F411137

General Info

Members Datasets Scaffolds Average Seq Length
332 320 108 221

Family's Representative Sequence

Representative Sequence 3300053083|Ga0495655_0081560|Ga0495655_0081560_67_846
Length 259
Sequence MVPWNYRKGPPTPSQAGVATLRSNDTLPKRSLTPLENLMFAGRKFAAFLFDMDGTVLNSIASAERVWAAWALRHGLDVETFLPTIHGVRAVETITRLALPGVDPVHEAHVLLQAESDDVEGVLPIAGAVPFLNALPPERWAIVTSAPRPLALLRMQAAGIRVPALMVAGEDVSHGKPAPDCFLLAAKRLGVDIADCLVFEDAPAGIAAAEAAGASVMVISATHQHPMATQHNSIAGYDAVAIAVDDSGWMTLEAQRSAA

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
7 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
8 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
9 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
10 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
11 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
12 2516143018 Ensifer sp. BR816 Isolate Nodule
13 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
14 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
15 2524023250 Niveispirillum irakense DSM 11586 Isolate Unclassified
16 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
17 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
18 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
19 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
20 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
21 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
22 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
23 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
24 2643221557 Ensifer sp. Root558 Isolate Unclassified
25 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
26 2643221610 Ensifer sp. Root74 Isolate Unclassified
27 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
28 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
29 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
30 2643221668 Ensifer sp. Root423 Isolate Unclassified
31 2643221675 Ensifer sp. Root1298 Isolate Unclassified
32 2643221680 Ensifer sp. Root1312 Isolate Unclassified
33 2643221723 Ensifer sp. Root278 Isolate Unclassified
34 2643221726 Ensifer sp. Root954 Isolate Unclassified
35 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
36 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
37 2738543024 Aminobacter sp. AP02 Isolate Unclassified
38 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
39 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
40 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
41 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
42 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
43 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
44 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
45 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
46 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
47 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
48 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
49 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
50 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
51 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
52 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
53 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
54 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
55 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
56 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
57 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
58 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
59 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
60 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
61 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
62 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
63 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
64 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
65 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
66 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
67 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
68 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
69 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
70 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
71 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
72 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
73 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
74 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
75 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
76 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
77 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
78 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
79 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
80 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
81 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
82 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
83 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
84 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
85 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
86 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
87 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
