F410878

General Info

Members Datasets Scaffolds Average Seq Length
332 209 664 304

Family's Representative Sequence

Representative Sequence 3300005981|Ga0081538_10006760|Ga0081538_100067604
Length 273
Sequence VTPKTDVQVEISAADQLVGVDVIGGGLRSYSVAGQELLDGYSPGQPSTSGRGQVLIPWPNRLQDGAYEFDGLRHQLPLTEPERGNAIHGLVRQESWTVGESRPERVVLEHVLRPNIGSEAAPYGSGQHPYLTLGTAVVDPLVLCAPGGTVLIVDERGIPRAKEPVHGTEFDFRRPREIGATTLDHAFTELERGMDGLARVELRDPKSRAGVSLWVDASYRYLQLFTGDRLPDVQRRSIAVEPMTCPPNAFRSGEDLIRLEPGQSVTSAWGIVP

Samples

Sample ID Description Type Environment
1 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
17 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
18 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
62 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
94 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
95 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
96 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
97 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
98 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
99 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
100 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
101 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
104 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
107 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
108 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
115 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
116 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
117 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
120 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
121 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
122 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
123 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
124 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
128 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
129 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
132 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
133 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
134 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
141 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
152 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
162 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
202 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
203 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.04
Rhizosphere 90.06
Stem 0
Stem Tuber 0
Unclassified 5.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081538_10006760 3300005981 Bacteria 10020
2 JGI25407J50210_10003551 3300003373 Bacteria 3745
3 Ga0070683_100006626 3300005329 Bacteria 9724
4 Ga0070683_100017060 3300005329 Bacteria 6409
5 Ga0070683_100085748 3300005329 Bacteria 2953
6 Ga0070683_100190037 3300005329 Bacteria 1950
7 Ga0070670_100061744 3300005331 Bacteria 3217
8 Ga0070670_100141220 3300005331 Bacteria 2083
9 Ga0070682_100049125 3300005337 Bacteria 2629
10 Ga0070689_100034120 3300005340 Bacteria 3882
11 Ga0070691_10005283 3300005341 Bacteria 5864
12 Ga0070675_100044450 3300005354 Bacteria 3632
13 Ga0070675_100250206 3300005354 Bacteria 1551
14 Ga0070671_100001017 3300005355 Bacteria 20609
15 Ga0070674_100110344 3300005356 Bacteria 2019
16 Ga0070673_100041669 3300005364 Bacteria 3534
17 Ga0070673_100072807 3300005364 Bacteria 2764
18 Ga0070659_100509190 3300005366 Bacteria 1027
19 Ga0070713_100075313 3300005436 Bacteria 2862
20 Ga0070713_100154746 3300005436 Bacteria 2042
21 Ga0070711_100085667 3300005439 Bacteria 2257
22 Ga0070700_100045413 3300005441 Bacteria 2710
23 Ga0068867_100056713 3300005459 Bacteria 2899
24 Ga0070685_10007555 3300005466 Bacteria 5563
25 Ga0070685_10080052 3300005466 Bacteria 1956
26 Ga0070685_10177386 3300005466 Bacteria 1369
27 Ga0070684_100025837 3300005535 Bacteria 4940
28 Ga0070684_100030389 3300005535 Bacteria 4589
29 Ga0070684_100275712 3300005535 Bacteria 1540
30 Ga0068853_100098983 3300005539 Bacteria 2575
31 Ga0070672_100052824 3300005543 Bacteria 3174
32 Ga0070686_100025479 3300005544 Bacteria 3559
33 Ga0070695_100006079 3300005545 Bacteria 7135
34 Ga0070695_100041665 3300005545 Bacteria 2912
35 Ga0070693_100024024 3300005547 Bacteria 3265
36 Ga0070665_100091506 3300005548 Bacteria 3047
37 Ga0070704_100266223 3300005549 Bacteria 1414
38 Ga0070664_100027524 3300005564 Bacteria 4725
39 Ga0068857_100005813 3300005577 Bacteria 10541
40 Ga0068854_100088828 3300005578 Bacteria 2295
41 Ga0068856_100052022 3300005614 Bacteria 4038
42 Ga0068859_100530475 3300005617 Bacteria 1272
43 Ga0068861_100145568 3300005719 Bacteria 1939
44 Ga0068863_100373863 3300005841 Bacteria 1391
45 Ga0068858_100203673 3300005842 Bacteria 1872
46 Ga0068860_100243975 3300005843 Bacteria 1748
47 Ga0081455_10018504 3300005937 Bacteria 6632
48 Ga0081455_10026646 3300005937 Bacteria 5310
49 Ga0081455_10029568 3300005937 Bacteria 4994
50 Ga0081455_10067709 3300005937 Bacteria 2974
51 Ga0081455_10283748 3300005937 Bacteria 1195
52 Ga0081538_10000183 3300005981 Bacteria 68671
53 Ga0081538_10003854 3300005981 Bacteria 14004
54 Ga0081538_10004716 3300005981 Bacteria 12484
55 Ga0081538_10007846 3300005981 Bacteria 9155
56 Ga0081540_1000017 3300005983 Bacteria 164991
57 Ga0070717_10030420 3300006028 Bacteria 4338
58 Ga0070717_10143701 3300006028 Bacteria 2059
59 Ga0070712_100197101 3300006175 Unclassified 1579
60 Ga0075428_100103920 3300006844 Bacteria 3098
61 Ga0075433_10009488 3300006852 Bacteria 7777
62 Ga0075434_100003225 3300006871 Bacteria 14556
63 Ga0075434_100027676 3300006871 Bacteria 5566
64 Ga0075434_100031708 3300006871 Bacteria 5211
65 Ga0075434_100072408 3300006871 Bacteria 3438
66 Ga0075434_100190351 3300006871 Bacteria 2072
67 Ga0075436_100035625 3300006914 Bacteria 3432
68 Ga0075436_100300093 3300006914 Bacteria 1151
69 Ga0097620_100530456 3300006931 Bacteria 1272
70 Ga0075435_100158846 3300007076 Bacteria 1903
71 Ga0075435_100404969 3300007076 Unclassified 1174
72 Ga0111539_10030492 3300009094 Bacteria 6555
73 Ga0111539_10046007 3300009094 Bacteria 5222
74 Ga0111539_10118249 3300009094 Bacteria 3106
75 Ga0111539_10141176 3300009094 Bacteria 2820
76 Ga0111539_10177375 3300009094 Bacteria 2489
77 Ga0105245_10118426 3300009098 Bacteria 2471
78 Ga0105245_10134146 3300009098 Bacteria 2325
79 Ga0105245_10211594 3300009098 Bacteria 1866
80 Ga0105245_10379314 3300009098 Bacteria 1408
81 Ga0105245_10555438 3300009098 Bacteria 1170
82 Ga0114129_10016756 3300009147 Bacteria 10434
83 Ga0114129_10043074 3300009147 Bacteria 6353
