F411130

General Info

Members Datasets Scaffolds Average Seq Length
332 183 664 151

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_31102_c1|nmdc:mga05p37_31102_c1_1412_1903
Length 163
Sequence VAIDRQGTGLTIIRMALGVFFIFEGLGKIRWFTDPSLLSSQLSGWLQDAAAGSYSQHYLQRIAIPFANVFARLVPLGELTSGAALLLGVWTPFFAFVAFFMALNFQFASGALFRYSFLTSGYGLPVLGSTLGLAVGGVRMPWSIRGGGSPRATPAPRSSPKQG

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
134 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
135 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
145 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
146 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
147 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
148 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
163 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
180 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
182 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.02
Rhizosphere 93.67
Stem 0
Stem Tuber 0
Unclassified 28.01

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_31102_c1 3300050507 Bacteria 6518
2 JGI25406J46586_10090306 3300003203 Bacteria 925
3 rootL2_10219388 3300003322 Unclassified 1186
4 Ga0065715_10246798 3300005293 Bacteria 1180
5 Ga0070683_100773665 3300005329 Bacteria 920
6 Ga0070683_101740368 3300005329 Bacteria 599
7 Ga0070690_100223657 3300005330 Bacteria 1320
8 Ga0070670_100824891 3300005331 Bacteria 838
9 Ga0068869_100056488 3300005334 Unclassified 2863
10 Ga0068869_100812864 3300005334 Unclassified 804
11 Ga0070666_10088868 3300005335 Bacteria 2120
12 Ga0070666_10333764 3300005335 Unclassified 1083
13 Ga0070680_100390892 3300005336 Bacteria 1185
14 Ga0070680_101238623 3300005336 Bacteria 645
15 Ga0068868_100105681 3300005338 Bacteria 2283
16 Ga0068868_101139428 3300005338 Bacteria 719
17 Ga0068868_102232217 3300005338 Unclassified 522
18 Ga0070660_100001966 3300005339 Bacteria 14175
19 Ga0070660_100729737 3300005339 Bacteria 831
20 Ga0070689_100123135 3300005340 Bacteria 2073
21 Ga0070689_100203176 3300005340 Unclassified 1619
22 Ga0070669_100003911 3300005353 Bacteria 10778
23 Ga0070675_100203911 3300005354 Unclassified 1717
24 Ga0070675_100709176 3300005354 Bacteria 917
25 Ga0070671_100187866 3300005355 Bacteria 1751
26 Ga0070674_100934534 3300005356 Unclassified 757
27 Ga0070673_100109066 3300005364 Unclassified 2293
28 Ga0070688_100396803 3300005365 Bacteria 1020
29 Ga0070667_100087715 3300005367 Bacteria 2671
30 Ga0070667_100358468 3300005367 Bacteria 1321
31 Ga0070714_100184679 3300005435 Unclassified 1899
32 Ga0070713_100343239 3300005436 Bacteria 1384
33 Ga0070708_100026937 3300005445 Bacteria 4926
34 Ga0070708_100621751 3300005445 Unclassified 1018
35 Ga0070708_100944084 3300005445 Bacteria 809
36 Ga0070678_100767188 3300005456 Bacteria 873
37 Ga0070681_10152148 3300005458 Unclassified 2240
38 Ga0070681_10227742 3300005458 Bacteria 1779
39 Ga0070681_10255446 3300005458 Bacteria 1665
40 Ga0068867_100365368 3300005459 Bacteria 1208
41 Ga0068867_101334205 3300005459 Bacteria 663
42 Ga0070706_100212772 3300005467 Bacteria 1805
43 Ga0070706_100794392 3300005467 Bacteria 876
44 Ga0070707_100160436 3300005468 Bacteria 2191
45 Ga0070707_100655670 3300005468 Bacteria 1012
46 Ga0070707_101233216 3300005468 Bacteria 714
47 Ga0070699_100217975 3300005518 Bacteria 1700
