F411128

General Info

Members Datasets Scaffolds Average Seq Length
332 243 664 95

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0927071|Ga0501081_0927071_15_362
Length 115
Sequence MRSSYTYIGIFQAVTISEVERAVHDRGGWPTDAPIDRSEHELADWEMLMDAIVGTLGSRGVMNVDELRRGIEAMPPEEYERASYYERWLASVEINLTEKGVLAPGELDEQLRSGE

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
19 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
20 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
41 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
44 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
62 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
63 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
115 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
122 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
123 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
124 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
125 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
133 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
144 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
147 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
148 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
157 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
158 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
159 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
167 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
168 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
195 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
234 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.43
Rhizosphere 90.36
Stem 0
Stem Tuber 0
Unclassified 8.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0927071 3300049743 Bacteria 657
2 Ga0070683_100025800 3300005329 Bacteria 5285
3 Ga0070670_101221705 3300005331 Bacteria 687
4 Ga0068869_100115780 3300005334 Bacteria 2044
5 Ga0068868_100016444 3300005338 Bacteria 5494
6 Ga0068868_100149050 3300005338 Bacteria 1925
7 Ga0070660_100015311 3300005339 Bacteria 5535
8 Ga0070691_10055409 3300005341 Bacteria 1899
9 Ga0070687_100197752 3300005343 Bacteria 1216
10 Ga0070661_100363517 3300005344 Bacteria 1138
11 Ga0070692_10092926 3300005345 Bacteria 1642
12 Ga0070675_100038497 3300005354 Bacteria 3898
13 Ga0070673_100551966 3300005364 Bacteria 1047
14 Ga0070711_100484896 3300005439 Bacteria 1017
15 Ga0070711_100618000 3300005439 Bacteria 905
16 Ga0070711_101427789 3300005439 Bacteria 603
17 Ga0070700_100407246 3300005441 Bacteria 1024
18 Ga0070662_100469437 3300005457 Bacteria 1047
19 Ga0070681_10415757 3300005458 Bacteria 1256
20 Ga0070685_10528406 3300005466 Bacteria 839
21 Ga0070706_100849120 3300005467 Bacteria 844
22 Ga0070707_100066763 3300005468 Bacteria 3458
23 Ga0070707_100871269 3300005468 Bacteria 865
24 Ga0070698_101136066 3300005471 Bacteria 730
25 Ga0070698_101421927 3300005471 Unclassified 644
26 Ga0070698_101542069 3300005471 Bacteria 616
27 Ga0070699_100029684 3300005518 Bacteria 4715
28 Ga0070699_101710948 3300005518 Bacteria 576
29 Ga0070679_100342185 3300005530 Bacteria 1444
30 Ga0070684_100135173 3300005535 Unclassified 2227
31 Ga0070684_100167073 3300005535 Bacteria 1997
32 Ga0070697_101315216 3300005536 Unclassified 645
33 Ga0068853_100497001 3300005539 Bacteria 1151
34 Ga0070686_100335120 3300005544 Bacteria 1132