84 Ga0114129_10084468 3300009147 Bacteria 4407
85 Ga0114129_10378615 3300009147 Bacteria 1870
86 Ga0105243_10026742 3300009148 Bacteria 4418
87 Ga0105242_10074612 3300009176 Bacteria 2822
88 Ga0105248_10178631 3300009177 Bacteria 2392
89 Ga0105248_10215946 3300009177 Bacteria 2160
90 Ga0105238_10088101 3300009551 Bacteria 3090
91 Ga0105239_10057296 3300010375 Bacteria 4274
92 Ga0105239_10142583 3300010375 Bacteria 2671
93 Ga0105239_10716755 3300010375 Bacteria 1144
94 Ga0105246_10018370 3300011119 Bacteria 4456
95 Ga0105246_10033121 3300011119 Bacteria 3432
96 Ga0157374_10128104 3300013296 Bacteria 2455
97 Ga0157372_10350074 3300013307 Bacteria 1721
98 Ga0163163_10241872 3300014325 Bacteria 1855
99 Ga0157380_10030181 3300014326 Bacteria 4150
100 Ga0157380_10088748 3300014326 Bacteria 2545
101 Ga0157380_10089098 3300014326 Bacteria 2541
102 Ga0157377_10030447 3300014745 Bacteria 2924
103 Ga0157376_10356546 3300014969 Bacteria 1401
104 Ga0163161_10135348 3300017792 Bacteria 1862
105 Ga0213872_10067458 3300021361 Bacteria 1615
106 Ga0213874_10033187 3300021377 Bacteria 1503
107 Ga0207692_10003522 3300025898 Bacteria 6124
108 Ga0207642_10070019 3300025899 Bacteria 1666
109 Ga0207688_10046974 3300025901 Bacteria 2411
110 Ga0207654_10157972 3300025911 Bacteria 1462
111 Ga0207693_10017134 3300025915 Bacteria 5780
112 Ga0207693_10121957 3300025915 Bacteria 2047
113 Ga0207693_10268946 3300025915 Bacteria 1336
114 Ga0207663_10033594 3300025916 Bacteria 3058
115 Ga0207649_10284954 3300025920 Bacteria 1202
116 Ga0207659_10028887 3300025926 Bacteria 3773
117 Ga0207687_10087654 3300025927 Bacteria 2262
118 Ga0207700_10047675 3300025928 Bacteria 3177
119 Ga0207700_10090795 3300025928 Bacteria 2412
120 Ga0207664_10038677 3300025929 Bacteria 3700
121 Ga0207690_10227079 3300025932 Bacteria 1431
122 Ga0207706_10148712 3300025933 Bacteria 2061
123 Ga0207669_10085896 3300025937 Bacteria 2033
124 Ga0207669_10095961 3300025937 Bacteria 1945
125 Ga0207704_10033277 3300025938 Bacteria 2929
126 Ga0207665_10024712 3300025939 Unclassified 3962
127 Ga0207691_10026508 3300025940 Bacteria 5437
128 Ga0207661_10025157 3300025944 Bacteria 4523
129 Ga0207661_10065447 3300025944 Bacteria 2951
130 Ga0207661_10402407 3300025944 Bacteria 1241
131 Ga0207651_10251203 3300025960 Bacteria 1447
132 Ga0207677_10159007 3300026023 Bacteria 1753
133 Ga0207703_10116510 3300026035 Bacteria 2287
134 Ga0207639_10637365 3300026041 Bacteria 985
135 Ga0207708_10012187 3300026075 Bacteria 6414
136 Ga0207648_10184074 3300026089 Bacteria 1849
137 Ga0207676_10044854 3300026095 Bacteria 3413
138 Ga0207674_10003494 3300026116 Bacteria 19188
139 Ga0207675_100421565 3300026118 Bacteria 1318
140 Ga0207698_10111907 3300026142 Bacteria 2290
141 Ga0207428_10001005 3300027907 Bacteria 31279
142 Ga0207428_10058617 3300027907 Bacteria 3055
143 Ga0268264_10438760 3300028381 Bacteria 1263
144 Ga0307413_10051868 3300031824 Bacteria 2474
145 Ga0307410_10041323 3300031852 Bacteria 3040
146 Ga0307409_100085390 3300031995 Bacteria 2566
147 Ga0307415_100051732 3300032126 Bacteria 2789
148 Ga0373958_0038304 3300034819 Unclassified 970
149 Ga0373926_0014256 3300035083 Bacteria 2701
150 Ga0373944_0005186 3300035089 Bacteria 3426
151 Ga0373949_0005159 3300035090 Bacteria 2932
152 Ga0373932_0006754 3300035112 Bacteria 2721