48 Ga0070699_100583090 3300005518 Bacteria 1019
49 Ga0070679_100033161 3300005530 Bacteria 5113
50 Ga0070679_100247473 3300005530 Bacteria 1739
51 Ga0070679_101911568 3300005530 Unclassified 542
52 Ga0070684_100270093 3300005535 Bacteria 1557
53 Ga0070684_100947396 3300005535 Unclassified 807
54 Ga0070697_100023150 3300005536 Bacteria 4939
55 Ga0070697_100584482 3300005536 Bacteria 981
56 Ga0068853_100297785 3300005539 Bacteria 1490
57 Ga0070672_100002400 3300005543 Bacteria 11863
58 Ga0070672_100270429 3300005543 Unclassified 1435
59 Ga0070686_101194318 3300005544 Bacteria 632
60 Ga0070695_100113357 3300005545 Bacteria 1844
61 Ga0070696_100122533 3300005546 Bacteria 1883
62 Ga0070665_100001535 3300005548 Bacteria 26671
63 Ga0070665_100040249 3300005548 Bacteria 4698
64 Ga0070704_100038881 3300005549 Bacteria 3263
65 Ga0068855_100288897 3300005563 Bacteria 1818
66 Ga0068855_100327020 3300005563 Bacteria 1693
67 Ga0068855_100385525 3300005563 Unclassified 1538
68 Ga0070664_101708266 3300005564 Bacteria 597
69 Ga0068854_100547908 3300005578 Bacteria 981
70 Ga0068854_101109895 3300005578 Unclassified 705
71 Ga0068854_101225402 3300005578 Bacteria 673
72 Ga0068854_101274325 3300005578 Unclassified 661
73 Ga0068854_102001864 3300005578 Bacteria 534
74 Ga0068856_100904688 3300005614 Bacteria 901
75 Ga0070702_100085936 3300005615 Bacteria 1896
76 Ga0068852_100663910 3300005616 Bacteria 1051
77 Ga0068859_100094398 3300005617 Bacteria 3043
78 Ga0068859_100203276 3300005617 Bacteria 2066
79 Ga0068859_100343313 3300005617 Unclassified 1587
80 Ga0068859_100512079 3300005617 Unclassified 1295
81 Ga0068859_100559744 3300005617 Unclassified 1238
82 Ga0068859_102166108 3300005617 Bacteria 614
83 Ga0068864_100026628 3300005618 Bacteria 4876
84 Ga0068864_100087287 3300005618 Bacteria 2746
85 Ga0068864_100177823 3300005618 Bacteria 1944
86 Ga0068864_100685446 3300005618 Bacteria 1000
87 Ga0068866_10160249 3300005718 Bacteria 1311
88 Ga0068866_10208195 3300005718 Unclassified 1173
89 Ga0068861_100802161 3300005719 Unclassified 884
90 Ga0068851_10173464 3300005834 Bacteria 1191
91 Ga0068863_100100997 3300005841 Unclassified 2742
92 Ga0068863_100350073 3300005841 Unclassified 1438
93 Ga0068863_100744422 3300005841 Unclassified 976
94 Ga0068858_100020865 3300005842 Bacteria 6123
95 Ga0068858_100911614 3300005842 Bacteria 860
96 Ga0068858_101306308 3300005842 Unclassified 714
97 Ga0068860_100028009 3300005843 Bacteria 5424
98 Ga0068860_100505553 3300005843 Bacteria 1207
99 Ga0068860_100687540 3300005843 Bacteria 1032
100 Ga0068860_100937398 3300005843 Bacteria 883
101 Ga0068862_100012211 3300005844 Bacteria 7100
102 Ga0081455_10027171 3300005937 Bacteria 5246
103 Ga0081539_10005884 3300005985 Bacteria 12142
104 Ga0081539_10234616 3300005985 Unclassified 826
105 Ga0070717_10457371 3300006028 Bacteria 1151
106 Ga0070716_100967950 3300006173 Unclassified 671
107 Ga0097621_100005845 3300006237 Bacteria 8690
108 Ga0097621_100341065 3300006237 Bacteria 1331
109 Ga0068871_100016282 3300006358 Bacteria 5594
110 Ga0068871_100253378 3300006358 Unclassified 1534
111 Ga0075433_10105875 3300006852 Bacteria 2492
112 Ga0075433_10153870 3300006852 Bacteria 2046
113 Ga0075433_10171225 3300006852 Bacteria 1932
114 Ga0075433_11178698 3300006852 Unclassified 665
115 Ga0075434_100086513 3300006871 Bacteria 3134
116 Ga0075434_100477466 3300006871 Bacteria 1268
117 Ga0075434_101022283 3300006871 Unclassified 840
118 Ga0075434_101607170 3300006871 Bacteria 658
119 Ga0075429_100803030 3300006880 Bacteria 824
120 Ga0068865_100044125 3300006881 Bacteria 3050
121 Ga0075436_100054340 3300006914 Bacteria 2765
122 Ga0097620_100094395 3300006931 Bacteria 3043
123 Ga0097620_100203274 3300006931 Bacteria 2066
124 Ga0097620_100343334 3300006931 Unclassified 1587
125 Ga0097620_100512064 3300006931 Unclassified 1295
126 Ga0097620_100559729 3300006931 Unclassified 1238
127 Ga0097620_102165917 3300006931 Bacteria 614
128 Ga0075435_100082108 3300007076 Bacteria 2649
129 Ga0075435_101258381 3300007076 Unclassified 648
130 Ga0105240_10035708 3300009093 Bacteria 6403
131 Ga0105240_10241064 3300009093 Bacteria 2096
132 Ga0111539_10021425 3300009094 Bacteria 7955
133 Ga0111539_10628105 3300009094 Unclassified 1251
134 Ga0105245_10085506 3300009098 Bacteria 2891
135 Ga0105245_10775618 3300009098 Bacteria 996
136 Ga0105247_10024530 3300009101 Bacteria 3635
137 Ga0114129_10000307 3300009147 Bacteria 57086
138 Ga0114129_10000789 3300009147 Bacteria 40604
139 Ga0114129_10076385 3300009147 Bacteria 4664
140 Ga0114129_10109361 3300009147 Bacteria 3816
141 Ga0105242_11645398 3300009176 Unclassified 677
142 Ga0105248_10000664 3300009177 Bacteria 39095
143 Ga0105248_10050807 3300009177 Bacteria 4651
144 Ga0105248_12230368 3300009177 Bacteria 623
145 Ga0105238_10450712 3300009551 Unclassified 1284
146 Ga0105238_10526284 3300009551 Bacteria 1185
147 Ga0105238_10553266 3300009551 Bacteria 1155
148 Ga0105238_11832984 3300009551 Unclassified 639
149 Ga0105238_12046594 3300009551 Bacteria 606
150 Ga0105249_10247787 3300009553 Unclassified 1765
151 Ga0105249_12740280 3300009553 Bacteria 565
152 Ga0099796_10283660 3300010159 Unclassified 697
153 Ga0157370_10257186 3300013104 Bacteria 1614
154 Ga0157378_11471785 3300013297 Unclassified 725
155 Ga0157378_11784597 3300013297 Unclassified 663
156 Ga0163162_10134329 3300013306 Bacteria 2585
157 Ga0157375_10096591 3300013308 Bacteria 3028
158 Ga0157375_10823595 3300013308 Bacteria 1076
159 Ga0163163_10037461 3300014325 Bacteria 4718
160 Ga0163163_10177830 3300014325 Bacteria 2175
161 Ga0163163_10252465 3300014325 Bacteria 1814
162 Ga0163163_10509088 3300014325 Unclassified 1266
163 Ga0157380_11092576 3300014326 Unclassified 836
164 Ga0157377_10206699 3300014745 Unclassified 1250
165 Ga0157377_10577094 3300014745 Bacteria 798
166 Ga0157379_10014142 3300014968 Bacteria 6998
167 Ga0157379_10036017 3300014968 Bacteria 4413
168 Ga0157379_10481188 3300014968 Bacteria 1149
169 Ga0163161_11318991 3300017792 Unclassified 628
170 Ga0207656_10124855 3300025321 Bacteria 1202
171 Ga0207682_10402948 3300025893 Unclassified 647
172 Ga0207710_10022196 3300025900 Bacteria 2724
173 Ga0207710_10406236 3300025900 Bacteria 699
174 Ga0207680_10193593 3300025903 Unclassified 1382
175 Ga0207680_10468303 3300025903 Bacteria 895
176 Ga0207699_11453008 3300025906 Bacteria 507
177 Ga0207684_10609555 3300025910 Bacteria 932
178 Ga0207684_10683858 3300025910 Unclassified 873
179 Ga0207684_10686459 3300025910 Unclassified 871
180 Ga0207707_10068160 3300025912 Bacteria 3100
181 Ga0207707_10242644 3300025912 Bacteria 1566
182 Ga0207707_10737473 3300025912 Bacteria 825
183 Ga0207660_10082281 3300025917 Bacteria 2368
