc:mga08y16_23008_c2_2850_3341 | 160 |
| 331 | 3300050512 | nmdc:mga0n895_4969_c1 | nmdc:mga0n895_4969_c1_10358_10849 | 160 |
| 332 | 3300050514 | nmdc:mga08x19_26334_c1 | nmdc:mga08x19_26334_c1_680_1165 | 160 |
| 333 | 3300050515 | nmdc:mga0a205_244973_c1 | nmdc:mga0a205_244973_c1_139_630 | 160 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2a22-assembly1.cif.gz_A | structure of vacuolar protein sorting 29 from cryptosporidium parvum | 0.8395 | 5 | 158 |
| 6tl0-assembly1.cif.gz_A | solution structure and 1h, 13c and 15n chemical shift assignments for the complex of vps29 with varp 687-747 | 0.8217 | 1 | 158 |
| 5w8m-assembly5.cif.gz_E | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.817 | 7 | 158 |
| 5w8m-assembly6.cif.gz_F | error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) | 0.8128 | 6 | 158 |
| 6xs5-assembly1.cif.gz_A | crystal structure of human vps29 complexed with rapid-derived cyclic peptide rt-d1 | 0.8112 | 4 | 159 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8842 | 7 | 157 | 3.60.21.10 |
| af_A4I7S2_2_176_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8779 | 7 | 158 | 3.60.21.10 |
| af_Q58040_34_189_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8523 | 7 | 157 | 3.60.21.10 |
| af_Q5AB94_1_173_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8434 | 8 | 137 | 3.60.21.10 |
| 2a22A00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.8395 | 5 | 158 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8IR48-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9935 | 7 | 158 |
GO:0016787
GO:0046872 |
| AF-A0A843SM23-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9871 | 5 | 158 |
GO:0016787
GO:0046872 |
| AF-A0A7W1PFF9-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9865 | 17 | 160 |
GO:0016787
GO:0046872 |
| AF-A0A2V7ZQQ1-F1-model_v4 | YfcE family phosphodiesterase | 0.9823 | 6 | 120 |
|
| AF-A0A143BK12-F1-model_v4 | Phosphoesterase (EC 3.1.4.-) | 0.9813 | 1 | 160 |
GO:0016787
GO:0046872 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar