F411025

General Info

Members Datasets Scaffolds Average Seq Length
332 173 664 159

Family's Representative Sequence

Representative Sequence 3300041456|Ga0451795_0834590|Ga0451795_0834590_63_626
Length 187
Sequence VTEHTPFIDFENLPAPSEGFVMTLFLTVRSVARSRAFYADVLGGQVVLEENPCMIKLSNSWLIMNPGGGPTPDKADVSVVNYEPGNTVSSFMNLRVADIQACYEEWSSKGAEFVTPPIDRGAEIRCYMRDPEWFLTLTTPSGRWVAVGRHADLTITVAARDLGSTTITLEPIANPDARLLGPEPNDS

Samples

Sample ID Description Type Environment
1 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
49 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
61 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
64 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
79 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
116 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
117 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
119 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
120 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
121 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
125 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
128 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
129 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
130 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
141 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
148 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
151 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
152 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
153 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
154 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
155 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
159 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
163 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
164 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
165 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
166 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
167 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
168 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
169 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
170 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
171 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
172 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
173 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 0
Rhizoplane 12.05
Rhizosphere 83.43
Stem 0
Stem Tuber 0
Unclassified 3.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451795_0834590 3300041456 Unclassified 642
2 Ga0065715_10098469 3300005293 Bacteria 3543
3 Ga0065715_10749953 3300005293 Bacteria 630
4 Ga0070683_101787250 3300005329 Bacteria 591
5 Ga0068869_100122065 3300005334 Bacteria 1994
6 Ga0068869_100316684 3300005334 Bacteria 1264
7 Ga0070682_100395933 3300005337 Bacteria 1043
8 Ga0068868_100016629 3300005338 Bacteria 5470
9 Ga0068868_100327913 3300005338 Bacteria 1306
10 Ga0070689_100506646 3300005340 Bacteria 1035
11 Ga0070687_100067537 3300005343 Bacteria 1909
12 Ga0070687_100570576 3300005343 Bacteria 773
13 Ga0070692_10359886 3300005345 Bacteria 907
14 Ga0070669_100433228 3300005353 Bacteria 1081
15 Ga0070688_100478068 3300005365 Bacteria 936
16 Ga0070659_101200712 3300005366 Unclassified 671
17 Ga0070667_101618007 3300005367 Bacteria 609
18 Ga0070709_10344373 3300005434 Bacteria 1100
19 Ga0070714_100016402 3300005435 Bacteria 5979
20 Ga0070713_100153172 3300005436 Bacteria 2052