184 Ga0207662_10372957 3300025918 Unclassified 963
185 Ga0207657_10006060 3300025919 Bacteria 12572
186 Ga0207649_10854027 3300025920 Bacteria 712
187 Ga0207652_10185355 3300025921 Bacteria 1871
188 Ga0207652_10273897 3300025921 Bacteria 1522
189 Ga0207646_10436414 3300025922 Bacteria 1182
190 Ga0207646_10719495 3300025922 Unclassified 892
191 Ga0207681_10024664 3300025923 Bacteria 3861
192 Ga0207687_10300780 3300025927 Unclassified 1292
193 Ga0207687_10437967 3300025927 Unclassified 1082
194 Ga0207687_10550672 3300025927 Bacteria 968
195 Ga0207687_10837225 3300025927 Unclassified 786
196 Ga0207664_10329407 3300025929 Bacteria 1348
197 Ga0207644_10014652 3300025931 Bacteria 5251
198 Ga0207706_10031799 3300025933 Bacteria 4700
199 Ga0207686_10010503 3300025934 Bacteria 5044
200 Ga0207686_10012542 3300025934 Bacteria 4661
201 Ga0207670_10083344 3300025936 Unclassified 2243
202 Ga0207704_10008157 3300025938 Bacteria 4988
203 Ga0207691_10033670 3300025940 Bacteria 4771
204 Ga0207691_10075797 3300025940 Unclassified 3032
205 Ga0207711_10006064 3300025941 Bacteria 10214
206 Ga0207711_10039833 3300025941 Bacteria 3997
207 Ga0207711_10118792 3300025941 Bacteria 2359
208 Ga0207711_10129145 3300025941 Bacteria 2264
209 Ga0207711_11341436 3300025941 Bacteria 658
210 Ga0207689_10083643 3300025942 Unclassified 2624
211 Ga0207667_10164928 3300025949 Bacteria 2278
212 Ga0207667_10524244 3300025949 Unclassified 1200
213 Ga0207651_10092207 3300025960 Unclassified 2221
214 Ga0207712_10156662 3300025961 Unclassified 1765
215 Ga0207668_10170583 3300025972 Unclassified 1706
216 Ga0207640_11085845 3300025981 Bacteria 707
217 Ga0207658_10112713 3300025986 Unclassified 2153
218 Ga0207658_10449839 3300025986 Bacteria 1140
219 Ga0207677_10019307 3300026023 Bacteria 4114
220 Ga0207677_10944500 3300026023 Unclassified 779
221 Ga0207703_10019213 3300026035 Bacteria 5337
222 Ga0207703_10024004 3300026035 Bacteria 4797
223 Ga0207639_11036476 3300026041 Unclassified 769
224 Ga0207639_11054875 3300026041 Unclassified 762
225 Ga0207639_11448323 3300026041 Bacteria 645
226 Ga0207702_10629182 3300026078 Bacteria 1054
227 Ga0207641_10002582 3300026088 Bacteria 16638
228 Ga0207641_10145021 3300026088 Bacteria 2146
229 Ga0207648_10029943 3300026089 Bacteria 4828
230 Ga0207648_10417836 3300026089 Bacteria 1217
231 Ga0207676_10009653 3300026095 Bacteria 6867
232 Ga0207676_10068031 3300026095 Unclassified 2847
233 Ga0207676_10431392 3300026095 Bacteria 1238
234 Ga0207676_10660422 3300026095 Bacteria 1010
235 Ga0207674_10921161 3300026116 Bacteria 842
236 Ga0207675_100338141 3300026118 Bacteria 1473
237 Ga0207428_10304888 3300027907 Bacteria 1178
238 Ga0268266_10003647 3300028379 Bacteria 15228
239 Ga0268266_10060059 3300028379 Bacteria 3276
240 Ga0268265_10010183 3300028380 Bacteria 6345
241 Ga0268264_10037812 3300028381 Bacteria 3981
242 Ga0268264_10206995 3300028381 Bacteria 1798
243 Ga0268264_10442883 3300028381 Unclassified 1257
244 Ga0307408_100604077 3300031548 Bacteria 975
245 Ga0373951_0259017 3300035091 Unclassified 525
246 Ga0373941_0010605 3300035115 Bacteria 2359
247 Ga0373953_0201907 3300035117 Bacteria 860
248 Ga0373954_0065237 3300035118 Bacteria 1723
249 Ga0373957_0063633 3300035120 Unclassified 1433
250 Ga0373957_0327535 3300035120 Bacteria 652
251 Ga0373955_0256596 3300035172 Bacteria 1049