35 Ga0070695_101145461 3300005545 Bacteria 638
36 Ga0070696_101289136 3300005546 Unclassified 620
37 Ga0070693_100230207 3300005547 Bacteria 1219
38 Ga0070704_101240114 3300005549 Unclassified 681
39 Ga0068855_100002345 3300005563 Bacteria 23377
40 Ga0068855_100097543 3300005563 Bacteria 3385
41 Ga0068857_100062326 3300005577 Bacteria 3315
42 Ga0068854_100355131 3300005578 Bacteria 1201
43 Ga0068854_101007144 3300005578 Bacteria 738
44 Ga0068856_100181501 3300005614 Bacteria 2118
45 Ga0068856_101156563 3300005614 Bacteria 791
46 Ga0070702_100204063 3300005615 Bacteria 1311
47 Ga0070702_100215088 3300005615 Bacteria 1282
48 Ga0068852_100086080 3300005616 Bacteria 2801
49 Ga0068866_10144919 3300005718 Bacteria 1368
50 Ga0068860_100128012 3300005843 Bacteria 2435
51 Ga0075432_10422379 3300006058 Bacteria 580
52 Ga0070716_100515420 3300006173 Bacteria 885
53 Ga0070716_100920809 3300006173 Bacteria 686
54 Ga0070712_100246849 3300006175 Bacteria 1424
55 Ga0070712_100898580 3300006175 Bacteria 763
56 Ga0097621_100692501 3300006237 Bacteria 938
57 Ga0075430_100180353 3300006846 Bacteria 1757
58 Ga0075431_100321009 3300006847 Bacteria 1562
59 Ga0075431_102052888 3300006847 Unclassified 527
60 Ga0075433_10910821 3300006852 Unclassified 767
61 Ga0075434_100068175 3300006871 Bacteria 3544
62 Ga0075429_100361630 3300006880 Bacteria 1271
63 Ga0068865_100105986 3300006881 Bacteria 2066
64 Ga0068865_100233506 3300006881 Bacteria 1444
65 Ga0068865_100388912 3300006881 Unclassified 1139
66 Ga0075436_100720142 3300006914 Bacteria 740
67 Ga0075435_100032789 3300007076 Bacteria 4103
68 Ga0105240_11497602 3300009093 Bacteria 708
69 Ga0111539_10143929 3300009094 Bacteria 2790
70 Ga0111539_12008510 3300009094 Bacteria 671
71 Ga0105245_10006973 3300009098 Bacteria 9908
72 Ga0105245_10343329 3300009098 Bacteria 1477
73 Ga0105245_10886281 3300009098 Unclassified 933
74 Ga0114129_10575813 3300009147 Bacteria 1461
75 Ga0114129_10996754 3300009147 Bacteria 1055
76 Ga0105243_10010119 3300009148 Bacteria 7176
77 Ga0105243_12630437 3300009148 Bacteria 543
78 Ga0105241_10157918 3300009174 Bacteria 1861
79 Ga0105242_10109567 3300009176 Bacteria 2351
80 Ga0105237_10145801 3300009545 Bacteria 2362
81 Ga0105238_10010461 3300009551 Bacteria 9312
82 Ga0105238_11097277 3300009551 Bacteria 818
83 Ga0105239_10011344 3300010375 Bacteria 9941
84 Ga0105239_10025123 3300010375 Bacteria 6561
85 Ga0105246_10232656 3300011119 Bacteria 1452
86 Ga0157341_1025637 3300012494 Unclassified 609
87 Ga0157369_11088411 3300013105 Bacteria 817
88 Ga0157374_10036131 3300013296 Bacteria 4524
89 Ga0163162_10055594 3300013306 Bacteria 3986
90 Ga0157372_10204225 3300013307 Bacteria 2289
91 Ga0157375_10207490 3300013308 Bacteria 2116
92 Ga0163163_10008286 3300014325 Bacteria 9224
93 Ga0157380_10716398 3300014326 Bacteria 1008
94 Ga0157380_13081574 3300014326 Bacteria 531
95 Ga0157377_10071347 3300014745 Bacteria 2008
96 Ga0157377_10495012 3300014745 Bacteria 853
97 Ga0157376_10044430 3300014969 Bacteria 3652
98 Ga0157376_10082355 3300014969 Bacteria 2765
99 Ga0157376_10884539 3300014969 Bacteria 910
100 Ga0207680_11317132 3300025903 Bacteria 513
101 Ga0207685_10450575 3300025905 Bacteria 669
102 Ga0207695_10093815 3300025913 Bacteria 3010
103 Ga0207671_10087033 3300025914 Bacteria 2349
104 Ga0207693_10366519 3300025915 Bacteria 1127
105 Ga0207663_10776359 3300025916 Bacteria 762
106 Ga0207663_11379619 3300025916 Bacteria 568
107 Ga0207660_10847106 3300025917 Unclassified 746
108 Ga0207662_10102047 3300025918 Bacteria 1779
109 Ga0207657_10024554 3300025919 Bacteria 5575
110 Ga0207652_10202704 3300025921 Bacteria 1785
111 Ga0207650_10052310 3300025925 Bacteria 3025
112 Ga0207659_10056127 3300025926 Bacteria 2820
113 Ga0207687_10000431 3300025927 Bacteria 28444
114 Ga0207644_10132676 3300025931 Bacteria 1909
115 Ga0207644_10252745 3300025931 Bacteria 1407
116 Ga0207686_10273113 3300025934 Bacteria 1244
117 Ga0207686_10901908 3300025934 Unclassified 713
118 Ga0207709_10664233 3300025935 Unclassified 831
119 Ga0207704_10229864 3300025938 Bacteria 1378
120 Ga0207665_10231912 3300025939 Bacteria 1357
121 Ga0207691_10333710 3300025940 Bacteria 1299
122 Ga0207711_10055100 3300025941 Bacteria 3414
123 Ga0207689_10105152 3300025942 Bacteria 2319
124 Ga0207661_10020128 3300025944 Bacteria 4983
125 Ga0207667_10008619 3300025949 Bacteria 12094
126 Ga0207640_10136910 3300025981 Bacteria 1779
127 Ga0207658_10169439 3300025986 Bacteria 1798
128 Ga0207677_10088696 3300026023 Bacteria 2243
129 Ga0207703_10128670 3300026035 Bacteria 2184
130 Ga0207708_10067901 3300026075 Bacteria 2728
131 Ga0207702_10001710 3300026078 Bacteria 21626
132 Ga0207641_10293547 3300026088 Bacteria 1533
133 Ga0207648_10277863 3300026089 Bacteria 1497
134 Ga0207648_11026930 3300026089 Bacteria 772
135 Ga0207676_10203647 3300026095 Bacteria 1750
136 Ga0207674_10038799 3300026116 Bacteria 4941
137 Ga0207675_100306127 3300026118 Bacteria 1549
138 Ga0207683_10366556 3300026121 Bacteria 1323
139 Ga0207698_10063571 3300026142 Bacteria 2889
140 Ga0268264_10104683 3300028381 Bacteria 2467
141 Ga0373926_0107988 3300035083 Bacteria 1044
142 Ga0373934_0046600 3300035086 Bacteria 1715
143 Ga0373923_0115411 3300035111 Bacteria 1196
144 Ga0373936_0087773 3300035113 Bacteria 1301
145 Ga0373945_0193081 3300035116 Bacteria 842
146 Ga0373953_0066748 3300035117 Bacteria 1479
147 Ga0373956_0190522 3300035119 Bacteria 971
148 Ga0373957_0040625 3300035120 Bacteria 1750
149 Ga0373943_0024709 3300035170 Bacteria 2803
150 Ga0373943_0204389 3300035170 Bacteria 1094
151 Ga0373946_0001922 3300035171 Bacteria 7252
152 Ga0373946_0197542 3300035171 Bacteria 962
153 Ga0373955_0055791 3300035172 Bacteria 2165
154 Ga0373924_0180164 3300035410 Bacteria 930
155 Ga0373935_0013949 3300035692 Bacteria 4853
156 Ga0373935_0019225 3300035692 Bacteria 4166
157 Ga0373935_0895941 3300035692 Bacteria 657
158 Ga0373927_0225045 3300035695 Bacteria 1232
159 Ga0373933_0551240 3300035724 Bacteria 756
160 Ga0373947_0020464 3300035725 Bacteria 3820
161 Ga0373947_0826555 3300035725 Bacteria 632
162 Ga0373937_0593714 3300036401 Bacteria 1051
163 Ga0373925_0003160 3300037068 Bacteria 12904
164 Ga0373925_0116629 3300037068 Bacteria 2068
165 Ga0395899_0034820 3300037312 Bacteria 3782
166 Ga0395899_0773270 3300037312 Bacteria 596
167 Ga0395900_0001856 3300037418 Bacteria 24085
168 Ga0395900_0682120 3300037418 Unclassified 962
169 Ga0395898_0018012 3300037466 Bacteria 7206
170 Ga0395898_0338214 3300037466 Bacteria 1435
171 Ga0395905_0008770 3300037471 Bacteria 9943
172 Ga0395905_0139870 3300037471 Bacteria 2278
173 Ga0395905_0905339 3300037471 Unclassified 785
