F411094

General Info

Members Datasets Scaffolds Average Seq Length
332 202 664 102

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0619974|Ga0496107_0619974_438_782
Length 114
Sequence MRCVIARFPFELTKAGVLESMRGIKPEPGTGESVIIGRRHYPVKQVGQVITRQDRRDFSAAEVLRAMTQLGFTCRALPAAAPVRVLPEPAAARLRDARHSRVRLTEGNRHEADT

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
11 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
14 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
15 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
16 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
17 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
18 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
19 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
20 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
21 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
22 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
23 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
24 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
25 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
26 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
27 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
28 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
41 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
42 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
43 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
44 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
45 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
46 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
47 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
48 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
49 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
50 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
51 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
52 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
53 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
54 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
55 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
56 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
57 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
58 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
59 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
60 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
61 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
62 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
63 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
64 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
65 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
66 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
67 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
68 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
69 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
70 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
71 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
72 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
73 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
74 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
75 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
76 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
77 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
78 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
79 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
80 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
81 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
82 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
83 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
84 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
85 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
86 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
87 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
88 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
89 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
90 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
91 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
92 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
93 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
94 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
95 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
96 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
97 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
98 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
99 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
100 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
101 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
102 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
103 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
104 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
105 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
106 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
109 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
110 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
111 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
114 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
117 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
118 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
119 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
120 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
121 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
122 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
123 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
124 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
125 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
126 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
127 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
128 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
129 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
130 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
131 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
132 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
133 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
134 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
135 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
136 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
137 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
138 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
139 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
140 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
141 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
142 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
147 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
151 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
152 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
153 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
154 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
155 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
156 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
157 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
158 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
159 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
160 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
161 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
162 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
163 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
164 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
165 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
166 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
167 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
168 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
169 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
170 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
171 2643221548 Streptomyces sp. Root55 Isolate Unclassified
172 2643221578 Streptomyces sp. Root63 Isolate Unclassified
173 2643221647 Streptomyces sp. Root369 Isolate Unclassified
174 2643221670 Streptomyces sp. Root431 Isolate Unclassified
175 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
176 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
177 2643221714 Streptomyces sp. Root264 Isolate Unclassified
178 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
179 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
180 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
181 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
182 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
183 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
184 2862574272 Streptomyces sp. AcE210 Isolate Nodule
185 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
186 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
187 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
188 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
189 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
190 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
191 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
192 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
193 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
194 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
195 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
196 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
197 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
198 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
199 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
200 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
201 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
202 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.75
Metatranscriptomes 0.3
Isolates 12.95

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 1.2
Rhizoplane 4.82
Rhizosphere 68.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0619974 3300048910 Bacteria 799
2 JGI24740J21852_10070410 3300001979 Bacteria 938
3 JGI24739J22299_10028930 3300001989 Bacteria 1930
4 JGI24735J21928_10014316 3300002067 Bacteria 2485
5 JGI25153J46596_10004688 3300003215 Bacteria 7305
6 JGI25153J46596_10015602 3300003215 Bacteria 3085
7 Ga0070665_100327616 3300005548 Bacteria 1536
8 Ga0068855_101999815 3300005563 Bacteria 585
9 Ga0070664_101386381 3300005564 Bacteria 664
10 Ga0075363_100156849 3300006048 Bacteria 1287
11 Ga0105251_10019205 3300009011 Bacteria 3617
12 Ga0105250_10121138 3300009092 Bacteria 1075
13 Ga0105245_10165115 3300009098 Bacteria 2104
14 Ga0105247_10394314 3300009101 Bacteria 984
15 Ga0105243_10258441 3300009148 Bacteria 1558
16 Ga0105241_11679708 3300009174 Bacteria 616
17 Ga0105242_10319731 3300009176 Bacteria 1423
18 Ga0105248_10501158 3300009177 Bacteria 1369
19 Ga0105237_10650457 3300009545 Bacteria 1061
20 Ga0105238_10205734 3300009551 Bacteria 1944
21 Ga0105238_10405109 3300009551 Bacteria 1357
22 Ga0105239_11108393 3300010375 Bacteria 911
23 Ga0105246_10000811 3300011119 Bacteria 17787
24 Ga0105246_11150842 3300011119 Bacteria 711
25 Ga0105246_11203443 3300011119 Bacteria 697
26 Ga0157369_10803348 3300013105 Bacteria 966
27 Ga0157372_10037697 3300013307 Bacteria 5333
28 Ga0213875_10004370 3300021388 Bacteria 7779
29 Ga0209758_1009216 3300025297 Bacteria 6195
30 Ga0207426_1007034 3300025302 Bacteria 4774
31 Ga0207426_1009758 3300025302 Bacteria 3772
32 Ga0209051_1089720 3300025303 Bacteria 859
33 Ga0207696_1111415 3300025711 Bacteria 741
34 Ga0207713_1017735 3300025735 Bacteria 3553
35 Ga0207713_1086557 3300025735 Bacteria 1112
36 Ga0207647_10009970 3300025904 Bacteria 6729
37 Ga0207694_10285242 3300025924 Bacteria 1357
38 Ga0207687_10395520 3300025927 Bacteria 1135
39 Ga0207669_10727281 3300025937 Bacteria 818
40 Ga0207711_10398767 3300025941 Bacteria 1278
41 Ga0207667_11486200 3300025949 Bacteria 649
42 Ga0207712_11455826 3300025961 Bacteria 613
43 Ga0207702_12220088 3300026078 Bacteria 537
44 Ga0207683_11595269 3300026121 Bacteria 602
45 Ga0268266_10269970 3300028379 Bacteria 1579
46 Ga0307517_10005122 3300028786 Bacteria 19915
47 Ga0307517_10024324 3300028786 Bacteria 7472
48 Ga0307517_10025706 3300028786 Bacteria 7182
49 Ga0307515_10000050 3300028794 Bacteria 275624
50 Ga0307515_10003702 3300028794 Bacteria 32085
51 Ga0307511_10004002 3300030521 Bacteria 15070
52 Ga0307511_10005953 3300030521 Bacteria 12323
53 Ga0307512_10015850 3300030522 Bacteria 6975
54 Ga0307513_10004697 3300031456 Bacteria 18173
55 Ga0307513_10473184 3300031456 Bacteria 974
56 Ga0307509_10001840 3300031507 Bacteria 35075
57 Ga0307509_10206255 3300031507 Bacteria 1795
58 Ga0307509_10331833 3300031507 Bacteria 1252
59 Ga0307508_10188117 3300031616 Bacteria 1666