252 Ga0373924_0244192 3300035410 Bacteria 794
253 Ga0373931_0233278 3300035691 Bacteria 1113
254 Ga0373931_0577101 3300035691 Unclassified 733
255 Ga0373935_0188091 3300035692 Bacteria 1421
256 Ga0373933_0532778 3300035724 Bacteria 770
257 Ga0373937_0156885 3300036401 Bacteria 2133
258 Ga0373925_0128759 3300037068 Bacteria 1972
259 Ga0395905_1465788 3300037471 Unclassified 587
260 Ga0466967_0624998 3300045976 Bacteria 1064
261 Ga0495603_0021423 3300046455 Bacteria 3915
262 Ga0495629_0256171 3300046459 Unclassified 1203
263 Ga0495582_0315470 3300046473 Bacteria 899
264 Ga0495582_0395511 3300046473 Bacteria 797
265 Ga0495639_0310875 3300046475 Unclassified 787
266 Ga0495594_0196248 3300046499 Unclassified 1150
267 Ga0495640_0488102 3300046533 Bacteria 750
268 Ga0495587_0320328 3300046536 Bacteria 866
269 Ga0495609_0358357 3300046538 Unclassified 588
270 Ga0495645_0000493 3300046543 Bacteria 27347
271 Ga0495635_0216799 3300046663 Bacteria 1295
272 Ga0495647_0012252 3300046681 Bacteria 2951
273 Ga0495658_0033467 3300046683 Bacteria 2815
274 Ga0495658_0056315 3300046683 Bacteria 2242
275 Ga0495658_0063428 3300046683 Bacteria 2126
276 Ga0495669_0097404 3300046684 Unclassified 1364
277 Ga0495669_0567991 3300046684 Bacteria 552
278 Ga0495613_0220145 3300046689 Bacteria 1333
279 Ga0495613_0370118 3300046689 Bacteria 981
280 Ga0495670_0216473 3300046691 Unclassified 1017
281 Ga0495600_0248651 3300046809 Bacteria 1131
282 Ga0495600_0291254 3300046809 Bacteria 1032
283 Ga0495674_0145881 3300047319 Bacteria 1987
284 Ga0495684_0149730 3300047471 Bacteria 1745
285 Ga0496102_1073036 3300048905 Bacteria 725
286 Ga0496104_0341060 3300048907 Bacteria 1411
287 Ga0496104_0359044 3300048907 Unclassified 1369
288 Ga0496104_0647275 3300048907 Bacteria 966
289 Ga0496104_0656587 3300048907 Bacteria 958
290 Ga0496106_0142184 3300048909 Unclassified 1888
291 Ga0496108_0879148 3300048911 Unclassified 770
292 Ga0496109_0384298 3300048912 Bacteria 1326
293 Ga0496110_0639585 3300048913 Unclassified 963
294 Ga0496111_0181004 3300048914 Bacteria 1567
295 Ga0496112_0111200 3300048915 Bacteria 2709
296 Ga0496112_0251537 3300048915 Bacteria 1718
297 Ga0496112_0398210 3300048915 Bacteria 1317
298 Ga0496112_0431450 3300048915 Bacteria 1256
299 Ga0496112_1457444 3300048915 Bacteria 599
300 Ga0496113_0034696 3300048916 Bacteria 3683
301 Ga0496114_0124303 3300048917 Bacteria 2222
302 Ga0496114_0164143 3300048917 Unclassified 1933
303 Ga0496114_0500061 3300048917 Bacteria 1075
304 Ga0496115_0003552 3300048918 Bacteria 11219
305 Ga0501067_0641241 3300049583 Unclassified 596
306 Ga0501069_0458860 3300049585 Unclassified 758
307 nmdc:mga05p37_14046_c1 3300050507 Bacteria 9606
308 nmdc:mga05p37_24381_c1 3300050507 Bacteria 7351
309 nmdc:mga05p37_352216_c1 3300050507 Unclassified 1733
310 nmdc:mga05p37_6052_c1 3300050507 Bacteria 14241
311 nmdc:mga05p37_6700_c1 3300050507 Bacteria 13572
312 nmdc:mga09592_441337_c1 3300050508 Bacteria 1123
313 nmdc:mga08y16_350047_c1 3300050511 Bacteria 1518
314 nmdc:mga08y16_900335_c1 3300050511 Unclassified 871
315 nmdc:mga0n895_1025437_c1 3300050512 Bacteria 805
316 nmdc:mga0n895_1402069_c1 3300050512 Unclassified 667
317 nmdc:mga0n895_1860906_c1 3300050512 Bacteria 561
318 nmdc:mga0n895_242084_c1 3300050512 Bacteria 1831
319 nmdc:mga0n895_380594_c1 3300050512 Bacteria 1428