21 Ga0070710_10205823 3300005437 Bacteria 1245
22 Ga0070701_10356786 3300005438 Bacteria 915
23 Ga0070711_100230517 3300005439 Bacteria 1444
24 Ga0070711_100366473 3300005439 Bacteria 1161
25 Ga0070700_100363328 3300005441 Bacteria 1077
26 Ga0070694_100002629 3300005444 Bacteria 10620
27 Ga0070694_101402109 3300005444 Bacteria 590
28 Ga0070678_101113096 3300005456 Bacteria 730
29 Ga0068867_100379098 3300005459 Unclassified 1187
30 Ga0070706_100365324 3300005467 Bacteria 1345
31 Ga0070697_100190015 3300005536 Bacteria 1743
32 Ga0070686_100272518 3300005544 Bacteria 1245
33 Ga0070686_100286783 3300005544 Bacteria 1216
34 Ga0070696_100360122 3300005546 Bacteria 1129
35 Ga0070665_100882687 3300005548 Bacteria 907
36 Ga0070704_100046792 3300005549 Bacteria 3020
37 Ga0070704_100181728 3300005549 Bacteria 1683
38 Ga0068857_100380312 3300005577 Bacteria 1311
39 Ga0070702_100023062 3300005615 Bacteria 3301
40 Ga0070702_100032083 3300005615 Bacteria 2880
41 Ga0070702_100565355 3300005615 Bacteria 847
42 Ga0068859_100008144 3300005617 Bacteria 10628
43 Ga0068859_100254204 3300005617 Bacteria 1848
44 Ga0068859_102582083 3300005617 Bacteria 559
45 Ga0068864_100798845 3300005618 Bacteria 927
46 Ga0068866_10093235 3300005718 Bacteria 1645
47 Ga0068861_100207501 3300005719 Bacteria 1648
48 Ga0068861_100252443 3300005719 Bacteria 1506
49 Ga0068861_100277427 3300005719 Bacteria 1442
50 Ga0068870_10160705 3300005840 Unclassified 1332
51 Ga0068870_11128382 3300005840 Bacteria 565
52 Ga0068858_100012941 3300005842 Bacteria 7868
53 Ga0068858_100636499 3300005842 Bacteria 1036
54 Ga0068860_100400075 3300005843 Bacteria 1358
55 Ga0068862_101703269 3300005844 Bacteria 639
56 Ga0081455_10647703 3300005937 Bacteria 681
57 Ga0081538_10001309 3300005981 Bacteria 25741
58 Ga0081538_10008555 3300005981 Bacteria 8663
59 Ga0081538_10274661 3300005981 Bacteria 629
60 Ga0081540_1001271 3300005983 Bacteria 21973
61 Ga0081540_1024172 3300005983 Bacteria 3532
62 Ga0070717_10051449 3300006028 Bacteria 3390
63 Ga0075368_10082186 3300006042 Bacteria 1312
64 Ga0075364_10369571 3300006051 Bacteria 978
65 Ga0075364_10768705 3300006051 Bacteria 657
66 Ga0070712_100149232 3300006175 Bacteria 1793
67 Ga0070712_100169537 3300006175 Bacteria 1692
68 Ga0070712_100468890 3300006175 Bacteria 1051
69 Ga0070712_100906862 3300006175 Bacteria 760
70 Ga0068871_100767547 3300006358 Bacteria 887
71 Ga0075428_100184055 3300006844 Bacteria 2260
72 Ga0075428_100304148 3300006844 Bacteria 1714
73 Ga0075428_100915515 3300006844 Bacteria 930
74 Ga0075430_100360987 3300006846 Bacteria 1199
75 Ga0075430_100867786 3300006846 Bacteria 743
76 Ga0075431_100079521 3300006847 Bacteria 3384
77 Ga0075431_100113210 3300006847 Bacteria 2800
78 Ga0075431_100177733 3300006847 Bacteria 2185
79 Ga0075431_100351580 3300006847 Bacteria 1481
80 Ga0075431_100578674 3300006847 Bacteria 1108
81 Ga0075431_101411050 3300006847 Bacteria 656
82 Ga0075433_10015540 3300006852 Bacteria 6250
83 Ga0075433_10087242 3300006852 Bacteria 2756
84 Ga0075434_100014405 3300006871 Bacteria 7557
85 Ga0075434_100047685 3300006871 Bacteria 4251
86 Ga0075434_100479917 3300006871 Bacteria 1264
87 Ga0075434_100857301 3300006871 Bacteria 924
88 Ga0075429_100093095 3300006880 Bacteria 2628
89 Ga0075436_100187778 3300006914 Bacteria 1462
90 Ga0097620_100008143 3300006931 Bacteria 10628
91 Ga0097620_100254192 3300006931 Bacteria 1848
92 Ga0097620_102582182 3300006931 Bacteria 559
93 Ga0075435_100070101 3300007076 Bacteria 2861
94 Ga0075435_100084009 3300007076 Bacteria 2619
95 Ga0075435_100396886 3300007076 Bacteria 1186
96 Ga0075435_100513842 3300007076 Bacteria 1036
97 Ga0075435_100978556 3300007076 Bacteria 738
98 Ga0105250_10351483 3300009092 Bacteria 646
99 Ga0105240_11439129 3300009093 Bacteria 724
100 Ga0105240_12175209 3300009093 Bacteria 575
101 Ga0111539_10027576 3300009094 Bacteria 6936
102 Ga0111539_10362326 3300009094 Bacteria 1687
103 Ga0111539_10838228 3300009094 Bacteria 1070
104 Ga0111539_11343779 3300009094 Bacteria 829
105 Ga0105245_10040031 3300009098 Bacteria 4173
106 Ga0105245_10317781 3300009098 Bacteria 1533
107 Ga0105245_10754495 3300009098 Bacteria 1009
108 Ga0105245_11493098 3300009098 Bacteria 727
109 Ga0114129_10042044 3300009147 Bacteria 6436
110 Ga0114129_10454767 3300009147 Bacteria 1679
111 Ga0114129_10557814 3300009147 Bacteria 1489
112 Ga0114129_10708578 3300009147 Bacteria 1293
113 Ga0114129_10743638 3300009147 Bacteria 1256
114 Ga0114129_10970798 3300009147 Bacteria 1072
115 Ga0114129_11884125 3300009147 Bacteria 725
116 Ga0105243_10080542 3300009148 Bacteria 2656
117 Ga0105243_10109243 3300009148 Bacteria 2310
118 Ga0105243_10381872 3300009148 Bacteria 1303
119 Ga0105243_10515910 3300009148 Bacteria 1136
120 Ga0105243_10705007 3300009148 Bacteria 984
121 Ga0105243_10864587 3300009148 Bacteria 896
122 Ga0105241_10725585 3300009174 Bacteria 909
123 Ga0105242_10298554 3300009176 Bacteria 1469
124 Ga0105242_10500531 3300009176 Bacteria 1156
125 Ga0105242_11005447 3300009176 Bacteria 842
126 Ga0105242_11355188 3300009176 Bacteria 737
127 Ga0105242_12608826 3300009176 Bacteria 554
128 Ga0105237_10097582 3300009545 Bacteria 2929
129 Ga0105249_10115686 3300009553 Bacteria 2541
130 Ga0105249_10270026 3300009553 Bacteria 1694
131 Ga0105249_11119711 3300009553 Unclassified 857
132 Ga0105249_11765645 3300009553 Bacteria 691
133 Ga0105239_11314000 3300010375 Bacteria 834
134 Ga0105239_11609783 3300010375 Bacteria 751
135 Ga0105239_11732745 3300010375 Bacteria 723
136 Ga0105239_11807485 3300010375 Bacteria 708
137 Ga0105246_10045830 3300011119 Bacteria 2980
138 Ga0105246_11071530 3300011119 Bacteria 734
139 Ga0157314_1038541 3300012500 Bacteria 568
140 Ga0157374_11087093 3300013296 Bacteria 820
141 Ga0163162_10295357 3300013306 Bacteria 1752
142 Ga0163162_10337621 3300013306 Bacteria 1639
143 Ga0163162_10812873 3300013306 Bacteria 1052
144 Ga0157372_10101108 3300013307 Bacteria 3291
145 Ga0157372_10224782 3300013307 Bacteria 2176
146 Ga0157372_10513198 3300013307 Bacteria 1397
147 Ga0157372_12713019 3300013307 Bacteria 568
148 Ga0157375_10322783 3300013308 Bacteria 1708
149 Ga0157375_11862768 3300013308 Bacteria 714
150 Ga0163163_12065940 3300014325 Bacteria 629
151 Ga0157380_12703633 3300014326 Bacteria 563
152 Ga0157377_10042001 3300014745 Bacteria 2539
153 Ga0157377_10082466 3300014745 Bacteria 1882
154 Ga0157379_10086910 3300014968 Bacteria 2803
155 Ga0157379_10206473 3300014968 Bacteria 1777
156 Ga0213873_10097147 3300021358 Bacteria 843
157 Ga0207653_10117946 3300025885 Bacteria 953
158 Ga0207642_10028700 3300025899 Bacteria 2294
159 Ga0207647_10131713 3300025904 Bacteria 1469
160 Ga0207699_10468677 3300025906 Bacteria 906
161 Ga0207643_10232272 3300025908 Bacteria 1132
162 Ga0207643_10918229 3300025908 Bacteria 567
163 Ga0207693_10007941 3300025915 Bacteria 8718
164 Ga0207693_10010509 3300025915 Bacteria 7512
165 Ga0207693_10139797 3300025915 Bacteria 1904
166 Ga0207693_10322634 3300025915 Bacteria 1209
167 Ga0207693_10403443 3300025915 Bacteria 1069
168 Ga0207663_10265316 3300025916 Bacteria 1270
169 Ga0207660_10563719 3300025917 Bacteria 927
170 Ga0207649_11612217 3300025920 Bacteria 514
171 Ga0207681_11098557 3300025923 Bacteria 668
172 Ga0207687_10117428 3300025927 Bacteria 1984
173 Ga0207687_10323109 3300025927 Bacteria 1250
174 Ga0207700_10248622 3300025928 Bacteria 1518
175 Ga0207664_10121615 3300025929 Bacteria 2186
176 Ga0207664_10417048 3300025929 Bacteria 1195
177 Ga0207706_10764319 3300025933 Bacteria 823
178 Ga0207686_10586422 3300025934 Bacteria 876
179 Ga0207686_10945654 3300025934 Bacteria 697
180 Ga0207709_10185103 3300025935 Bacteria 1474
181 Ga0207709_10324888 3300025935 Bacteria 1153
182 Ga0207709_10343046 3300025935 Unclassified 1125
183 Ga0207670_10395162 3300025936 Bacteria 1104
184 Ga0207670_10419022 3300025936 Bacteria 1074
185 Ga0207669_10346080 3300025937 Bacteria 1146
186 Ga0207704_10694868 3300025938 Bacteria 842
187 Ga0207704_10990788 3300025938 Bacteria 710
188 Ga0207665_10819700 3300025939 Unclassified 736
189 Ga0207689_10129944 3300025942 Bacteria 2073
190 Ga0207689_10929421 3300025942 Bacteria 734
191 Ga0207679_10343142 3300025945 Bacteria 1299
192 Ga0207679_10515791 3300025945 Bacteria 1068
193 Ga0207712_10393919 3300025961 Bacteria 1162
194 Ga0207668_10233554 3300025972 Bacteria 1484
195 Ga0207677_10758848 3300026023 Bacteria 865
196 Ga0207703_10091649 3300026035 Bacteria 2557
197 Ga0207703_10480189 3300026035 Bacteria 1164
198 Ga0207639_10568644 3300026041 Bacteria 1042
199 Ga0207641_10336657 3300026088 Bacteria 1435
200 Ga0207648_10097532 3300026089 Bacteria 2573
201 Ga0207676_10735334 3300026095 Bacteria 958
202 Ga0207674_10130798 3300026116 Bacteria 2473
203 Ga0207675_100188137 3300026118 Bacteria 1979
204 Ga0207675_100315405 3300026118 Bacteria 1525
205 Ga0207675_100321955 3300026118 Bacteria 1510
206 Ga0207675_100589656 3300026118 Bacteria 1114
207 Ga0207698_10419343 3300026142 Bacteria 1284
208 Ga0207698_10540527 3300026142 Bacteria 1140
209 Ga0209813_10101484 3300027866 Bacteria 979
210 Ga0207428_10172232 3300027907 Bacteria 1639
211 Ga0268266_10197191 3300028379 Bacteria 1841
212 Ga0307508_10046340 3300031616 Bacteria 3881
213 Ga0373949_0066842 3300035090 Bacteria 935
214 Ga0373937_1637240 3300036401 Bacteria 591
215 Ga0373925_1231521 3300037068 Bacteria 615
216 Ga0395899_0041390 3300037312 Bacteria 3443
217 Ga0395900_0127315 3300037418 Bacteria 2611
218 Ga0395900_0264274 3300037418 Bacteria 1717
219 Ga0395898_0002563 3300037466 Bacteria 21298
220 Ga0395898_0044956 3300037466 Bacteria 4342
221 Ga0395898_0861277 3300037466 Bacteria 845
222 Ga0395898_1081661 3300037466 Bacteria 736
223 Ga0395898_1374685 3300037466 Bacteria 634
224 Ga0395905_0003099 3300037471 Bacteria 17966
225 Ga0395905_1488907 3300037471 Bacteria 581
226 Ga0395901_0031809 3300038443 Bacteria 5440
227 Ga0395901_0212868 3300038443 Bacteria 2022
228 Ga0436365_1529570 3300039437 Bacteria 2764
229 Ga0436360_0364782 3300039438 Bacteria 767
230 Ga0436363_0012195 3300039450 Unclassified 781
231 Ga0436363_0307100 3300039450 Bacteria 721
232 Ga0436363_0383834 3300039450 Bacteria 673
233 Ga0436362_0171802 3300039453 Bacteria 653
234 Ga0436362_0176400 3300039453 Unclassified 666
235 Ga0436362_0987003 3300039453 Bacteria 2262
236 Ga0451847_0985481 3300041503 Bacteria 557
237 Ga0450888_007565 3300042126 Bacteria 1205
238 Ga0439460_0007254 3300042461 Bacteria 2766
239 Ga0439460_0300302 3300042461 Bacteria 561
240 Ga0439440_0040697 3300042993 Bacteria 1132
241 Ga0466963_0002608 3300044694 Bacteria 10115
242 Ga0466963_0050551 3300044694 Bacteria 2751
243 Ga0466970_0102491 3300044765 Bacteria 1559
244 Ga0466957_0009687 3300044842 Bacteria 5501
245 Ga0466958_0001088 3300045836 Bacteria 12512
246 Ga0466958_0808615 3300045836 Bacteria 611
247 Ga0466967_0009133 3300045976 Bacteria 7334
248 Ga0466967_0547761 3300045976 Unclassified 1138
249 Ga0495629_0221192 3300046459 Bacteria 1306
250 Ga0495628_0023434 3300046516 Bacteria 5068
251 Ga0495586_0746118 3300046535 Bacteria 565
252 Ga0495586_0786913 3300046535 Bacteria 549
253 Ga0495624_0764913 3300046690 Bacteria 572
254 Ga0495589_0276680 3300046794 Bacteria 781
255 Ga0495674_0264981 3300047319 Bacteria 1411
256 Ga0495674_0300192 3300047319 Bacteria 1312
257 Ga0495679_115992 3300047446 Bacteria 735
258 Ga0496102_0065443 3300048905 Bacteria 3332
259 Ga0496102_0140066 3300048905 Bacteria 2268
260 Ga0496102_0284583 3300048905 Bacteria 1558
261 Ga0496102_0678013 3300048905 Bacteria 954
262 Ga0496104_0176966 3300048907 Bacteria 2044
263 Ga0496105_0158576 3300048908 Bacteria 1858
264 Ga0496106_0006193 3300048909 Bacteria 8850
265 Ga0496106_0153735 3300048909 Bacteria 1816
266 Ga0496106_0500905 3300048909 Bacteria 976
267 Ga0496107_0003106 3300048910 Bacteria 11039
268 Ga0496108_0018345 3300048911 Bacteria 5731
269 Ga0496108_0533718 3300048911 Bacteria 1024
270 Ga0496109_0045454 3300048912 Bacteria 3985
271 Ga0496109_0055245 3300048912 Bacteria 3622
272 Ga0496109_0349216 3300048912 Bacteria 1397
273 Ga0496109_0596231 3300048912 Bacteria 1041
274 Ga0496109_0910984 3300048912 Bacteria 817
275 Ga0496109_1321586 3300048912 Bacteria 657
276 Ga0496110_0050489 3300048913 Bacteria 3652
277 Ga0496110_0171686 3300048913 Bacteria 1967
278 Ga0496110_0860766 3300048913 Bacteria 812
279 Ga0496110_1298023 3300048913 Bacteria 637
280 Ga0496111_0078207 3300048914 Bacteria 2412
281 Ga0496111_0140613 3300048914 Bacteria 1789
282 Ga0496111_0167991 3300048914 Bacteria 1630
283 Ga0496111_0264613 3300048914 Unclassified 1276
284 Ga0496111_0712584 3300048914 Bacteria 729
285 Ga0496112_0151948 3300048915 Bacteria 2282
286 Ga0496112_0200240 3300048915 Bacteria 1956
287 Ga0496112_0277771 3300048915 Bacteria 1623
288 Ga0496112_0734797 3300048915 Bacteria 914
289 Ga0496112_1304960 3300048915 Bacteria 641
290 Ga0496113_0034465 3300048916 Bacteria 3694
291 Ga0496113_0273525 3300048916 Bacteria 1350
292 Ga0496113_0703739 3300048916 Bacteria 806
293 Ga0496114_0170550 3300048917 Bacteria 1896
294 Ga0496115_0029463 3300048918 Bacteria 4311
295 Ga0496115_0051398 3300048918 Bacteria 3305
296 Ga0496115_0470746 3300048918 Bacteria 1013
297 Ga0496126_0298884 3300048929 Bacteria 1329
298 nmdc:mga00v17_353134_c1 3300050491 Bacteria 956
299 nmdc:mga00v17_666644_c1 3300050491 Bacteria 668
300 nmdc:mga0yw44_117798_c1 3300050492 Bacteria 1708
301 nmdc:mga04h51_120010_c1 3300050495 Bacteria 978
302 nmdc:mga05p37_1051593_c1 3300050507 Bacteria 859
303 nmdc:mga05p37_171642_c1 3300050507 Bacteria 2644
304 nmdc:mga05p37_34826_c1 3300050507 Bacteria 1358
305 nmdc:mga05p37_523694_c1 3300050507 Bacteria 1355
306 nmdc:mga05p37_577473_c1 3300050507 Bacteria 1274
307 nmdc:mga09592_111349_c1 3300050508 Bacteria 2348
308 nmdc:mga09592_28132_c1 3300050508 Bacteria 4670
309 nmdc:mga09592_502591_c1 3300050508 Bacteria 1044
310 nmdc:mga0qj67_265286_c1 3300050509 Bacteria 1393
311 nmdc:mga0qj67_721131_c1 3300050509 Bacteria 792
312 nmdc:mga06r32_1743894_c1 3300050510 Bacteria 559
313 nmdc:mga06r32_1793895_c1 3300050510 Bacteria 549
314 nmdc:mga06r32_2033997_c1 3300050510 Bacteria 508
315 nmdc:mga06r32_34424_c1 3300050510 Bacteria 4776
316 nmdc:mga06r32_595629_c1 3300050510 Bacteria 1077
317 nmdc:mga08y16_750013_c1 3300050511 Bacteria 972
318 nmdc:mga0n895_163862_c1 3300050512 Bacteria 2255
319 nmdc:mga0n895_187206_c1 3300050512 Bacteria 2101
320 nmdc:mga0n895_668986_c1 3300050512 Bacteria 1036
321 nmdc:mga0rr50_274317_c1 3300050513 Bacteria 1406
322 nmdc:mga0rr50_46533_c1 3300050513 Bacteria 3194
323 nmdc:mga08x19_1013343_c1 3300050514 Bacteria 590
324 nmdc:mga08x19_244295_c1 3300050514 Bacteria 1238
325 nmdc:mga0a205_1019804_c1 3300050515 Bacteria 675
326 nmdc:mga0a205_22641_c1 3300050515 Bacteria 5955
327 nmdc:mga0a205_289340_c1 3300050515 Bacteria 1513
328 nmdc:mga0a205_31125_c1 3300050515 Bacteria 5110
329 Ga0495601_0021743 3300053077 Bacteria 3931
330 Ga0495612_0000205 3300053078 Bacteria 25332
331 Ga0495619_0072546 3300053085 Bacteria 2306
332 Ga0530510_0368012 3300061734 Bacteria 1081
333 Ga0451795_0834590
334 Ga0065715_10098469
335 Ga0065715_10749953
336 Ga0070683_101787250
337 Ga0068869_100122065
338 Ga0068869_100316684
339 Ga0070682_100395933
340 Ga0068868_100016629
341 Ga0068868_100327913
342 Ga0070689_100506646
343 Ga0070687_100067537
344 Ga0070687_100570576
345 Ga0070692_10359886
346 Ga0070669_100433228
347 Ga0070688_100478068
348 Ga0070659_101200712
349 Ga0070667_101618007
350 Ga0070709_10344373
351 Ga0070714_100016402
352 Ga0070713_100153172
353 Ga0070710_10205823
354 Ga0070701_10356786
355 Ga0070711_100230517
356 Ga0070711_100366473
357 Ga0070700_100363328
358 Ga0070694_100002629
359 Ga0070694_101402109
360 Ga0070678_101113096
361 Ga0068867_100379098
362 Ga0070706_100365324
363 Ga0070697_100190015
364 Ga0070686_100272518
365 Ga0070686_100286783
366 Ga0070696_100360122
367 Ga0070665_100882687
368 Ga0070704_100046792
369 Ga0070704_100181728
370 Ga0068857_100380312
371 Ga0070702_100023062
372 Ga0070702_100032083
373 Ga0070702_100565355
374 Ga0068859_100008144
375 Ga0068859_100254204
376 Ga0068859_102582083
377 Ga0068864_100798845
378 Ga0068866_10093235
379 Ga0068861_100207501
380 Ga0068861_100252443
381 Ga0068861_100277427
382 Ga0068870_10160705
383 Ga0068870_11128382
384 Ga0068858_100012941
385 Ga0068858_100636499
386 Ga0068860_100400075
387 Ga0068862_101703269
388 Ga0081455_10647703
389 Ga0081538_10001309
390 Ga0081538_10008555
391 Ga0081538_10274661
392 Ga0081540_1001271
393 Ga0081540_1024172
394 Ga0070717_10051449
395 Ga0075368_10082186
396 Ga0075364_10369571
397 Ga0075364_10768705
398 Ga0070712_100149232
399 Ga0070712_100169537
400 Ga0070712_100468890
401 Ga0070712_100906862
402 Ga0068871_100767547
403 Ga0075428_100184055
404 Ga0075428_100304148
405 Ga0075428_100915515
406 Ga0075430_100360987
407 Ga0075430_100867786
408 Ga0075431_100079521
409 Ga0075431_100113210
410 Ga0075431_100177733
411 Ga0075431_100351580
412 Ga0075431_100578674
413 Ga0075431_101411050
414 Ga0075433_10015540
415 Ga0075433_10087242
416 Ga0075434_100014405
417 Ga0075434_100047685
418 Ga0075434_100479917
419 Ga0075434_100857301
420 Ga0075429_100093095
421 Ga0075436_100187778
422 Ga0097620_100008143
423 Ga0097620_100254192
424 Ga0097620_102582182
425 Ga0075435_100070101
426 Ga0075435_100084009
427 Ga0075435_100396886
428 Ga0075435_100513842
429 Ga0075435_100978556
430 Ga0105250_10351483
431 Ga0105240_11439129
432 Ga0105240_12175209
433 Ga0111539_10027576
434 Ga0111539_10362326
435 Ga0111539_10838228
436 Ga0111539_11343779
437 Ga0105245_10040031
438 Ga0105245_10317781
439 Ga0105245_10754495
440 Ga0105245_11493098
441 Ga0114129_10042044
442 Ga0114129_10454767
443 Ga0114129_10557814
444 Ga0114129_10708578
445 Ga0114129_10743638
446 Ga0114129_10970798
447 Ga0114129_11884125
448 Ga0105243_10080542
449 Ga0105243_10109243
450 Ga0105243_10381872
451 Ga0105243_10515910
452 Ga0105243_10705007
453 Ga0105243_10864587
454 Ga0105241_10725585
455 Ga0105242_10298554
456 Ga0105242_10500531
457 Ga0105242_11005447
458 Ga0105242_11355188
459 Ga0105242_12608826
460 Ga0105237_10097582
461 Ga0105249_10115686
462 Ga0105249_10270026
463 Ga0105249_11119711
464 Ga0105249_11765645
465 Ga0105239_11314000
466 Ga0105239_11609783
467 Ga0105239_11732745
468 Ga0105239_11807485
469 Ga0105246_10045830
470 Ga0105246_11071530
471 Ga0157314_1038541
472 Ga0157374_11087093
473 Ga0163162_10295357
474 Ga0163162_10337621
475 Ga0163162_10812873
476 Ga0157372_10101108
477 Ga0157372_10224782
478 Ga0157372_10513198
479 Ga0157372_12713019
480 Ga0157375_10322783
481 Ga0157375_11862768
482 Ga0163163_12065940
483 Ga0157380_12703633
484 Ga0157377_10042001
485 Ga0157377_10082466
486 Ga0157379_10086910
487 Ga0157379_10206473
488 Ga0213873_10097147
489 Ga0207653_10117946
490 Ga0207642_10028700
491 Ga0207647_10131713
492 Ga0207699_10468677
493 Ga0207643_10232272
494 Ga0207643_10918229
495 Ga0207693_10007941
496 Ga0207693_10010509
497 Ga0207693_10139797
498 Ga0207693_10322634
499 Ga0207693_10403443
500 Ga0207663_10265316
501 Ga0207660_10563719
502 Ga0207649_11612217
503 Ga0207681_11098557
504 Ga0207687_10117428
505 Ga0207687_10323109
506 Ga0207700_10248622
507 Ga0207664_10121615
508 Ga0207664_10417048
509 Ga0207706_10764319
510 Ga0207686_10586422
511 Ga0207686_10945654
512 Ga0207709_10185103
513 Ga0207709_10324888
514 Ga0207709_10343046
515 Ga0207670_10395162
516 Ga0207670_10419022
517 Ga0207669_10346080
518 Ga0207704_10694868
519 Ga0207704_10990788
520 Ga0207665_10819700
521 Ga0207689_10129944
522 Ga0207689_10929421
523 Ga0207679_10343142
524 Ga0207679_10515791
525 Ga0207712_10393919
526 Ga0207668_10233554
527 Ga0207677_10758848
528 Ga0207703_10091649
529 Ga0207703_10480189
530 Ga0207639_10568644
531 Ga0207641_10336657
532 Ga0207648_10097532
533 Ga0207676_10735334
534 Ga0207674_10130798
535 Ga0207675_100188137
536 Ga0207675_100315405
537 Ga0207675_100321955
538 Ga0207675_100589656
539 Ga0207698_10419343
540 Ga0207698_10540527
541 Ga0209813_10101484
542 Ga0207428_10172232
543 Ga0268266_10197191
544 Ga0307508_10046340
545 Ga0373949_0066842
546 Ga0373937_1637240
547 Ga0373925_1231521
548 Ga0395899_0041390
549 Ga0395900_0127315
550 Ga0395900_0264274
551 Ga0395898_0002563
552 Ga0395898_0044956
553 Ga0395898_0861277
554 Ga0395898_1081661
555 Ga0395898_1374685
556 Ga0395905_0003099
557 Ga0395905_1488907
558 Ga0395901_0031809
559 Ga0395901_0212868
560 Ga0436365_1529570
561 Ga0436360_0364782
562 Ga0436363_0012195
563 Ga0436363_0307100
564 Ga0436363_0383834
565 Ga0436362_0171802
566 Ga0436362_0176400
567 Ga0436362_0987003
568 Ga0451847_0985481
569 Ga0450888_007565
570 Ga0439460_0007254
571 Ga0439460_0300302
572 Ga0439440_0040697
573 Ga0466963_0002608
574 Ga0466963_0050551
575 Ga0466970_0102491
576 Ga0466957_0009687
577 Ga0466958_0001088