60 Ga0307514_10003620 3300031649 Bacteria 14674
61 Ga0307514_10182452 3300031649 Bacteria 1350
62 Ga0307514_10329476 3300031649 Bacteria 831
63 Ga0307516_10015010 3300031730 Bacteria 8167
64 Ga0307516_10111985 3300031730 Bacteria 2530
65 Ga0307516_10168557 3300031730 Bacteria 1932
66 Ga0307518_10049925 3300031838 Bacteria 3041
67 Ga0307518_10266915 3300031838 Bacteria 1072
68 Ga0307518_10329583 3300031838 Bacteria 905
69 Ga0307416_100614244 3300032002 Bacteria 1168
70 Ga0307507_10011159 3300033179 Bacteria 11401
71 Ga0307510_10060246 3300033180 Bacteria 3908
72 Ga0307510_10170559 3300033180 Bacteria 1755
73 Ga0307510_10498485 3300033180 Bacteria 660
74 Ga0307510_10537115 3300033180 Bacteria 614
75 Ga0395898_0058599 3300037466 Bacteria 3748
76 Ga0436364_1246942 3300037853 Bacteria 8407
77 Ga0395901_0985072 3300038443 Bacteria 820
78 Ga0439436_0003312 3300041404 Bacteria 4884
79 Ga0439439_0052082 3300041406 Bacteria 1074
80 Ga0439466_0238317 3300041411 Bacteria 551
81 Ga0451795_0957305 3300041456 Bacteria 765
82 Ga0451795_1614152 3300041456 Bacteria 1168
83 Ga0451800_0342407 3300041459 Bacteria 866
84 Ga0451800_0357223 3300041459 Bacteria 1040
85 Ga0451802_0226078 3300041460 Bacteria 539
86 Ga0451833_1068387 3300041491 Bacteria 953
87 Ga0451835_0732816 3300041492 Bacteria 575
88 Ga0451837_1209302 3300041494 Bacteria 760
89 Ga0451839_0765758 3300041496 Bacteria 566
90 Ga0451841_0546863 3300041498 Bacteria 962
91 Ga0451845_0713579 3300041501 Bacteria 787
92 Ga0451847_0149963 3300041503 Bacteria 689
93 Ga0451851_0408894 3300041507 Bacteria 934
94 Ga0451843_0907077 3300041509 Bacteria 566
95 Ga0451853_0155547 3300041512 Bacteria 1449
96 Ga0451853_0824589 3300041512 Bacteria 3405
97 Ga0451853_0982998 3300041512 Bacteria 2266
98 Ga0451853_3711500 3300041512 Bacteria 4287
99 Ga0439433_0001791 3300041999 Bacteria 4466
100 Ga0439442_010019 3300042002 Bacteria 1918
101 Ga0439449_0025364 3300042007 Bacteria 2216
102 Ga0439449_0047744 3300042007 Bacteria 1585
103 Ga0439449_0094955 3300042007 Bacteria 1101
104 Ga0439457_001793 3300042014 Bacteria 6345
105 Ga0439462_0001025 3300042015 Bacteria 5992
106 Ga0450894_000808 3300042131 Bacteria 5030
107 Ga0450898_004883 3300042134 Bacteria 2003
108 Ga0495592_0070477 3300046454 Bacteria 2546
109 Ga0495592_0326618 3300046454 Bacteria 990
110 Ga0495603_0000718 3300046455 Bacteria 18741
111 Ga0495603_0019358 3300046455 Bacteria 4120
112 Ga0495603_0022824 3300046455 Bacteria 3786
113 Ga0495603_0045704 3300046455 Bacteria 2610
114 Ga0495603_0063780 3300046455 Bacteria 2173
115 Ga0495603_0078235 3300046455 Bacteria 1939
116 Ga0495629_0010427 3300046459 Bacteria 6762
117 Ga0495629_0042200 3300046459 Bacteria 3206
118 Ga0495629_0053165 3300046459 Bacteria 2834
119 Ga0495629_0085225 3300046459 Bacteria 2204
120 Ga0495629_0086977 3300046459 Bacteria 2180
121 Ga0495629_0094128 3300046459 Bacteria 2091
122 Ga0495629_0168803 3300046459 Bacteria 1519
123 Ga0495629_0197384 3300046459 Bacteria 1391
124 Ga0495629_0344836 3300046459 Bacteria 1016
125 Ga0495629_0771346 3300046459 Bacteria 635
126 Ga0495638_0120784 3300046460 Bacteria 1549
127 Ga0495638_0134076 3300046460 Bacteria 1452
128 Ga0495651_0025223 3300046462 Bacteria 4627
129 Ga0495580_0310787 3300046472 Bacteria 1072
130 Ga0495582_0079861 3300046473 Bacteria 1816
131 Ga0495582_0329593 3300046473 Bacteria 879
132 Ga0495605_0060497 3300046474 Bacteria 1815
133 Ga0495639_0598246 3300046475 Bacteria 567
134 Ga0495662_0000151 3300046476 Bacteria 27248
135 Ga0495662_0006681 3300046476 Bacteria 5749
136 Ga0495662_0009068 3300046476 Bacteria 4886
137 Ga0495662_0180103 3300046476 Bacteria 1041
138 Ga0495664_0000445 3300046477 Bacteria 20360
139 Ga0495664_0122941 3300046477 Bacteria 1569
140 Ga0495664_0294929 3300046477 Bacteria 979
141 Ga0495585_0505924 3300046492 Bacteria 574
142 Ga0495594_0021487 3300046499 Bacteria 3444
143 Ga0495594_0028222 3300046499 Bacteria 3027
144 Ga0495594_0033964 3300046499 Bacteria 2775
145 Ga0495594_0038860 3300046499 Bacteria 2600
146 Ga0495594_0066796 3300046499 Bacteria 1995
147 Ga0495594_0206391 3300046499 Bacteria 1120
148 Ga0495594_0694745 3300046499 Bacteria 575
149 Ga0495583_0044132 3300046506 Bacteria 2071
150 Ga0495583_0054077 3300046506 Bacteria 1819
151 Ga0495606_0275588 3300046507 Bacteria 922
152 Ga0495608_0177794 3300046511 Bacteria 1347
153 Ga0495616_0100142 3300046513 Bacteria 1360
154 Ga0495618_0468955 3300046514 Bacteria 762
155 Ga0495618_0724477 3300046514 Bacteria 583
156 Ga0495628_0038948 3300046516 Bacteria 3803
157 Ga0495628_0102141 3300046516 Bacteria 2212
158 Ga0495630_0581481 3300046517 Bacteria 859
159 Ga0495643_0132388 3300046522 Bacteria 1251
160 Ga0495666_0095602 3300046526 Bacteria 1401
161 Ga0495666_0504632 3300046526 Bacteria 540
162 Ga0495642_0112848 3300046528 Bacteria 1163
163 Ga0495652_0042339 3300046529 Bacteria 3927
164 Ga0495640_0011870 3300046533 Bacteria 6681
165 Ga0495587_0001103 3300046536 Bacteria 17737
166 Ga0495587_0008598 3300046536 Bacteria 6563
167 Ga0495609_0266987 3300046538 Bacteria 702
168 Ga0495597_0125867 3300046542 Bacteria 1065
169 Ga0495645_0057365 3300046543 Bacteria 2826
170 Ga0495645_0354584 3300046543 Bacteria 944
171 Ga0495622_0038174 3300046557 Bacteria 2236
172 Ga0495622_0074695 3300046557 Bacteria 1563
173 Ga0495622_0533026 3300046557 Bacteria 501
174 Ga0495667_0579158 3300046559 Bacteria 700
175 Ga0495634_0001675 3300046642 Bacteria 19329
176 Ga0495634_0002023 3300046642 Bacteria 17263
177 Ga0495625_0008651 3300046660 Bacteria 8654
178 Ga0495625_0022519 3300046660 Bacteria 4830
179 Ga0495625_0025171 3300046660 Bacteria 4516
180 Ga0495625_0237799 3300046660 Bacteria 1187
181 Ga0495635_0005183 3300046663 Bacteria 9073
182 Ga0495635_0035792 3300046663 Bacteria 3442
183 Ga0495635_0166549 3300046663 Bacteria 1499
184 Ga0495588_0001966 3300046674 Bacteria 8777
185 Ga0495588_0015471 3300046674 Bacteria 3672
186 Ga0495588_0031141 3300046674 Bacteria 2683
187 Ga0495657_0000364 3300046675 Bacteria 41806
188 Ga0495657_0002036 3300046675 Bacteria 17217
189 Ga0495657_0004322 3300046675 Bacteria 11349
190 Ga0495657_0015683 3300046675 Bacteria 5538
191 Ga0495657_0030597 3300046675 Bacteria 3768
192 Ga0495657_0053310 3300046675 Bacteria 2707
193 Ga0495646_0001372 3300046680 Bacteria 14430
194 Ga0495646_0027699 3300046680 Bacteria 3553
195 Ga0495613_0002621 3300046689 Bacteria 13520
196 Ga0495613_0025716 3300046689 Bacteria 4386
197 Ga0495613_0026079 3300046689 Bacteria 4355
198 Ga0495613_0042134 3300046689 Bacteria 3379
199 Ga0495613_0060563 3300046689 Bacteria 2772
200 Ga0495613_0081759 3300046689 Bacteria 2346
201 Ga0495624_0010047 3300046690 Bacteria 6531
202 Ga0495624_0249096 3300046690 Bacteria 1074
203 Ga0495670_0211324 3300046691 Bacteria 1029
204 Ga0495671_0003110 3300046692 Bacteria 10310
205 Ga0495671_0007763 3300046692 Bacteria 6078
206 Ga0495649_0068350 3300046694 Bacteria 1906
207 Ga0495589_0037123 3300046794 Bacteria 2441
208 Ga0495589_0058433 3300046794 Bacteria 1896
209 Ga0495589_0065878 3300046794 Bacteria 1775
210 Ga0495600_0007609 3300046809 Bacteria 6635
211 Ga0495600_0047045 3300046809 Bacteria 2814
212 Ga0495600_0087119 3300046809 Bacteria 2037
213 Ga0495660_0193698 3300046810 Bacteria 975
214 Ga0495581_0094636 3300047315 Bacteria 1734
215 Ga0495581_0223821 3300047315 Bacteria 1100
216 Ga0495581_0393097 3300047315 Bacteria 809
217 Ga0495604_0000977 3300047317 Bacteria 23846
218 Ga0495604_0003596 3300047317 Bacteria 12355
219 Ga0495604_0043482 3300047317 Bacteria 3516
220 Ga0495604_0044772 3300047317 Bacteria 3455
221 Ga0495636_0011028 3300047318 Bacteria 3576
222 Ga0495636_0064080 3300047318 Bacteria 1559
223 Ga0495636_0398340 3300047318 Bacteria 655
224 Ga0495674_1296394 3300047319 Bacteria 547
225 Ga0495676_0021297 3300047321 Bacteria 5665
226 Ga0495676_0030081 3300047321 Bacteria 4615
227 Ga0495676_0031758 3300047321 Bacteria 4462
228 Ga0495676_0032701 3300047321 Bacteria 4387
229 Ga0495676_0035673 3300047321 Bacteria 4158
230 Ga0495676_0036827 3300047321 Bacteria 4080
231 Ga0495676_0045681 3300047321 Bacteria 3562
232 Ga0495676_0462867 3300047321 Bacteria 835
233 Ga0495676_0476455 3300047321 Bacteria 821
234 Ga0495676_0755552 3300047321 Bacteria 627
235 Ga0495680_0162604 3300047322 Bacteria 1620
236 Ga0495683_0104227 3300047323 Bacteria 1361
237 Ga0495683_0389616 3300047323 Bacteria 581
238 Ga0495687_012804 3300047443 Bacteria 4415
239 Ga0495687_026373 3300047443 Bacteria 2735
240 Ga0495687_189852 3300047443 Bacteria 662
241 Ga0495675_0072699 3300047444 Bacteria 2169
242 Ga0495675_0114247 3300047444 Bacteria 1684
243 Ga0495675_0391524 3300047444 Bacteria 811
244 Ga0495675_0556875 3300047444 Bacteria 653
245 Ga0495677_0311965 3300047445 Bacteria 619
246 Ga0495685_022530 3300047447 Bacteria 2168
247 Ga0495685_052377 3300047447 Bacteria 1382
248 Ga0495681_0002193 3300047470 Bacteria 14122
249 Ga0495681_0003592 3300047470 Bacteria 10797
250 Ga0495681_0246838 3300047470 Bacteria 706
251 Ga0495684_0056078 3300047471 Bacteria 3005
252 Ga0495686_0536445 3300047472 Bacteria 612
253 Ga0495593_0006842 3300047673 Bacteria 6675
254 Ga0495593_0018196 3300047673 Bacteria 3951
255 Ga0495593_0029952 3300047673 Bacteria 2981
256 Ga0495602_0123097 3300048088 Bacteria 2083
257 Ga0495614_0024402 3300048089 Bacteria 2610
258 Ga0495614_0053833 3300048089 Bacteria 1725
259 Ga0495614_0068655 3300048089 Bacteria 1526
260 Ga0496100_0280770 3300048903 Bacteria 1241
261 Ga0496105_0101968 3300048908 Bacteria 2370
262 Ga0496108_0474670 3300048911 Bacteria 1093
263 Ga0496109_0006331 3300048912 Bacteria 9970
264 Ga0496109_0556550 3300048912 Bacteria 1082
265 Ga0496109_0838126 3300048912 Bacteria 857
266 Ga0496110_1407728 3300048913 Bacteria 607
267 Ga0496112_1382238 3300048915 Bacteria 619
268 Ga0496113_0371385 3300048916 Bacteria 1148
269 Ga0496115_0209026 3300048918 Bacteria 1612
270 Ga0496120_0319771 3300048923 Bacteria 705
271 Ga0496122_0484240 3300048925 Bacteria 605
272 Ga0496123_0524352 3300048926 Bacteria 513
273 Ga0496125_0499458 3300048928 Bacteria 685
274 Ga0496126_0453112 3300048929 Bacteria 1032
275 Ga0501317_019281 3300049533 Bacteria 910
276 Ga0501036_0085726 3300049572 Bacteria 2662
277 nmdc:mga03n38_513439_c1 3300050490 Bacteria 674
278 nmdc:mga0yw44_1050495_c1 3300050492 Bacteria 551
279 Ga0495612_0574864 3300053078 Bacteria 520
280 Ga0495655_0004950 3300053083 Bacteria 2319
281 Ga0500644_0121202 3300053088 Bacteria 1019
282 Ga0500583_0132995 3300053092 Bacteria 1234
283 Ga0500640_037553 3300053095 Bacteria 2128
284 Ga0500650_0460541 3300053098 Bacteria 544
285 Ga0500553_192425 3300053101 Bacteria 712
286 Ga0500560_002230 3300053107 Bacteria 3651
287 Ga0500560_188975 3300053107 Bacteria 670
288 Ga0500628_040676 3300053129 Bacteria 1060
289 Ga0500600_0306406 3300053149 Bacteria 677
290 2554255800 2554235005 Bacteria 6457341
291 2585317557 2582581314 Bacteria 11452267
292 2616906307 2616644941 Bacteria 8510691
293 2616906379 2616644941 Bacteria 8510691
294 2643760113 2643221548 Bacteria 8053412
295 2643899787 2643221578 Bacteria 9213798
296 2644263050 2643221647 Bacteria 10741251
297 2644390432 2643221670 Bacteria 6497041
298 2644402119 2643221673 Bacteria 9196637
299 2644460190 2643221682 Bacteria 6743283
300 2644631418 2643221714 Bacteria 9015452
301 2784591602 2784132148 Bacteria 8627943
302 2785347021 2784746763 Bacteria 9783172
303 2808914531 2808606375 Bacteria 9466072
304 2808916457 2808606375 Bacteria 9466072
305 2811845396 2808606982 Bacteria 7791042
306 2812354987 2811994879 Bacteria 9313447
307 2862507949 2862507626 Bacteria 9425308
308 2862511823 2862507626 Bacteria 9425308
309 2862516090 2862507626 Bacteria 9425308
310 2862575899 2862574272 Bacteria 10567477
311 2862575998 2862574272 Bacteria 10567477
312 2862576567 2862574272 Bacteria 10567477
313 2862576922 2862574272 Bacteria 10567477
314 2873151929 2873151551 Bacteria 8625867
315 2919474875 2919468124 Bacteria 9133025
316 2935395685 2935390628 Bacteria 7043367
317 2946048655 2946045630 Bacteria 8527308
318 2946049024 2946045630 Bacteria 8527308
319 2946070913 2946064051 Bacteria 8957905
320 2946072509 2946072368 Bacteria 8999607
321 2954006541 2954002825 Bacteria 9173742
322 2954385951 2954380949 Bacteria 10050426
323 2954696602 2954691527 Bacteria 10720516
324 2954705559 2954701450 Bacteria 10834262
325 2966605286 2966598605 Bacteria 7676064
326 2990066328 2990059506 Bacteria 9321252
327 3006399963 3006393351 Bacteria 6615579
328 3006426280 3006425503 Bacteria 6491253
329 3006488712 3006486233 Bacteria 8157040
330 8023628376 8023623736 Bacteria 8593882
331 8048132309 8048127548 Bacteria 11053136
332 8056449499 8056447290 Bacteria 7680491
333 Ga0496107_0619974
334 JGI24740J21852_10070410
335 JGI24739J22299_10028930
336 JGI24735J21928_10014316
337 JGI25153J46596_10004688
338 JGI25153J46596_10015602
339 Ga0070665_100327616
340 Ga0068855_101999815
341 Ga0070664_101386381