320 nmdc:mga0rr50_1152075_c1 3300050513 Unclassified 659
321 nmdc:mga0rr50_220641_c1 3300050513 Bacteria 1565
322 nmdc:mga0rr50_227402_c1 3300050513 Unclassified 1542
323 nmdc:mga08x19_11103_c1 3300050514 Bacteria 5422
324 nmdc:mga08x19_490464_c1 3300050514 Bacteria 867
325 nmdc:mga0a205_31596_c1 3300050515 Bacteria 5073
326 nmdc:mga0a205_35921_c1 3300050515 Bacteria 4760
327 nmdc:mga0a205_85338_c1 3300050515 Bacteria 3049
328 nmdc:mga0a205_894977_c1 3300050515 Bacteria 734
329 nmdc:mga0a205_934899_c1 3300050515 Unclassified 714
330 Ga0495595_0249307 3300053084 Bacteria 889
331 Ga0495619_0100225 3300053085 Bacteria 1971
332 Ga0495619_0287448 3300053085 Bacteria 1139
333 nmdc:mga05p37_31102_c1
334 JGI25406J46586_10090306
335 rootL2_10219388
336 Ga0065715_10246798
337 Ga0070683_100773665
338 Ga0070683_101740368
339 Ga0070690_100223657
340 Ga0070670_100824891
341 Ga0068869_100056488
342 Ga0068869_100812864
343 Ga0070666_10088868
344 Ga0070666_10333764
345 Ga0070680_100390892
346 Ga0070680_101238623
347 Ga0068868_100105681
348 Ga0068868_101139428
349 Ga0068868_102232217
350 Ga0070660_100001966
351 Ga0070660_100729737
352 Ga0070689_100123135
353 Ga0070689_100203176
354 Ga0070669_100003911
355 Ga0070675_100203911
356 Ga0070675_100709176
357 Ga0070671_100187866
358 Ga0070674_100934534
359 Ga0070673_100109066
360 Ga0070688_100396803
361 Ga0070667_100087715
362 Ga0070667_100358468
363 Ga0070714_100184679
364 Ga0070713_100343239
365 Ga0070708_100026937
366 Ga0070708_100621751
367 Ga0070708_100944084
368 Ga0070678_100767188
369 Ga0070681_10152148
370 Ga0070681_10227742
371 Ga0070681_10255446
372 Ga0068867_100365368
373 Ga0068867_101334205
374 Ga0070706_100212772
375 Ga0070706_100794392
376 Ga0070707_100160436
377 Ga0070707_100655670
378 Ga0070707_101233216
379 Ga0070699_100217975
380 Ga0070699_100583090
381 Ga0070679_100033161
382 Ga0070679_100247473
383 Ga0070679_101911568
384 Ga0070684_100270093
385 Ga0070684_100947396
386 Ga0070697_100023150
387 Ga0070697_100584482
388 Ga0068853_100297785
389 Ga0070672_100002400
390 Ga0070672_100270429
391 Ga0070686_101194318
392 Ga0070695_100113357
393 Ga0070696_100122533
394 Ga0070665_100001535
395 Ga0070665_100040249
396 Ga0070704_100038881
397 Ga0068855_100288897
398 Ga0068855_100327020
399 Ga0068855_100385525
400 Ga0070664_101708266
401 Ga0068854_100547908
402 Ga0068854_101109895
403 Ga0068854_101225402
404 Ga0068854_101274325
405 Ga0068854_102001864
406 Ga0068856_100904688
407 Ga0070702_100085936
408 Ga0068852_100663910
409 Ga0068859_100094398
410 Ga0068859_100203276
411 Ga0068859_100343313
412 Ga0068859_100512079
413 Ga0068859_100559744
414 Ga0068859_102166108
415 Ga0068864_100026628
416 Ga0068864_100087287
417 Ga0068864_100177823
418 Ga0068864_100685446
419 Ga0068866_10160249
420 Ga0068866_10208195
421 Ga0068861_100802161
422 Ga0068851_10173464
423 Ga0068863_100100997
424 Ga0068863_100350073
425 Ga0068863_100744422
426 Ga0068858_100020865
427 Ga0068858_100911614
428 Ga0068858_101306308
429 Ga0068860_100028009
430 Ga0068860_100505553
431 Ga0068860_100687540
432 Ga0068860_100937398
433 Ga0068862_100012211
434 Ga0081455_10027171
435 Ga0081539_10005884
436 Ga0081539_10234616
437 Ga0070717_10457371
438 Ga0070716_100967950
439 Ga0097621_100005845
440 Ga0097621_100341065
441 Ga0068871_100016282
442 Ga0068871_100253378
443 Ga0075433_10105875