174 Ga0395901_0114581 3300038443 Unclassified 2831
175 Ga0395901_0281011 3300038443 Bacteria 1729
176 Ga0395901_0393728 3300038443 Bacteria 1424
177 Ga0395901_0533382 3300038443 Unclassified 1191
178 Ga0395901_1524386 3300038443 Unclassified 624
179 Ga0436363_1198577 3300039450 Bacteria 588
180 Ga0451795_0319804 3300041456 Unclassified 654
181 Ga0451800_0733334 3300041459 Bacteria 835
182 Ga0451847_0715813 3300041503 Bacteria 949
183 Ga0451853_0008697 3300041512 Bacteria 4082
184 Ga0451853_0759727 3300041512 Unclassified 767
185 Ga0450907_025975 3300042146 Bacteria 991
186 Ga0466963_0896414 3300044694 Unclassified 625
187 Ga0466964_0063836 3300044706 Bacteria 1539
188 Ga0466967_0316189 3300045976 Bacteria 1505
189 Ga0495592_0171492 3300046454 Bacteria 1485
190 Ga0495603_0053981 3300046455 Bacteria 2383
191 Ga0495590_0090121 3300046457 Bacteria 1084
192 Ga0495591_114669 3300046458 Bacteria 660
193 Ga0495629_0092460 3300046459 Bacteria 2111
194 Ga0495641_0025600 3300046461 Bacteria 2894
195 Ga0495641_0042691 3300046461 Bacteria 2100
196 Ga0495641_0228865 3300046461 Bacteria 834
197 Ga0495651_0269299 3300046462 Bacteria 1155
198 Ga0495653_0020653 3300046463 Bacteria 5335
199 Ga0495580_0046601 3300046472 Bacteria 3075
200 Ga0495582_0016765 3300046473 Bacteria 4013
201 Ga0495582_0146139 3300046473 Bacteria 1341
202 Ga0495639_0008459 3300046475 Bacteria 4412
203 Ga0495662_0001005 3300046476 Bacteria 13817
204 Ga0495664_0018446 3300046477 Bacteria 3999
205 Ga0495584_0077398 3300046491 Bacteria 1673
206 Ga0495584_0240877 3300046491 Bacteria 920
207 Ga0495594_0010876 3300046499 Bacteria 4726
208 Ga0495607_0205232 3300046501 Bacteria 973
209 Ga0495608_0157209 3300046511 Bacteria 1446
210 Ga0495618_0084695 3300046514 Bacteria 2025
211 Ga0495620_0357146 3300046515 Bacteria 554
212 Ga0495628_0260580 3300046516 Bacteria 1292
213 Ga0495628_0519348 3300046516 Unclassified 858
214 Ga0495630_0035680 3300046517 Bacteria 3715
215 Ga0495666_0028141 3300046526 Bacteria 2766
216 Ga0495652_0324013 3300046529 Bacteria 1112
217 Ga0495665_0022475 3300046531 Bacteria 3390
218 Ga0495665_0101585 3300046531 Bacteria 1509
219 Ga0495640_0124257 3300046533 Bacteria 1674
220 Ga0495586_0033130 3300046535 Bacteria 2772
221 Ga0495587_0030522 3300046536 Bacteria 3268
222 Ga0495598_0376543 3300046537 Bacteria 551
223 Ga0495622_0215442 3300046557 Bacteria 852
224 Ga0495667_0376472 3300046559 Bacteria 895
225 Ga0495668_0561522 3300046616 Bacteria 630
226 Ga0495634_0069352 3300046642 Bacteria 2326
227 Ga0495634_0081812 3300046642 Bacteria 2111
228 Ga0495635_0004258 3300046663 Bacteria 9917
229 Ga0495659_0214186 3300046664 Bacteria 794
230 Ga0495588_0005969 3300046674 Bacteria 5461
231 Ga0495588_0066892 3300046674 Bacteria 1865
232 Ga0495623_0093125 3300046679 Bacteria 1845
233 Ga0495646_0058473 3300046680 Bacteria 2305
234 Ga0495647_0039285 3300046681 Bacteria 1793
235 Ga0495647_0207833 3300046681 Bacteria 860
236 Ga0495658_0002509 3300046683 Bacteria 9230
237 Ga0495613_0159992 3300046689 Bacteria 1602
238 Ga0495624_0047801 3300046690 Bacteria 2717
239 Ga0495624_0169173 3300046690 Bacteria 1333
240 Ga0495670_0247233 3300046691 Bacteria 950
241 Ga0495671_0044872 3300046692 Bacteria 2215
242 Ga0495589_0160523 3300046794 Bacteria 1071
243 Ga0495600_0046579 3300046809 Bacteria 2828
244 Ga0495581_0003699 3300047315 Bacteria 8808