88 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
89 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
90 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
91 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
92 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
93 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
94 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
95 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
96 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
97 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
98 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
99 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
100 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
101 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
102 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
103 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
104 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
105 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
106 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
107 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
108 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
109 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
110 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
111 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
112 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
113 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
114 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
115 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
116 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
117 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
118 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
119 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
120 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
121 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
122 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
123 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
124 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
125 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
126 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
127 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
128 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
129 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
130 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
131 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
132 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
133 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
134 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
135 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
136 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
137 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
138 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
139 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
140 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
141 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
142 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
143 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
144 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
145 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
146 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
147 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
148 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
149 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
150 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
151 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
152 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
153 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
154 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
155 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
156 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
157 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
158 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
159 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
160 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
161 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
162 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
163 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
164 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
165 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
166 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
167 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
168 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
169 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
170 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
171 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
172 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
173 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
174 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
175 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
176 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
177 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
178 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
179 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
180 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
181 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
182 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
183 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
184 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
185 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
186 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
187 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
188 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
189 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
190 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
191 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
192 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
193 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
194 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
195 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
196 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
197 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
198 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
199 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
200 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
201 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
202 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
203 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
204 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
205 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
206 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
207 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
208 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
209 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
210 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
211 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
212 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
213 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
214 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
215 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
216 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
217 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
218 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
219 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
220 3004167301 Mesorhizobium loti 582 Isolate Unclassified
221 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
222 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
223 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
224 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
225 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
226 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
227 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
228 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
229 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
230 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
231 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
232 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
233 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
234 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
235 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
236 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
237 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
238 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
239 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
240 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
241 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
242 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
243 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
244 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
245 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
246 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
247 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
248 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
249 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
250 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
251 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
252 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
253 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
254 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
255 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
256 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
257 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
258 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
259 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
260 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
261 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
262 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
263 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
264 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
266 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
267 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
268 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
270 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
271 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
272 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
273 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
276 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
277 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
279 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
280 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
281 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
282 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
283 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
284 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
285 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
286 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
287 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
288 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
294 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
300 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
301 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
302 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
309 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
310 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
311 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
312 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
313 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
316 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
317 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
318 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
319 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
320 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 32.53
Metatranscriptomes 0
Isolates 67.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.25
Nodule 61.14
Rhizoplane 1.2
Rhizosphere 14.16
Stem 0
Stem Tuber 0
Unclassified 10.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1000009 3300002987 Bacteria 168868
2 JGI25151J46595_10003316 3300003187 Bacteria 8933
3 JGI25153J46596_10002912 3300003215 Bacteria 9689
4 rootH1_10013716 3300003316 Bacteria 2594
5 rootL2_10043151 3300003322 Bacteria 2340
6 rootH1_10061670 3300003323 Bacteria 7161
7 JGI25160J50197_1000028 3300003354 Bacteria 179309
8 JGI25161J50226_1000332 3300003374 Bacteria 25529
9 Ga0055539_1000334 3300003752 Bacteria 22236
10 Ga0055533_1000028 3300003756 Bacteria 311012
11 Ga0055533_1000057 3300003756 Bacteria 194035
12 Ga0055525_1000941 3300003759 Bacteria 8133
13 Ga0055535_1000063 3300003761 Bacteria 117039
14 Ga0055529_1000456 3300003763 Bacteria 40019
15 Ga0055526_1001863 3300003771 Bacteria 14611
16 Ga0055526_1014318 3300003771 Bacteria 3272
17 Ga0055524_1016276 3300003775 Bacteria 2674
18 Ga0055536_1009122 3300003781 Bacteria 4155
19 Ga0055540_1019568 3300003792 Bacteria 1818
20 Ga0055531_10061462 3300003794 Bacteria 915
21 Ga0055543_1000230 3300004625 Bacteria 44357
22 Ga0065165_1000061 3300005262 Bacteria 179347
23 Ga0070658_10029230 3300005327 Bacteria 4427
24 Ga0070660_100582349 3300005339 Bacteria 935
25 Ga0070674_100826304 3300005356 Bacteria 802
26 Ga0070663_100494933 3300005455 Bacteria 1014
27 Ga0068867_100478034 3300005459 Bacteria 1067
28 Ga0070665_100015427 3300005548 Bacteria 7672
29 Ga0068855_100890820 3300005563 Bacteria 941
30 Ga0075362_10092686 3300006177 Bacteria 1404
31 Ga0097621_100427602 3300006237 Bacteria 1189
32 Ga0079104_1001284 3300006946 Bacteria 17357
33 Ga0163162_10966566 3300013306 Bacteria 962
34 Ga0157375_11281700 3300013308 Bacteria 861
35 Ga0163161_10374201 3300017792 Bacteria 1137
36 Ga0213872_10003557 3300021361 Bacteria 8582
37 Ga0228710_1000283 3300022740 Bacteria 56899
38 Ga0209674_100007 3300025226 Bacteria 1077082
39 Ga0209563_100033 3300025230 Bacteria 457883
40 Ga0209258_100123 3300025242 Bacteria 178931
41 Ga0209677_100132 3300025253 Bacteria 72060
42 Ga0209759_1004772 3300025256 Bacteria 4953
43 Ga0209759_1005355 3300025256 Bacteria 4518
44 Ga0209129_1000041 3300025258 Bacteria 307590
45 Ga0209455_1000115 3300025272 Bacteria 178506
46 Ga0209130_1000068 3300025284 Bacteria 179361
47 Ga0209676_1000714 3300025292 Bacteria 45991
48 Ga0209025_1000203 3300025294 Bacteria 145210
49 Ga0209564_1000029 3300025295 Bacteria 505995
50 Ga0209564_1000081 3300025295 Bacteria 261592
51 Ga0209758_1000043 3300025297 Bacteria 402310
52 Ga0209050_1003615 3300025298 Bacteria 11211
53 Ga0209256_1001098 3300025299 Bacteria 31105
54 Ga0207426_1000155 3300025302 Bacteria 179361
55 Ga0209051_1002255 3300025303 Bacteria 14156
56 Ga0209257_1003599 3300025304 Bacteria 13086
57 Ga0207657_10135688 3300025919 Bacteria 2014
58 Ga0207657_10326776 3300025919 Bacteria 1212
59 Ga0207669_10431179 3300025937 Bacteria 1040
60 Ga0209281_1000087 3300027111 Bacteria 246142
61 Ga0209281_1000188 3300027111 Bacteria 141823
62 Ga0209282_1000008 3300027666 Bacteria 248526
63 Ga0268266_10033121 3300028379 Bacteria 4394
64 Ga0268266_10517516 3300028379 Bacteria 1141
65 Ga0265336_10000012 3300028666 Bacteria 261478
66 Ga0265324_10000803 3300029957 Bacteria 20519
67 Ga0315914_1000011 3300031967 Bacteria 170175
68 Ga0307416_100782546 3300032002 Bacteria 1049
69 Ga0315913_1000008 3300033430 Bacteria 155397
70 Ga0315915_1000009 3300033464 Bacteria 252178
71 Ga0395905_0000836 3300037471 Bacteria 40186
72 Ga0436361_0029917 3300039447 Bacteria 6823
73 Ga0436361_0323872 3300039447 Bacteria 19289
74 Ga0439445_0030348 3300042004 Bacteria 1401
75 Ga0439446_0028925 3300042156 Bacteria 1598
76 Ga0495605_0000066 3300046474 Bacteria 139260
77 Ga0495605_0029575 3300046474 Bacteria 2817
78 Ga0495607_0035116 3300046501 Bacteria 3036
79 Ga0495583_0001170 3300046506 Bacteria 28380
80 Ga0495606_0010666 3300046507 Bacteria 7596
81 Ga0495606_0023070 3300046507 Bacteria 4519
82 Ga0495616_0000022 3300046513 Bacteria 149720
83 Ga0495620_0080660 3300046515 Bacteria 1317
84 Ga0495632_0133137 3300046519 Bacteria 1156
85 Ga0495648_0021372 3300046524 Bacteria 4482
86 Ga0495609_0000125 3300046538 Bacteria 83190
87 Ga0495609_0141620 3300046538 Bacteria 1026
88 Ga0495668_0003144 3300046616 Bacteria 12740
89 Ga0495625_0030895 3300046660 Bacteria 3990
90 Ga0495660_0167916 3300046810 Bacteria 1071
91 Ga0495687_041785 3300047443 Bacteria 2009
92 Ga0495673_0001093 3300047469 Bacteria 23524
93 Ga0495626_0131322 3300048091 Bacteria 1069
94 Ga0496105_0577472 3300048908 Bacteria 875
95 Ga0496106_0555809 3300048909 Bacteria 921
96 Ga0496107_0322194 3300048910 Bacteria 1150
97 Ga0496118_0192606 3300048921 Bacteria 1218
98 Ga0496121_0342942 3300048924 Bacteria 998
99 Ga0496126_0092336 3300048929 Bacteria 2660
100 Ga0501238_001741 3300049671 Bacteria 2535
101 nmdc:mga0yw44_632966_c1 3300050492 Bacteria 727
102 nmdc:mga0k408_22435_c1 3300050493 Bacteria 3004
103 Ga0495655_0081560 3300053083 Bacteria 926
104 Ga0500578_0000244 3300053086 Bacteria 67335
105 Ga0500578_0071344 3300053086 Bacteria 2214
106 Ga0500568_0000212 3300053139 Bacteria 50122
107 Ga0500604_0049978 3300053151 Bacteria 1287
108 Ga0500627_0000516 3300053158 Bacteria 10411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050492 nmdc:mga0yw44_632966_c1 nmdc:mga0yw44_632966_c1_20_646 205
2 3300005327 Ga0070658_10029230 Ga0070658_100292303 206
3 3300005339 Ga0070660_100582349 Ga0070660_1005823492 206
4 3300025919 Ga0207657_10135688 Ga0207657_101356882 206
5 3300046474 Ga0495605_0000066 Ga0495605_0000066_127092_127736 209
6 3300053086 Ga0500578_0000244 Ga0500578_0000244_42059_42721 209
7 3300025919 Ga0207657_10326776 Ga0207657_103267761 212
8 3300048908 Ga0496105_0577472 Ga0496105_0577472_214_855 212
9 3300048910 Ga0496107_0322194 Ga0496107_0322194_445_1086 212
10 iso_pu_bacteria 2830075706 2830077016 212
11 3300005548 Ga0070665_100015427 Ga0070665_1000154278 213
12 3300028379 Ga0268266_10033121 Ga0268266_100331214 213
13 3300048929 Ga0496126_0092336 Ga0496126_0092336_600_1241 213
14 iso_pu_bacteria 2871488783 2871494781 213
15 iso_pu_bacteria 2878753008 2878759915 213
16 iso_pu_bacteria 2881845957 2881848506 213
17 iso_pu_bacteria 2882912400 2882919196 213
18 iso_pu_bacteria 2903492973 2903494139 213
19 iso_pu_bacteria 2961170736 2961177187 213
20 iso_pu_bacteria 2967996073 2968002277 213
21 iso_pu_bacteria 2968003550 2968009511 213
22 iso_pu_bacteria 2970503327 2970509861 213
23 iso_pu_bacteria 2977821940 2977828437 213
24 iso_pu_bacteria 2979808191 2979814737 213
25 iso_pu_bacteria 8004374579 8004381413 213
26 3300013308 Ga0157375_11281700 Ga0157375_112817001 214
27 3300046506 Ga0495583_0001170 Ga0495583_0001170_22100_22744 214
28 3300046538 Ga0495609_0141620 Ga0495609_0141620_233_877 214
29 iso_pu_bacteria 2503198000 2503199193 214
30 iso_pu_bacteria 2508501127 2509144266 214
31 iso_pu_bacteria 2513237305 2514423223 214
32 iso_pu_bacteria 2643221595 2643988357 214
33 iso_pu_bacteria 2643221627 2644154726 214
34 iso_pu_bacteria 2721755686 2723573576 214
35 iso_pu_bacteria 2844002411 2844002960 214
36 iso_pu_bacteria 2874123672 2874130213 214
37 iso_pu_bacteria 2882632389 2882640214 214
38 iso_pu_bacteria 2885312484 2885313645 214
39 iso_pu_bacteria 2924762789 2924765435 214
40 iso_pu_bacteria 2937822353 2937825413 214
41 iso_pu_bacteria 2977986579 2977989710 214
42 iso_pu_bacteria 3004167301 3004173813 214
43 3300021361 Ga0213872_10003557 Ga0213872_100035579 215
44 3300039447 Ga0436361_0323872 Ga0436361_0323872_1877_2533 215
45 3300025256 Ga0209759_1005355 Ga0209759_10053551 216
46 3300042004 Ga0439445_0030348 Ga0439445_0030348_515_1165 216
47 3300042156 Ga0439446_0028925 Ga0439446_0028925_636_1286 216
48 3300047469 Ga0495673_0001093 Ga0495673_0001093_2580_3230 216
49 3300049671 Ga0501238_001741 Ga0501238_001741_626_1276 216
50 iso_pu_bacteria 2524023250 2524611219 216
51 3300006177 Ga0075362_10092686 Ga0075362_100926862 217
52 3300046474 Ga0495605_0029575 Ga0495605_0029575_48_743 217
53 3300046501 Ga0495607_0035116 Ga0495607_0035116_105_758 217
54 3300046519 Ga0495632_0133137 Ga0495632_0133137_119_775 217
55 3300046538 Ga0495609_0000125 Ga0495609_0000125_56790_57443 217
56 iso_pu_bacteria 2643221623 2644129188 217