444 Ga0075433_10153870
445 Ga0075433_10171225
446 Ga0075433_11178698
447 Ga0075434_100086513
448 Ga0075434_100477466
449 Ga0075434_101022283
450 Ga0075434_101607170
451 Ga0075429_100803030
452 Ga0068865_100044125
453 Ga0075436_100054340
454 Ga0097620_100094395
455 Ga0097620_100203274
456 Ga0097620_100343334
457 Ga0097620_100512064
458 Ga0097620_100559729
459 Ga0097620_102165917
460 Ga0075435_100082108
461 Ga0075435_101258381
462 Ga0105240_10035708
463 Ga0105240_10241064
464 Ga0111539_10021425
465 Ga0111539_10628105
466 Ga0105245_10085506
467 Ga0105245_10775618
468 Ga0105247_10024530
469 Ga0114129_10000307
470 Ga0114129_10000789
471 Ga0114129_10076385
472 Ga0114129_10109361
473 Ga0105242_11645398
474 Ga0105248_10000664
475 Ga0105248_10050807
476 Ga0105248_12230368
477 Ga0105238_10450712
478 Ga0105238_10526284
479 Ga0105238_10553266
480 Ga0105238_11832984
481 Ga0105238_12046594
482 Ga0105249_10247787
483 Ga0105249_12740280
484 Ga0099796_10283660
485 Ga0157370_10257186
486 Ga0157378_11471785
487 Ga0157378_11784597
488 Ga0163162_10134329
489 Ga0157375_10096591
490 Ga0157375_10823595
491 Ga0163163_10037461
492 Ga0163163_10177830
493 Ga0163163_10252465
494 Ga0163163_10509088
495 Ga0157380_11092576
496 Ga0157377_10206699
497 Ga0157377_10577094
498 Ga0157379_10014142
499 Ga0157379_10036017
500 Ga0157379_10481188
501 Ga0163161_11318991
502 Ga0207656_10124855
503 Ga0207682_10402948
504 Ga0207710_10022196
505 Ga0207710_10406236
506 Ga0207680_10193593
507 Ga0207680_10468303
508 Ga0207699_11453008
509 Ga0207684_10609555
510 Ga0207684_10683858
511 Ga0207684_10686459
512 Ga0207707_10068160
513 Ga0207707_10242644
514 Ga0207707_10737473
515 Ga0207660_10082281
516 Ga0207662_10372957
517 Ga0207657_10006060
518 Ga0207649_10854027
519 Ga0207652_10185355
520 Ga0207652_10273897
521 Ga0207646_10436414
522 Ga0207646_10719495
523 Ga0207681_10024664
524 Ga0207687_10300780
525 Ga0207687_10437967
526 Ga0207687_10550672
527 Ga0207687_10837225
528 Ga0207664_10329407
529 Ga0207644_10014652
530 Ga0207706_10031799
531 Ga0207686_10010503
532 Ga0207686_10012542
533 Ga0207670_10083344
534 Ga0207704_10008157
535 Ga0207691_10033670
536 Ga0207691_10075797
537 Ga0207711_10006064
538 Ga0207711_10039833
539 Ga0207711_10118792
540 Ga0207711_10129145
541 Ga0207711_11341436
542 Ga0207689_10083643
543 Ga0207667_10164928
544 Ga0207667_10524244
545 Ga0207651_10092207
546 Ga0207712_10156662
547 Ga0207668_10170583
548 Ga0207640_11085845
549 Ga0207658_10112713
550 Ga0207658_10449839
551 Ga0207677_10019307
552 Ga0207677_10944500
553 Ga0207703_10019213
554 Ga0207703_10024004
555 Ga0207639_11036476
556 Ga0207639_11054875
557 Ga0207639_11448323
558 Ga0207702_10629182
559 Ga0207641_10002582
560 Ga0207641_10145021
561 Ga0207648_10029943
562 Ga0207648_10417836
563 Ga0207676_10009653
564 Ga0207676_10068031
565 Ga0207676_10431392
566 Ga0207676_10660422
567 Ga0207674_10921161
568 Ga0207675_100338141
569 Ga0207428_10304888
570 Ga0268266_10003647
571 Ga0268266_10060059
572 Ga0268265_10010183
573 Ga0268264_10037812
574 Ga0268264_10206995
575 Ga0268264_10442883
576 Ga0307408_100604077
577 Ga0373951_0259017
578 Ga0373941_0010605
579 Ga0373953_0201907
580 Ga0373954_0065237
581 Ga0373957_0063633
582 Ga0373957_0327535
583 Ga0373955_0256596
584 Ga0373924_0244192
585 Ga0373931_0233278
586 Ga0373931_0577101
587 Ga0373935_0188091
588 Ga0373933_0532778