245 Ga0495604_0697861 3300047317 Bacteria 644
246 Ga0495674_0004604 3300047319 Bacteria 13262
247 Ga0495674_0026049 3300047319 Bacteria 5352
248 Ga0495676_0029010 3300047321 Bacteria 4716
249 Ga0495676_0077661 3300047321 Bacteria 2531
250 Ga0495680_0244084 3300047322 Bacteria 1274
251 Ga0495675_0154960 3300047444 Bacteria 1413
252 Ga0495677_0241512 3300047445 Bacteria 706
253 Ga0495684_0002519 3300047471 Bacteria 14598
254 Ga0495593_0001972 3300047673 Bacteria 12219
255 Ga0495614_0003787 3300048089 Bacteria 6799
256 Ga0495614_0119914 3300048089 Bacteria 1159
257 Ga0496100_0043835 3300048903 Bacteria 2862
258 Ga0496101_0021046 3300048904 Bacteria 4476
259 Ga0496102_0002867 3300048905 Bacteria 14647
260 Ga0496103_0009088 3300048906 Bacteria 5885
261 Ga0496104_0002646 3300048907 Bacteria 15410
262 Ga0496104_0059983 3300048907 Bacteria 3603
263 Ga0496105_0000985 3300048908 Bacteria 19609
264 Ga0496105_0005082 3300048908 Bacteria 9971
265 Ga0496106_0110545 3300048909 Bacteria 2139
266 Ga0496107_0024575 3300048910 Bacteria 4262
267 Ga0496107_0320910 3300048910 Bacteria 1153
268 Ga0496107_0831444 3300048910 Bacteria 675
269 Ga0496108_0002059 3300048911 Bacteria 16107
270 Ga0496109_0003857 3300048912 Bacteria 12520
271 Ga0496110_0000359 3300048913 Bacteria 30505
272 Ga0496110_0077402 3300048913 Unclassified 2959
273 Ga0496111_0000327 3300048914 Bacteria 23617
274 Ga0496111_0865053 3300048914 Bacteria 652
275 Ga0496112_0001371 3300048915 Bacteria 18568
276 Ga0496112_0275478 3300048915 Bacteria 1630
277 Ga0496113_0004119 3300048916 Bacteria 8862
278 Ga0496114_0010451 3300048917 Bacteria 7386
279 Ga0496114_0140030 3300048917 Bacteria 2094
280 Ga0496114_1267003 3300048917 Unclassified 624
281 Ga0496115_0014083 3300048918 Bacteria 6054
282 Ga0496115_0582706 3300048918 Bacteria 891
283 Ga0501036_0211750 3300049572 Bacteria 1628
284 Ga0501037_0459691 3300049573 Bacteria 867
285 Ga0501038_0101282 3300049574 Bacteria 2398
286 Ga0501039_1347540 3300049575 Bacteria 550
287 Ga0501040_0059784 3300049576 Bacteria 2618
288 Ga0501040_0280449 3300049576 Bacteria 1190
289 Ga0501042_0377813 3300049578 Bacteria 1026
290 Ga0501046_0153853 3300049580 Bacteria 1734
291 Ga0501048_0089608 3300049582 Bacteria 2170
292 Ga0501068_0277304 3300049584 Bacteria 1071
293 Ga0501069_0220224 3300049585 Bacteria 1103
294 Ga0501069_0452840 3300049585 Bacteria 763
295 Ga0501071_0043925 3300049587 Bacteria 3206
296 Ga0501071_0117754 3300049587 Bacteria 1967
297 Ga0501071_1425264 3300049587 Unclassified 535
298 Ga0501072_0152959 3300049588 Bacteria 1839
299 Ga0501072_1136496 3300049588 Unclassified 607
300 Ga0501073_0305130 3300049589 Bacteria 1098
301 Ga0501074_0115949 3300049590 Bacteria 1916
302 Ga0501075_0088460 3300049591 Bacteria 2348
303 Ga0501075_0490006 3300049591 Bacteria 938
304 Ga0501075_0636782 3300049591 Bacteria 813
305 Ga0501076_0171669 3300049592 Bacteria 1767
306 Ga0501079_1031087 3300049741 Unclassified 648
307 Ga0501079_1636026 3300049741 Bacteria 506
308 Ga0501080_1276202 3300049742 Bacteria 629
309 Ga0501081_0438748 3300049743 Bacteria 969
310 Ga0501045_0629005 3300049824 Bacteria 794
311 Ga0501045_0665071 3300049824 Bacteria 769
312 nmdc:mga05p37_1303086_c1 3300050507 Bacteria 740
313 nmdc:mga0n895_75033_c1 3300050512 Bacteria 3361
314 nmdc:mga0n895_8978_c1 3300050512 Bacteria 8713