57 iso_pu_bacteria 2738543024 2739308285 217
58 iso_pu_bacteria 2902405164 2902405250 217
59 iso_pu_bacteria 8002285264 8002288841 217
60 3300005356 Ga0070674_100826304 Ga0070674_1008263041 218
61 3300005459 Ga0068867_100478034 Ga0068867_1004780341 218
62 3300005563 Ga0068855_100890820 Ga0068855_1008908201 218
63 3300006237 Ga0097621_100427602 Ga0097621_1004276021 218
64 3300017792 Ga0163161_10374201 Ga0163161_103742012 218
65 3300025937 Ga0207669_10431179 Ga0207669_104311791 218
66 3300028379 Ga0268266_10517516 Ga0268266_105175162 218
67 3300039447 Ga0436361_0029917 Ga0436361_0029917_381_1052 218
68 3300046515 Ga0495620_0080660 Ga0495620_0080660_559_1224 218
69 3300046660 Ga0495625_0030895 Ga0495625_0030895_2985_3650 218
70 3300047443 Ga0495687_041785 Ga0495687_041785_335_1000 218
71 3300048091 Ga0495626_0131322 Ga0495626_0131322_35_700 218
72 3300048909 Ga0496106_0555809 Ga0496106_0555809_186_851 218
73 3300048921 Ga0496118_0192606 Ga0496118_0192606_384_1049 218
74 3300048924 Ga0496121_0342942 Ga0496121_0342942_137_802 218
75 iso_pu_bacteria 2939669807 2939672082 218
76 3300005455 Ga0070663_100494933 Ga0070663_1004949332 219
77 3300028666 Ga0265336_10000012 Ga0265336_1000001280 219
78 3300029957 Ga0265324_10000803 Ga0265324_1000080310 219
79 3300037471 Ga0395905_0000836 Ga0395905_0000836_18424_19086 219
80 iso_pu_bacteria 2510065057 2510303830 219
81 iso_pu_bacteria 2511231052 2511498046 219
82 iso_pu_bacteria 2512047086 2512529203 219
83 iso_pu_bacteria 2513237086 2513583810 219
84 iso_pu_bacteria 2513237091 2513617333 219
85 iso_pu_bacteria 2513237140 2513882430 219
86 iso_pu_bacteria 2513237143 2513904136 219
87 iso_pu_bacteria 2515154107 2515612601 219
88 iso_pu_bacteria 2516143018 2516206949 219
89 iso_pu_bacteria 2516653046 2516896309 219
90 iso_pu_bacteria 2524023207 2524449741 219
91 iso_pu_bacteria 2551306084 2551676212 219
92 iso_pu_bacteria 2551306085 2551685679 219
93 iso_pu_bacteria 2551306086 2551695162 219
94 iso_pu_bacteria 2551306089 2551709936 219
95 iso_pu_bacteria 2551306090 2551723334 219
96 iso_pu_bacteria 2551306091 2551728510 219
97 iso_pu_bacteria 2551306093 2551745541 219
98 iso_pu_bacteria 2690316117 2692318791 219
99 iso_pu_bacteria 2751185821 2753457962 219
100 iso_pu_bacteria 2791355091 2792619704 219
101 iso_pu_bacteria 2791355092 2792627479 219
102 iso_pu_bacteria 2791355094 2792641939 219
103 iso_pu_bacteria 2802428863 2802748787 219
104 iso_pu_bacteria 2847417321 2847422705 219
105 iso_pu_bacteria 2848992105 2848997858 219
106 iso_pu_bacteria 2855825444 2855828865 219
107 iso_pu_bacteria 2855839649 2855843989 219
108 iso_pu_bacteria 2855872281 2855872739 219
109 iso_pu_bacteria 2858800743 2858806768 219
110 iso_pu_bacteria 2896384573 2896387174 219
111 iso_pu_bacteria 2915980308 2915981971 219
112 iso_pu_bacteria 2915986958 2915990483 219
113 iso_pu_bacteria 2915993759 2915994644 219
114 iso_pu_bacteria 2916000859 2916003977 219
115 iso_pu_bacteria 2916007675 2916010279 219
116 iso_pu_bacteria 2916014648 2916016195 219
117 iso_pu_bacteria 2916021584 2916022802 219
118 iso_pu_bacteria 2916028427 2916031655 219
119 iso_pu_bacteria 2916035215 2916036135 219
120 iso_pu_bacteria 2916041962 2916044434 219
121 iso_pu_bacteria 2916048683 2916050907 219
122 iso_pu_bacteria 2916055098 2916061275 219
123 iso_pu_bacteria 2916061851 2916065380 219
124 iso_pu_bacteria 2916076590 2916080057 219
125 iso_pu_bacteria 2921201388 2921203377 219
126 iso_pu_bacteria 2921208531 2921210508 219
127 iso_pu_bacteria 2921237296 2921238627 219
128 iso_pu_bacteria 2921244191 2921249256 219
129 iso_pu_bacteria 2921250672 2921251892 219
130 iso_pu_bacteria 2921257292 2921262280 219
131 iso_pu_bacteria 2921263974 2921265642 219
132 iso_pu_bacteria 2921282425 2921282470 219
133 iso_pu_bacteria 2921289301 2921289336 219
134 iso_pu_bacteria 2921296804 2921302896 219
135 iso_pu_bacteria 2924144063 2924145884 219
136 iso_pu_bacteria 2924150972 2924152586 219
137 iso_pu_bacteria 2924158325 2924159625 219
138 iso_pu_bacteria 2924165586 2924170163 219
139 iso_pu_bacteria 2924172951 2924178110 219
140 iso_pu_bacteria 2924179722 2924182150 219
141 iso_pu_bacteria 2924186466 2924190611 219
142 iso_pu_bacteria 2924193448 2924199504 219
143 iso_pu_bacteria 2924200457 2924205133 219
144 iso_pu_bacteria 2924207177 2924208369 219
145 iso_pu_bacteria 2924214083 2924217745 219
146 iso_pu_bacteria 2924221636 2924225393 219
147 iso_pu_bacteria 2924228884 2924229174 219
148 iso_pu_bacteria 2936996657 2937001985 219
149 iso_pu_bacteria 2937002841 2937007182 219
150 iso_pu_bacteria 2937009748 2937015844 219
151 iso_pu_bacteria 2937016420 2937022647 219
152 iso_pu_bacteria 2937023124 2937024207 219
153 iso_pu_bacteria 2937042894 2937046750 219
154 iso_pu_bacteria 2937049772 2937053034 219
155 iso_pu_bacteria 2937056579 2937059896 219
156 iso_pu_bacteria 2937063883 2937066682 219
157 iso_pu_bacteria 2937071275 2937074063 219
158 iso_pu_bacteria 2937091812 2937093255 219
159 iso_pu_bacteria 2937098957 2937105290 219
160 iso_pu_bacteria 2937106411 2937113413 219
161 iso_pu_bacteria 2937113482 2937114401 219