589 Ga0373937_0156885
590 Ga0373925_0128759
591 Ga0395905_1465788
592 Ga0466967_0624998
593 Ga0495603_0021423
594 Ga0495629_0256171
595 Ga0495582_0315470
596 Ga0495582_0395511
597 Ga0495639_0310875
598 Ga0495594_0196248
599 Ga0495640_0488102
600 Ga0495587_0320328
601 Ga0495609_0358357
602 Ga0495645_0000493
603 Ga0495635_0216799
604 Ga0495647_0012252
605 Ga0495658_0033467
606 Ga0495658_0056315
607 Ga0495658_0063428
608 Ga0495669_0097404
609 Ga0495669_0567991
610 Ga0495613_0220145
611 Ga0495613_0370118
612 Ga0495670_0216473
613 Ga0495600_0248651
614 Ga0495600_0291254
615 Ga0495674_0145881
616 Ga0495684_0149730
617 Ga0496102_1073036
618 Ga0496104_0341060
619 Ga0496104_0359044
620 Ga0496104_0647275
621 Ga0496104_0656587
622 Ga0496106_0142184
623 Ga0496108_0879148
624 Ga0496109_0384298
625 Ga0496110_0639585
626 Ga0496111_0181004
627 Ga0496112_0111200
628 Ga0496112_0251537
629 Ga0496112_0398210
630 Ga0496112_0431450
631 Ga0496112_1457444
632 Ga0496113_0034696
633 Ga0496114_0124303
634 Ga0496114_0164143
635 Ga0496114_0500061
636 Ga0496115_0003552
637 Ga0501067_0641241
638 Ga0501069_0458860
639 nmdc:mga05p37_14046_c1
640 nmdc:mga05p37_24381_c1
641 nmdc:mga05p37_352216_c1
642 nmdc:mga05p37_6052_c1
643 nmdc:mga05p37_6700_c1
644 nmdc:mga09592_441337_c1
645 nmdc:mga08y16_350047_c1
646 nmdc:mga08y16_900335_c1
647 nmdc:mga0n895_1025437_c1
648 nmdc:mga0n895_1402069_c1
649 nmdc:mga0n895_1860906_c1
650 nmdc:mga0n895_242084_c1
651 nmdc:mga0n895_380594_c1
652 nmdc:mga0rr50_1152075_c1
653 nmdc:mga0rr50_220641_c1
654 nmdc:mga0rr50_227402_c1
655 nmdc:mga08x19_11103_c1
656 nmdc:mga08x19_490464_c1
657 nmdc:mga0a205_31596_c1
658 nmdc:mga0a205_35921_c1
659 nmdc:mga0a205_85338_c1
660 nmdc:mga0a205_894977_c1
661 nmdc:mga0a205_934899_c1
662 Ga0495595_0249307
663 Ga0495619_0100225
664 Ga0495619_0287448

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07681

DoxX

DoxX

9

111

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3v3c-assembly1.cif.gz_K crystal structure of chloroplast atp synthase c-ring from pisum sativum 0.4578 8 85
3v3c-assembly1.cif.gz_B crystal structure of chloroplast atp synthase c-ring from pisum sativum 0.4576 8 85
3v3c-assembly1.cif.gz_K crystal structure of chloroplast atp synthase c-ring from pisum sativum 0.4205 8 85
3v3c-assembly1.cif.gz_B crystal structure of chloroplast atp synthase c-ring from pisum sativum 0.4204 8 85
6wvg-assembly2.cif.gz_B human cd53 0.3871 8 130
ID Description Score Start End Superfamily
af_Q7KSM4_10_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6976 9 134 1.20.120.550
af_Q7TP91_4_196_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6958 8 144 1.20.120.550
af_A4IAM6_1_156_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6683 1 135 1.20.120.550
af_Q2FUV7_1_119_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6519 8 134 1.10.10.1740
af_Q8NCS4_7_125_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6396 11 131 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A2V8GIH6-F1-model_v4 DoxX family protein 0.9733 1 144 GO:0016020
AF-A0A6B0WAM7-F1-model_v4 DoxX family membrane protein 0.9699 1 112 GO:0016020
AF-A0A2V8GIH6-F1-model_v4 DoxX family protein 0.9666 1 144 GO:0016020
AF-A0A1F2SCU5-F1-model_v4 DoxX family protein 0.9606 2 144 GO:0016020
AF-A0A2E4FSV8-F1-model_v4 DoxX family protein 0.9559 2 144 GO:0016020

Map