315 nmdc:mga0n895_933802_c1 3300050512 Unclassified 852
316 nmdc:mga0rr50_6584_c1 3300050513 Bacteria 7095
317 nmdc:mga0rr50_9791_c1 3300050513 Bacteria 6050
318 nmdc:mga08x19_134327_c1 3300050514 Bacteria 1667
319 nmdc:mga08x19_881398_c1 3300050514 Bacteria 636
320 nmdc:mga0a205_140226_c1 3300050515 Bacteria 2318
321 Ga0495601_0005390 3300053077 Bacteria 7450
322 Ga0495601_0589907 3300053077 Bacteria 713
323 Ga0495612_0049794 3300053078 Bacteria 1719
324 Ga0495612_0055316 3300053078 Bacteria 1636
325 Ga0495655_0242865 3300053083 Bacteria 603
326 Ga0495595_0106116 3300053084 Bacteria 1359
327 Ga0495619_0003905 3300053085 Bacteria 9583
328 Ga0495619_0011891 3300053085 Bacteria 5481
329 Ga0495619_0086260 3300053085 Bacteria 2121
330 Ga0501084_0068116 3300054114 Bacteria 2980
331 Ga0501082_0123879 3300060353 Bacteria 2241
332 Ga0530510_0728773 3300061734 Bacteria 756
333 Ga0501081_0927071
334 Ga0070683_100025800
335 Ga0070670_101221705
336 Ga0068869_100115780
337 Ga0068868_100016444
338 Ga0068868_100149050
339 Ga0070660_100015311
340 Ga0070691_10055409
341 Ga0070687_100197752
342 Ga0070661_100363517
343 Ga0070692_10092926
344 Ga0070675_100038497
345 Ga0070673_100551966
346 Ga0070711_100484896
347 Ga0070711_100618000
348 Ga0070711_101427789
349 Ga0070700_100407246
350 Ga0070662_100469437
351 Ga0070681_10415757
352 Ga0070685_10528406
353 Ga0070706_100849120
354 Ga0070707_100066763
355 Ga0070707_100871269
356 Ga0070698_101136066
357 Ga0070698_101421927
358 Ga0070698_101542069
359 Ga0070699_100029684
360 Ga0070699_101710948
361 Ga0070679_100342185
362 Ga0070684_100135173
363 Ga0070684_100167073
364 Ga0070697_101315216
365 Ga0068853_100497001
366 Ga0070686_100335120
367 Ga0070695_101145461
368 Ga0070696_101289136
369 Ga0070693_100230207
370 Ga0070704_101240114
371 Ga0068855_100002345
372 Ga0068855_100097543
373 Ga0068857_100062326
374 Ga0068854_100355131
375 Ga0068854_101007144
376 Ga0068856_100181501
377 Ga0068856_101156563
378 Ga0070702_100204063
379 Ga0070702_100215088
380 Ga0068852_100086080
381 Ga0068866_10144919
382 Ga0068860_100128012
383 Ga0075432_10422379
384 Ga0070716_100515420
385 Ga0070716_100920809
386 Ga0070712_100246849
387 Ga0070712_100898580
388 Ga0097621_100692501
389 Ga0075430_100180353
390 Ga0075431_100321009
391 Ga0075431_102052888
392 Ga0075433_10910821
393 Ga0075434_100068175
394 Ga0075429_100361630
395 Ga0068865_100105986
396 Ga0068865_100233506
397 Ga0068865_100388912
398 Ga0075436_100720142
399 Ga0075435_100032789
400 Ga0105240_11497602
401 Ga0111539_10143929
402 Ga0111539_12008510
403 Ga0105245_10006973
404 Ga0105245_10343329
405 Ga0105245_10886281
406 Ga0114129_10575813
407 Ga0114129_10996754
408 Ga0105243_10010119
409 Ga0105243_12630437
410 Ga0105241_10157918
411 Ga0105242_10109567
412 Ga0105237_10145801
413 Ga0105238_10010461
414 Ga0105238_11097277
415 Ga0105239_10011344
416 Ga0105239_10025123
417 Ga0105246_10232656
418 Ga0157341_1025637
419 Ga0157369_11088411
420 Ga0157374_10036131
421 Ga0163162_10055594
422 Ga0157372_10204225
423 Ga0157375_10207490
424 Ga0163163_10008286
425 Ga0157380_10716398
426 Ga0157380_13081574
427 Ga0157377_10071347
428 Ga0157377_10495012
429 Ga0157376_10044430
430 Ga0157376_10082355
431 Ga0157376_10884539
432 Ga0207680_11317132
433 Ga0207685_10450575
434 Ga0207695_10093815
435 Ga0207671_10087033
436 Ga0207693_10366519
437 Ga0207663_10776359