578 Ga0466958_0808615
579 Ga0466967_0009133
580 Ga0466967_0547761
581 Ga0495629_0221192
582 Ga0495628_0023434
583 Ga0495586_0746118
584 Ga0495586_0786913
585 Ga0495624_0764913
586 Ga0495589_0276680
587 Ga0495674_0264981
588 Ga0495674_0300192
589 Ga0495679_115992
590 Ga0496102_0065443
591 Ga0496102_0140066
592 Ga0496102_0284583
593 Ga0496102_0678013
594 Ga0496104_0176966
595 Ga0496105_0158576
596 Ga0496106_0006193
597 Ga0496106_0153735
598 Ga0496106_0500905
599 Ga0496107_0003106
600 Ga0496108_0018345
601 Ga0496108_0533718
602 Ga0496109_0045454
603 Ga0496109_0055245
604 Ga0496109_0349216
605 Ga0496109_0596231
606 Ga0496109_0910984
607 Ga0496109_1321586
608 Ga0496110_0050489
609 Ga0496110_0171686
610 Ga0496110_0860766
611 Ga0496110_1298023
612 Ga0496111_0078207
613 Ga0496111_0140613
614 Ga0496111_0167991
615 Ga0496111_0264613
616 Ga0496111_0712584
617 Ga0496112_0151948
618 Ga0496112_0200240
619 Ga0496112_0277771
620 Ga0496112_0734797
621 Ga0496112_1304960
622 Ga0496113_0034465
623 Ga0496113_0273525
624 Ga0496113_0703739
625 Ga0496114_0170550
626 Ga0496115_0029463
627 Ga0496115_0051398
628 Ga0496115_0470746
629 Ga0496126_0298884
630 nmdc:mga00v17_353134_c1
631 nmdc:mga00v17_666644_c1
632 nmdc:mga0yw44_117798_c1
633 nmdc:mga04h51_120010_c1
634 nmdc:mga05p37_1051593_c1
635 nmdc:mga05p37_171642_c1
636 nmdc:mga05p37_34826_c1
637 nmdc:mga05p37_523694_c1
638 nmdc:mga05p37_577473_c1
639 nmdc:mga09592_111349_c1
640 nmdc:mga09592_28132_c1
641 nmdc:mga09592_502591_c1
642 nmdc:mga0qj67_265286_c1
643 nmdc:mga0qj67_721131_c1
644 nmdc:mga06r32_1743894_c1
645 nmdc:mga06r32_1793895_c1
646 nmdc:mga06r32_2033997_c1
647 nmdc:mga06r32_34424_c1
648 nmdc:mga06r32_595629_c1
649 nmdc:mga08y16_750013_c1
650 nmdc:mga0n895_163862_c1
651 nmdc:mga0n895_187206_c1
652 nmdc:mga0n895_668986_c1
653 nmdc:mga0rr50_274317_c1
654 nmdc:mga0rr50_46533_c1
655 nmdc:mga08x19_1013343_c1
656 nmdc:mga08x19_244295_c1
657 nmdc:mga0a205_1019804_c1
658 nmdc:mga0a205_22641_c1
659 nmdc:mga0a205_289340_c1
660 nmdc:mga0a205_31125_c1
661 Ga0495601_0021743
662 Ga0495612_0000205
663 Ga0495619_0072546
664 Ga0530510_0368012

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

20

147

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7r-assembly1.cif.gz_B conserved domain protein 0.8471 18 142
2i7r-assembly1.cif.gz_B conserved domain protein 0.8404 18 142
4nb0-assembly1.cif.gz_A crystal structure of fosb from staphylococcus aureus with bs-cys9 disulfide at 1.62 angstrom resolution 0.8083 14 142
3vcx-assembly1.cif.gz_B crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8046 22 140
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.7923 22 141
ID Description Score Start End Superfamily
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9205 91 138 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8466 90 141 3.30.720.110
3sk1A02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8465 90 140 3.30.720.110
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8423 20 141 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8378 91 138 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A535IXF6-F1-model_v4 VOC family protein 0.9583 86 146
AF-A0A6B3FE02-F1-model_v4 VOC family protein 0.9383 22 122
AF-A0A0K1PCE3-F1-model_v4 Putative lyase 0.9379 16 144 GO:0004493
GO:0016829
GO:0046491
AF-A0A843TE35-F1-model_v4 VOC domain-containing protein 0.9378 14 143 GO:0016491
AF-A0A6B3FE02-F1-model_v4 VOC family protein 0.9295 22 122

Map