162 iso_pu_bacteria 2937119839 2937122787 219
163 iso_pu_bacteria 2937126314 2937130036 219
164 iso_pu_bacteria 2957375807 2957379270 219
165 iso_pu_bacteria 2957382221 2957384179 219
166 iso_pu_bacteria 2957388812 2957390432 219
167 iso_pu_bacteria 2957395598 2957401096 219
168 iso_pu_bacteria 2957402308 2957408040 219
169 iso_pu_bacteria 2957408893 2957409776 219
170 iso_pu_bacteria 2957415311 2957420645 219
171 iso_pu_bacteria 2957422303 2957422556 219
172 iso_pu_bacteria 2957430029 2957436049 219
173 iso_pu_bacteria 2957443900 2957448799 219
174 iso_pu_bacteria 2957450854 2957452053 219
175 iso_pu_bacteria 2957457609 2957462902 219
176 iso_pu_bacteria 2957464669 2957467443 219
177 iso_pu_bacteria 2957471148 2957477777 219
178 iso_pu_bacteria 2957478035 2957484584 219
179 iso_pu_bacteria 2957484790 2957488138 219
180 iso_pu_bacteria 2957491536 2957497484 219
181 iso_pu_bacteria 2957498199 2957501567 219
182 iso_pu_bacteria 2957505466 2957511135 219
183 iso_pu_bacteria 2960584000 2960587083 219
184 iso_pu_bacteria 2960597568 2960598582 219
185 iso_pu_bacteria 2960603979 2960605894 219
186 iso_pu_bacteria 2960610863 2960615437 219
187 iso_pu_bacteria 2960617483 2960622917 219
188 iso_pu_bacteria 2960624210 2960630454 219
189 iso_pu_bacteria 2960631154 2960632416 219
190 iso_pu_bacteria 2960637947 2960641891 219
191 iso_pu_bacteria 2960645483 2960648196 219
192 iso_pu_bacteria 2960652885 2960653950 219
193 iso_pu_bacteria 2960660292 2960664663 219
194 iso_pu_bacteria 2960667422 2960667827 219
195 iso_pu_bacteria 2960674078 2960678182 219
196 iso_pu_bacteria 2960687367 2960691390 219
197 iso_pu_bacteria 2964607997 2964613269 219
198 iso_pu_bacteria 2964615318 2964615957 219
199 iso_pu_bacteria 2964621998 2964624947 219
200 iso_pu_bacteria 2964628898 2964632359 219
201 iso_pu_bacteria 2964636051 2964636695 219
202 iso_pu_bacteria 2964643177 2964648421 219
203 iso_pu_bacteria 2964649959 2964656077 219
204 iso_pu_bacteria 2964656573 2964659144 219
205 iso_pu_bacteria 2964663802 2964670610 219
206 iso_pu_bacteria 2964670856 2964673099 219
207 iso_pu_bacteria 2964678106 2964679020 219
208 iso_pu_bacteria 2964685014 2964688378 219
209 iso_pu_bacteria 2964691889 2964697936 219
210 iso_pu_bacteria 2964698721 2964702783 219
211 iso_pu_bacteria 2964705432 2964709511 219
212 iso_pu_bacteria 2964712639 2964716949 219
213 iso_pu_bacteria 2964719344 2964721415 219
214 iso_pu_bacteria 2967664464 2967666420 219
215 iso_pu_bacteria 2967671571 2967674041 219
216 iso_pu_bacteria 2967678726 2967682521 219
217 iso_pu_bacteria 2967693043 2967693763 219
218 iso_pu_bacteria 2967699805 2967701015 219
219 iso_pu_bacteria 2967706974 2967711001 219
220 iso_pu_bacteria 2967714385 2967715500 219
221 iso_pu_bacteria 2967721400 2967724518 219
222 iso_pu_bacteria 2967735183 2967736108 219
223 iso_pu_bacteria 2967742019 2967743044 219
224 iso_pu_bacteria 2967748971 2967751189 219
225 iso_pu_bacteria 2967755722 2967762144 219
226 iso_pu_bacteria 2967762386 2967768301 219
227 iso_pu_bacteria 2967769361 2967775401 219
228 iso_pu_bacteria 2967775926 2967777844 219
229 iso_pu_bacteria 2970019648 2970022974 219
230 iso_pu_bacteria 2970033650 2970037961 219
231 iso_pu_bacteria 2970040964 2970045621 219
232 iso_pu_bacteria 2970047711 2970053247 219
233 iso_pu_bacteria 2970054988 2970055427 219
234 iso_pu_bacteria 2970061556 2970062175 219
235 iso_pu_bacteria 2970068827 2970069545 219
236 iso_pu_bacteria 2970076120 2970080625 219
237 iso_pu_bacteria 2970082768 2970088727 219
238 iso_pu_bacteria 2970088815 2970092325 219
239 iso_pu_bacteria 2970095765 2970100459 219
240 iso_pu_bacteria 2970102677 2970103601 219
241 iso_pu_bacteria 2970109326 2970114653 219
242 iso_pu_bacteria 2970116247 2970116599 219
243 iso_pu_bacteria 2970129317 2970130562 219
244 iso_pu_bacteria 2970136068 2970140161 219
245 iso_pu_bacteria 2970149975 2970155111 219
246 iso_pu_bacteria 2970164137 2970165807 219
247 iso_pu_bacteria 2970170962 2970177560 219
248 iso_pu_bacteria 2970177841 2970180338 219
249 iso_pu_bacteria 2970184632 2970186066 219
250 iso_pu_bacteria 2970191845 2970192108 219
251 iso_pu_bacteria 2977516862 2977518089 219
252 iso_pu_bacteria 2977523885 2977528329 219
253 iso_pu_bacteria 2977537788 2977538896 219
254 iso_pu_bacteria 2977551784 2977552474 219
255 iso_pu_bacteria 2977558990 2977561907 219
256 iso_pu_bacteria 2977565890 2977570703 219
257 iso_pu_bacteria 2977572785 2977579373 219
258 iso_pu_bacteria 2977579622 2977580916 219
259 iso_pu_bacteria 3002141150 3002144324 219
260 iso_pu_bacteria 648276728 648737599 219
261 iso_pu_bacteria 8003992118 8003996561 219
262 3300046507 Ga0495606_0023070 Ga0495606_0023070_2646_3308 220
263 3300053086 Ga0500578_0071344 Ga0500578_0071344_448_1110 220
264 iso_pu_bacteria 2599185352 2600193066 220
265 iso_pu_bacteria 2643221557 2643809210 220
266 iso_pu_bacteria 2643221610 2644064388 220
267 iso_pu_bacteria 2643221644 2644245751 220
268 iso_pu_bacteria 2643221668 2644378804 220
269 iso_pu_bacteria 2643221675 2644416220 220
270 iso_pu_bacteria 2643221680 2644449260 220
271 iso_pu_bacteria 2643221723 2644672194 220
272 iso_pu_bacteria 2643221726 2644688484 220