438 Ga0207663_11379619
439 Ga0207660_10847106
440 Ga0207662_10102047
441 Ga0207657_10024554
442 Ga0207652_10202704
443 Ga0207650_10052310
444 Ga0207659_10056127
445 Ga0207687_10000431
446 Ga0207644_10132676
447 Ga0207644_10252745
448 Ga0207686_10273113
449 Ga0207686_10901908
450 Ga0207709_10664233
451 Ga0207704_10229864
452 Ga0207665_10231912
453 Ga0207691_10333710
454 Ga0207711_10055100
455 Ga0207689_10105152
456 Ga0207661_10020128
457 Ga0207667_10008619
458 Ga0207640_10136910
459 Ga0207658_10169439
460 Ga0207677_10088696
461 Ga0207703_10128670
462 Ga0207708_10067901
463 Ga0207702_10001710
464 Ga0207641_10293547
465 Ga0207648_10277863
466 Ga0207648_11026930
467 Ga0207676_10203647
468 Ga0207674_10038799
469 Ga0207675_100306127
470 Ga0207683_10366556
471 Ga0207698_10063571
472 Ga0268264_10104683
473 Ga0373926_0107988
474 Ga0373934_0046600
475 Ga0373923_0115411
476 Ga0373936_0087773
477 Ga0373945_0193081
478 Ga0373953_0066748
479 Ga0373956_0190522
480 Ga0373957_0040625
481 Ga0373943_0024709
482 Ga0373943_0204389
483 Ga0373946_0001922
484 Ga0373946_0197542
485 Ga0373955_0055791
486 Ga0373924_0180164
487 Ga0373935_0013949
488 Ga0373935_0019225
489 Ga0373935_0895941
490 Ga0373927_0225045
491 Ga0373933_0551240
492 Ga0373947_0020464
493 Ga0373947_0826555
494 Ga0373937_0593714
495 Ga0373925_0003160
496 Ga0373925_0116629
497 Ga0395899_0034820
498 Ga0395899_0773270
499 Ga0395900_0001856
500 Ga0395900_0682120
501 Ga0395898_0018012
502 Ga0395898_0338214
503 Ga0395905_0008770
504 Ga0395905_0139870
505 Ga0395905_0905339
506 Ga0395901_0114581
507 Ga0395901_0281011
508 Ga0395901_0393728
509 Ga0395901_0533382
510 Ga0395901_1524386
511 Ga0436363_1198577
512 Ga0451795_0319804
513 Ga0451800_0733334
514 Ga0451847_0715813
515 Ga0451853_0008697
516 Ga0451853_0759727
517 Ga0450907_025975
518 Ga0466963_0896414
519 Ga0466964_0063836
520 Ga0466967_0316189
521 Ga0495592_0171492
522 Ga0495603_0053981
523 Ga0495590_0090121
524 Ga0495591_114669
525 Ga0495629_0092460
526 Ga0495641_0025600
527 Ga0495641_0042691
528 Ga0495641_0228865
529 Ga0495651_0269299
530 Ga0495653_0020653
531 Ga0495580_0046601
532 Ga0495582_0016765
533 Ga0495582_0146139
534 Ga0495639_0008459
535 Ga0495662_0001005
536 Ga0495664_0018446
537 Ga0495584_0077398
538 Ga0495584_0240877
539 Ga0495594_0010876
540 Ga0495607_0205232
541 Ga0495608_0157209
542 Ga0495618_0084695
543 Ga0495620_0357146
544 Ga0495628_0260580
545 Ga0495628_0519348
546 Ga0495630_0035680
547 Ga0495666_0028141
548 Ga0495652_0324013
549 Ga0495665_0022475
550 Ga0495665_0101585
551 Ga0495640_0124257
552 Ga0495586_0033130
553 Ga0495587_0030522
554 Ga0495598_0376543
555 Ga0495622_0215442
556 Ga0495667_0376472
557 Ga0495668_0561522
558 Ga0495634_0069352
559 Ga0495634_0081812
560 Ga0495635_0004258
561 Ga0495659_0214186
562 Ga0495588_0005969
563 Ga0495588_0066892
564 Ga0495623_0093125
565 Ga0495646_0058473
566 Ga0495647_0039285
567 Ga0495647_0207833
568 Ga0495658_0002509
569 Ga0495613_0159992
570 Ga0495624_0047801
571 Ga0495624_0169173
572 Ga0495670_0247233
573 Ga0495671_0044872
574 Ga0495589_0160523
575 Ga0495600_0046579
576 Ga0495581_0003699
577 Ga0495604_0697861
578 Ga0495674_0004604
579 Ga0495674_0026049
580 Ga0495676_0029010
581 Ga0495676_0077661
582 Ga0495680_0244084
583 Ga0495675_0154960
584 Ga0495677_0241512
585 Ga0495684_0002519
586 Ga0495593_0001972