342 Ga0075363_100156849
343 Ga0105251_10019205
344 Ga0105250_10121138
345 Ga0105245_10165115
346 Ga0105247_10394314
347 Ga0105243_10258441
348 Ga0105241_11679708
349 Ga0105242_10319731
350 Ga0105248_10501158
351 Ga0105237_10650457
352 Ga0105238_10205734
353 Ga0105238_10405109
354 Ga0105239_11108393
355 Ga0105246_10000811
356 Ga0105246_11150842
357 Ga0105246_11203443
358 Ga0157369_10803348
359 Ga0157372_10037697
360 Ga0213875_10004370
361 Ga0209758_1009216
362 Ga0207426_1007034
363 Ga0207426_1009758
364 Ga0209051_1089720
365 Ga0207696_1111415
366 Ga0207713_1017735
367 Ga0207713_1086557
368 Ga0207647_10009970
369 Ga0207694_10285242
370 Ga0207687_10395520
371 Ga0207669_10727281
372 Ga0207711_10398767
373 Ga0207667_11486200
374 Ga0207712_11455826
375 Ga0207702_12220088
376 Ga0207683_11595269
377 Ga0268266_10269970
378 Ga0307517_10005122
379 Ga0307517_10024324
380 Ga0307517_10025706
381 Ga0307515_10000050
382 Ga0307515_10003702
383 Ga0307511_10004002
384 Ga0307511_10005953
385 Ga0307512_10015850
386 Ga0307513_10004697
387 Ga0307513_10473184
388 Ga0307509_10001840
389 Ga0307509_10206255
390 Ga0307509_10331833
391 Ga0307508_10188117
392 Ga0307514_10003620
393 Ga0307514_10182452
394 Ga0307514_10329476
395 Ga0307516_10015010
396 Ga0307516_10111985
397 Ga0307516_10168557
398 Ga0307518_10049925
399 Ga0307518_10266915
400 Ga0307518_10329583
401 Ga0307416_100614244
402 Ga0307507_10011159
403 Ga0307510_10060246
404 Ga0307510_10170559
405 Ga0307510_10498485
406 Ga0307510_10537115
407 Ga0395898_0058599
408 Ga0436364_1246942
409 Ga0395901_0985072
410 Ga0439436_0003312
411 Ga0439439_0052082
412 Ga0439466_0238317
413 Ga0451795_0957305
414 Ga0451795_1614152
415 Ga0451800_0342407
416 Ga0451800_0357223
417 Ga0451802_0226078
418 Ga0451833_1068387
419 Ga0451835_0732816
420 Ga0451837_1209302
421 Ga0451839_0765758
422 Ga0451841_0546863
423 Ga0451845_0713579
424 Ga0451847_0149963
425 Ga0451851_0408894
426 Ga0451843_0907077
427 Ga0451853_0155547
428 Ga0451853_0824589
429 Ga0451853_0982998
430 Ga0451853_3711500
431 Ga0439433_0001791
432 Ga0439442_010019
433 Ga0439449_0025364
434 Ga0439449_0047744
435 Ga0439449_0094955
436 Ga0439457_001793
437 Ga0439462_0001025
438 Ga0450894_000808
439 Ga0450898_004883
440 Ga0495592_0070477
441 Ga0495592_0326618
442 Ga0495603_0000718
443 Ga0495603_0019358
444 Ga0495603_0022824
445 Ga0495603_0045704
446 Ga0495603_0063780
447 Ga0495603_0078235
448 Ga0495629_0010427
449 Ga0495629_0042200
450 Ga0495629_0053165
451 Ga0495629_0085225
452 Ga0495629_0086977
453 Ga0495629_0094128
454 Ga0495629_0168803
455 Ga0495629_0197384
456 Ga0495629_0344836
457 Ga0495629_0771346
458 Ga0495638_0120784
459 Ga0495638_0134076
460 Ga0495651_0025223
461 Ga0495580_0310787
462 Ga0495582_0079861
463 Ga0495582_0329593
464 Ga0495605_0060497
465 Ga0495639_0598246
466 Ga0495662_0000151
467 Ga0495662_0006681
468 Ga0495662_0009068
469 Ga0495662_0180103
470 Ga0495664_0000445
471 Ga0495664_0122941
472 Ga0495664_0294929
473 Ga0495585_0505924
474 Ga0495594_0021487
475 Ga0495594_0028222
476 Ga0495594_0033964
477 Ga0495594_0038860
478 Ga0495594_0066796
479 Ga0495594_0206391
480 Ga0495594_0694745
481 Ga0495583_0044132
482 Ga0495583_0054077
483 Ga0495606_0275588
484 Ga0495608_0177794
485 Ga0495616_0100142
486 Ga0495618_0468955
487 Ga0495618_0724477
488 Ga0495628_0038948
489 Ga0495628_0102141
490 Ga0495630_0581481
491 Ga0495643_0132388
492 Ga0495666_0095602
493 Ga0495666_0504632
494 Ga0495642_0112848
495 Ga0495652_0042339
496 Ga0495640_0011870
497 Ga0495587_0001103
498 Ga0495587_0008598
499 Ga0495609_0266987
500 Ga0495597_0125867
501 Ga0495645_0057365
502 Ga0495645_0354584
503 Ga0495622_0038174
504 Ga0495622_0074695
505 Ga0495622_0533026
506 Ga0495667_0579158
507 Ga0495634_0001675
508 Ga0495634_0002023
509 Ga0495625_0008651
510 Ga0495625_0022519
511 Ga0495625_0025171
512 Ga0495625_0237799
513 Ga0495635_0005183
514 Ga0495635_0035792
515 Ga0495635_0166549
516 Ga0495588_0001966
517 Ga0495588_0015471
518 Ga0495588_0031141
519 Ga0495657_0000364
520 Ga0495657_0002036
521 Ga0495657_0004322
522 Ga0495657_0015683
523 Ga0495657_0030597
524 Ga0495657_0053310
525 Ga0495646_0001372
526 Ga0495646_0027699
527 Ga0495613_0002621
528 Ga0495613_0025716
529 Ga0495613_0026079
530 Ga0495613_0042134
531 Ga0495613_0060563
532 Ga0495613_0081759
533 Ga0495624_0010047