273 3300003215 JGI25153J46596_10002912 JGI25153J46596_100029122 221
274 3300003771 Ga0055526_1001863 Ga0055526_100186314 221
275 3300013306 Ga0163162_10966566 Ga0163162_109665662 221
276 3300025258 Ga0209129_1000041 Ga0209129_1000041126 221
277 3300025295 Ga0209564_1000029 Ga0209564_1000029272 221
278 3300025297 Ga0209758_1000043 Ga0209758_1000043168 221
279 3300046513 Ga0495616_0000022 Ga0495616_0000022_76768_77436 221
280 3300046616 Ga0495668_0003144 Ga0495668_0003144_1864_2532 221
281 3300050493 nmdc:mga0k408_22435_c1 nmdc:mga0k408_22435_c1_1521_2186 221
282 3300053139 Ga0500568_0000212 Ga0500568_0000212_10070_10747 221
283 3300053158 Ga0500627_0000516 Ga0500627_0000516_5101_5769 221
284 3300003316 rootH1_10013716 rootH1_100137163 222
285 3300003322 rootL2_10043151 rootL2_100431513 222
286 3300003323 rootH1_10061670 rootH1_100616706 222
287 3300003752 Ga0055539_1000334 Ga0055539_10003347 222
288 3300003756 Ga0055533_1000028 Ga0055533_1000028246 222
289 3300003756 Ga0055533_1000057 Ga0055533_1000057101 222
290 3300003759 Ga0055525_1000941 Ga0055525_10009417 222
291 3300003761 Ga0055535_1000063 Ga0055535_10000637 222
292 3300003763 Ga0055529_1000456 Ga0055529_100045629 222
293 3300025226 Ga0209674_100007 Ga0209674_100007796 222
294 3300025230 Ga0209563_100033 Ga0209563_100033243 222
295 3300025242 Ga0209258_100123 Ga0209258_1001237 222
296 3300025253 Ga0209677_100132 Ga0209677_1001327 222
297 3300025256 Ga0209759_1004772 Ga0209759_10047721 222
298 3300025272 Ga0209455_1000115 Ga0209455_10001157 222
299 3300006946 Ga0079104_1001284 Ga0079104_10012846 223
300 3300022740 Ga0228710_1000283 Ga0228710_100028323 223
301 3300027111 Ga0209281_1000087 Ga0209281_100008769 223
302 3300027111 Ga0209281_1000188 Ga0209281_100018845 223
303 3300027666 Ga0209282_1000008 Ga0209282_100000870 223
304 3300031967 Ga0315914_1000011 Ga0315914_1000011103 223
305 3300032002 Ga0307416_100782546 Ga0307416_1007825461 223
306 3300033430 Ga0315913_1000008 Ga0315913_100000887 223
307 3300033464 Ga0315915_1000009 Ga0315915_1000009146 223
308 3300025284 Ga0209130_1000068 Ga0209130_1000068129 224
309 3300025292 Ga0209676_1000714 Ga0209676_10007146 224
310 3300025294 Ga0209025_1000203 Ga0209025_100020393 224
311 3300025295 Ga0209564_1000081 Ga0209564_100008168 224
312 3300025298 Ga0209050_1003615 Ga0209050_10036152 224
313 3300025299 Ga0209256_1001098 Ga0209256_100109819 224
314 3300025302 Ga0207426_1000155 Ga0207426_1000155129 224
315 3300025303 Ga0209051_1002255 Ga0209051_100225511 224
316 3300025304 Ga0209257_1003599 Ga0209257_100359912 224
317 3300046524 Ga0495648_0021372 Ga0495648_0021372_506_1186 224
318 3300053151 Ga0500604_0049978 Ga0500604_0049978_345_1079 228
319 3300046507 Ga0495606_0010666 Ga0495606_0010666_2232_2993 232
320 3300046810 Ga0495660_0167916 Ga0495660_0167916_283_1044 232
321 3300053083 Ga0495655_0081560 Ga0495655_0081560_67_846 235
322 3300002987 JGI25159J45721_1000009 JGI25159J45721_1000009128 237
323 3300003187 JGI25151J46595_10003316 JGI25151J46595_100033164 237
324 3300003354 JGI25160J50197_1000028 JGI25160J50197_100002841 237
325 3300003374 JGI25161J50226_1000332 JGI25161J50226_10003322 237
326 3300003771 Ga0055526_1014318 Ga0055526_10143182 237
327 3300003775 Ga0055524_1016276 Ga0055524_10162762 237
328 3300003781 Ga0055536_1009122 Ga0055536_10091224 237
329 3300003792 Ga0055540_1019568 Ga0055540_10195682 237
330 3300003794 Ga0055531_10061462 Ga0055531_100614621 237
331 3300004625 Ga0055543_1000230 Ga0055543_100023011 237
332 3300005262 Ga0065165_1000061 Ga0065165_100006141 237

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

48

219

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

45

213

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.8814 26 200
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.8779 27 200
3s6j-assembly2.cif.gz_F the crystal structure of a hydrolase from pseudomonas syringae 0.8732 27 200
2qlt-assembly1.cif.gz_A crystal structure of an isoform of dl-glycerol-3-phosphatase, rhr2p, from saccharomyces cerevisiae 0.8579 24 233
4gib-assembly2.cif.gz_B 2.27 angstrom crystal structure of beta-phosphoglucomutase (pgmb) from clostridium difficile 0.8504 26 201
ID Description Score Start End Superfamily
af_A0A0R0KYK9_29_156_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8801 122 217 3.40.50.1000
1qq7B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8768 104 200 3.40.50.1000
af_Q655Y3_103_228_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8609 122 201 3.40.50.1000
af_O17773_104_249_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8578 122 200 3.40.50.1000
af_D7SFJ0_151_278_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8555 122 200 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A1V2SD65-F1-model_v4 deleted 0.9897 24 155
AF-A0A7U6IYD7-F1-model_v4 deleted 0.9869 20 236
AF-A0A7Z3C6L3-F1-model_v4 Glycerol-3-phosphatase 0.9867 20 236 GO:0050308
AF-A0A839XG27-F1-model_v4 deleted 0.9852 19 236
AF-A0A1Q9B2Q7-F1-model_v4 Glycerol-3-phosphatase 0.9807 33 236 GO:0050308

Feature Viewer

pLDDT pTM Quality
89.16 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map