587 Ga0495614_0003787
588 Ga0495614_0119914
589 Ga0496100_0043835
590 Ga0496101_0021046
591 Ga0496102_0002867
592 Ga0496103_0009088
593 Ga0496104_0002646
594 Ga0496104_0059983
595 Ga0496105_0000985
596 Ga0496105_0005082
597 Ga0496106_0110545
598 Ga0496107_0024575
599 Ga0496107_0320910
600 Ga0496107_0831444
601 Ga0496108_0002059
602 Ga0496109_0003857
603 Ga0496110_0000359
604 Ga0496110_0077402
605 Ga0496111_0000327
606 Ga0496111_0865053
607 Ga0496112_0001371
608 Ga0496112_0275478
609 Ga0496113_0004119
610 Ga0496114_0010451
611 Ga0496114_0140030
612 Ga0496114_1267003
613 Ga0496115_0014083
614 Ga0496115_0582706
615 Ga0501036_0211750
616 Ga0501037_0459691
617 Ga0501038_0101282
618 Ga0501039_1347540
619 Ga0501040_0059784
620 Ga0501040_0280449
621 Ga0501042_0377813
622 Ga0501046_0153853
623 Ga0501048_0089608
624 Ga0501068_0277304
625 Ga0501069_0220224
626 Ga0501069_0452840
627 Ga0501071_0043925
628 Ga0501071_0117754
629 Ga0501071_1425264
630 Ga0501072_0152959
631 Ga0501072_1136496
632 Ga0501073_0305130
633 Ga0501074_0115949
634 Ga0501075_0088460
635 Ga0501075_0490006
636 Ga0501075_0636782
637 Ga0501076_0171669
638 Ga0501079_1031087
639 Ga0501079_1636026
640 Ga0501080_1276202
641 Ga0501081_0438748
642 Ga0501045_0629005
643 Ga0501045_0665071
644 nmdc:mga05p37_1303086_c1
645 nmdc:mga0n895_75033_c1
646 nmdc:mga0n895_8978_c1
647 nmdc:mga0n895_933802_c1
648 nmdc:mga0rr50_6584_c1
649 nmdc:mga0rr50_9791_c1
650 nmdc:mga08x19_134327_c1
651 nmdc:mga08x19_881398_c1
652 nmdc:mga0a205_140226_c1
653 Ga0495601_0005390
654 Ga0495601_0589907
655 Ga0495612_0049794
656 Ga0495612_0055316
657 Ga0495655_0242865
658 Ga0495595_0106116
659 Ga0495619_0003905
660 Ga0495619_0011891
661 Ga0495619_0086260
662 Ga0501084_0068116
663 Ga0501082_0123879
664 Ga0530510_0728773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

21

114

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fm4-assembly7.cif.gz_N wild type fe-type nitrile hydratase from comamonas testosteroni ni1 0.9046 7 91
4zgd-assembly1.cif.gz_B mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.8927 5 91
2dd4-assembly1.cif.gz_H thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.8766 9 89
7w8m-assembly1.cif.gz_B-2 crystal structure of co-type nitrile hydratase mutant from pseudomonas thermophila - a129r 0.8722 11 90
3qxe-assembly3.cif.gz_F crystal structure of co-type nitrile hydratase from pseudomonas putida. 0.8712 5 87
ID Description Score Start End Superfamily
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.907 7 91 1.10.472.20
2dd4H00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.8766 9 89 1.10.472.20
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.8534 5 90 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.8422 7 91 1.10.472.20
3hhtB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.8163 4 90 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A7S2S6K6-F1-model_v4 nitrile hydratase (EC 4.2.1.84) 0.9822 14 80 GO:0016829
GO:0046914
AF-A0A7S4VV09-F1-model_v4 nitrile hydratase (EC 4.2.1.84) 0.9679 10 81 GO:0016829
GO:0046914
AF-A0A821JYI5-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.9664 12 80
AF-A9V2C1-F1-model_v4 Probable nitrile hydratase (NHase) (Nitrilase) (EC 4.2.1.84) 0.9643 10 81 GO:0018822
GO:0046914
AF-A0A0L0FXY1-F1-model_v4 nitrile hydratase (EC 4.2.1.84) 0.9623 10 82 GO:0016829
GO:0046914

Map