534 Ga0495624_0249096
535 Ga0495670_0211324
536 Ga0495671_0003110
537 Ga0495671_0007763
538 Ga0495649_0068350
539 Ga0495589_0037123
540 Ga0495589_0058433
541 Ga0495589_0065878
542 Ga0495600_0007609
543 Ga0495600_0047045
544 Ga0495600_0087119
545 Ga0495660_0193698
546 Ga0495581_0094636
547 Ga0495581_0223821
548 Ga0495581_0393097
549 Ga0495604_0000977
550 Ga0495604_0003596
551 Ga0495604_0043482
552 Ga0495604_0044772
553 Ga0495636_0011028
554 Ga0495636_0064080
555 Ga0495636_0398340
556 Ga0495674_1296394
557 Ga0495676_0021297
558 Ga0495676_0030081
559 Ga0495676_0031758
560 Ga0495676_0032701
561 Ga0495676_0035673
562 Ga0495676_0036827
563 Ga0495676_0045681
564 Ga0495676_0462867
565 Ga0495676_0476455
566 Ga0495676_0755552
567 Ga0495680_0162604
568 Ga0495683_0104227
569 Ga0495683_0389616
570 Ga0495687_012804
571 Ga0495687_026373
572 Ga0495687_189852
573 Ga0495675_0072699
574 Ga0495675_0114247
575 Ga0495675_0391524
576 Ga0495675_0556875
577 Ga0495677_0311965
578 Ga0495685_022530
579 Ga0495685_052377
580 Ga0495681_0002193
581 Ga0495681_0003592
582 Ga0495681_0246838
583 Ga0495684_0056078
584 Ga0495686_0536445
585 Ga0495593_0006842
586 Ga0495593_0018196
587 Ga0495593_0029952
588 Ga0495602_0123097
589 Ga0495614_0024402
590 Ga0495614_0053833
591 Ga0495614_0068655
592 Ga0496100_0280770
593 Ga0496105_0101968
594 Ga0496108_0474670
595 Ga0496109_0006331
596 Ga0496109_0556550
597 Ga0496109_0838126
598 Ga0496110_1407728
599 Ga0496112_1382238
600 Ga0496113_0371385
601 Ga0496115_0209026
602 Ga0496120_0319771
603 Ga0496122_0484240
604 Ga0496123_0524352
605 Ga0496125_0499458
606 Ga0496126_0453112
607 Ga0501317_019281
608 Ga0501036_0085726
609 nmdc:mga03n38_513439_c1
610 nmdc:mga0yw44_1050495_c1
611 Ga0495612_0574864
612 Ga0495655_0004950
613 Ga0500644_0121202
614 Ga0500583_0132995
615 Ga0500640_037553
616 Ga0500650_0460541
617 Ga0500553_192425
618 Ga0500560_002230
619 Ga0500560_188975
620 Ga0500628_040676
621 Ga0500600_0306406
622 2554255800
623 2585317557
624 2616906307
625 2616906379
626 2643760113
627 2643899787
628 2644263050
629 2644390432
630 2644402119
631 2644460190
632 2644631418
633 2784591602
634 2785347021
635 2808914531
636 2808916457
637 2811845396
638 2812354987
639 2862507949
640 2862511823
641 2862516090
642 2862575899
643 2862575998
644 2862576567
645 2862576922
646 2873151929
647 2919474875
648 2935395685
649 2946048655
650 2946049024
651 2946070913
652 2946072509
653 2954006541
654 2954385951
655 2954696602
656 2954705559
657 2966605286
658 2990066328
659 3006399963
660 3006426280
661 3006488712
662 8023628376
663 8048132309
664 8056449499

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zmm-assembly1.cif.gz_E structure of the type iv phosphorothioation-dependent restriction endonuclease scomcra 0.6787 17 87
5zmm-assembly1.cif.gz_B structure of the type iv phosphorothioation-dependent restriction endonuclease scomcra 0.5931 10 87
5zmm-assembly1.cif.gz_A structure of the type iv phosphorothioation-dependent restriction endonuclease scomcra 0.5167 11 87
5zmm-assembly1.cif.gz_B structure of the type iv phosphorothioation-dependent restriction endonuclease scomcra 0.4689 10 87
5zmm-assembly1.cif.gz_E structure of the type iv phosphorothioation-dependent restriction endonuclease scomcra 0.4444 17 87
ID Description Score Start End Superfamily
af_C0SUU6_138_229_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.5132 14 69 1.10.10.60
af_P18412_128_202_6.10.20.40 Special;Helix non-globular;Arc Repressor Mutant, subunit A;TEA/ATTS domain 0.4327 10 69 6.10.20.40
af_A0A0P0XD00_1_72_3.30.70.100 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.4233 14 77 3.30.70.100
af_Q2FXI0_1_119_3.30.470.10 Alpha Beta;2-Layer Sandwich;D-amino Acid Aminotransferase; Chain A, domain 1;Aminotransferase class 4, branched-chain amino acid transferase, N-terminal domain 0.3986 31 70 3.30.470.10
af_Q9ASZ1_64_158_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.3842 14 102 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A5P1ZMU5-F1-model_v4 deleted 0.9887 1 76
AF-A0A553Y0B4-F1-model_v4 Uncharacterized protein 0.988 1 75
AF-A0A2U2ZX77-F1-model_v4 Uncharacterized protein 0.9789 1 78
AF-A0A1H6AH72-F1-model_v4 Uncharacterized protein 0.9753 1 78
AF-A0A553Y0B4-F1-model_v4 Uncharacterized protein 0.9752 1 75

Map