153 Ga0373936_0025583 3300035113 Bacteria 2308
154 Ga0373939_0066142 3300035114 Unclassified 1165
155 Ga0373960_0001683 3300035121 Bacteria 4947
156 Ga0373955_0053981 3300035172 Bacteria 2196
157 Ga0373942_0009127 3300035207 Unclassified 2317
158 Ga0373961_0003787 3300035241 Bacteria 3697
159 Ga0373962_0001210 3300035242 Bacteria 6040
160 Ga0373931_0001503 3300035691 Bacteria 10037
161 Ga0373933_0026308 3300035724 Bacteria 3340
162 Ga0373947_0097156 3300035725 Bacteria 1845
163 Ga0373937_0202628 3300036401 Bacteria 1865
164 Ga0373925_0191824 3300037068 Bacteria 1621
165 Ga0436361_0496773 3300039447 Bacteria 5675
166 Ga0436361_0499681 3300039447 Bacteria 1574
167 Ga0436363_1078823 3300039450 Bacteria 3537
168 Ga0436363_1110896 3300039450 Bacteria 1870
169 Ga0436362_0546615 3300039453 Bacteria 2006
170 Ga0495617_057367 3300046452 Unclassified 1291
171 Ga0495592_0041523 3300046454 Bacteria 3447
172 Ga0495641_0051064 3300046461 Bacteria 1889
173 Ga0495651_0083984 3300046462 Bacteria 2400
174 Ga0495653_0134578 3300046463 Bacteria 1745
175 Ga0495580_0024906 3300046472 Bacteria 4374
176 Ga0495582_0011625 3300046473 Bacteria 4851
177 Ga0495639_0071542 3300046475 Unclassified 1602
178 Ga0495662_0062389 3300046476 Bacteria 1800
179 Ga0495664_0064883 3300046477 Bacteria 2176
180 Ga0495664_0318084 3300046477 Bacteria 939
181 Ga0495584_0169354 3300046491 Unclassified 1110
182 Ga0495585_0012949 3300046492 Bacteria 4900
183 Ga0495594_0098985 3300046499 Bacteria 1640
184 Ga0495594_0189492 3300046499 Unclassified 1171
185 Ga0495618_0116796 3300046514 Unclassified 1708
186 Ga0495628_0220533 3300046516 Unclassified 1424
187 Ga0495630_0103114 3300046517 Bacteria 2158
188 Ga0495644_0037609 3300046523 Bacteria 1826
189 Ga0495663_0013893 3300046525 Bacteria 2253
190 Ga0495666_0092056 3300046526 Unclassified 1430
191 Ga0495586_0057800 3300046535 Bacteria 2105
192 Ga0495622_0021929 3300046557 Bacteria 2975
193 Ga0495667_0098969 3300046559 Bacteria 1888
194 Ga0495656_0012131 3300046615 Bacteria 3175
195 Ga0495634_0070565 3300046642 Bacteria 2302
196 Ga0495635_0016464 3300046663 Bacteria 5164
197 Ga0495659_0016736 3300046664 Bacteria 2422
198 Ga0495661_0087956 3300046665 Bacteria 1775
199 Ga0495588_0053265 3300046674 Bacteria 2086
200 Ga0495588_0128285 3300046674 Bacteria 1338
201 Ga0495599_0052093 3300046678 Bacteria 2564
202 Ga0495646_0062153 3300046680 Bacteria 2221
203 Ga0495646_0071038 3300046680 Bacteria 2049
204 Ga0495646_0089692 3300046680 Bacteria 1779
205 Ga0495647_0042511 3300046681 Bacteria 1735
206 Ga0495658_0087667 3300046683 Bacteria 1838
207 Ga0495670_0090180 3300046691 Bacteria 1568
208 Ga0495589_0055895 3300046794 Bacteria 1944
209 Ga0495589_0121044 3300046794 Bacteria 1260
210 Ga0495600_0044242 3300046809 Bacteria 2905
211 Ga0495674_0038847 3300047319 Bacteria 4270
212 Ga0495676_0071248 3300047321 Bacteria 2672
213 Ga0495679_062343 3300047446 Unclassified 1091
214 Ga0495684_0017428 3300047471 Bacteria 5530
215 Ga0495602_0520336 3300048088 Unclassified 829
216 Ga0495614_0112437 3300048089 Bacteria 1196
217 Ga0496100_0035679 3300048903 Bacteria 3130
218 Ga0496100_0037522 3300048903 Bacteria 3064
219 Ga0496101_0006168 3300048904 Bacteria 7702
220 Ga0496101_0106958 3300048904 Bacteria 2101
221 Ga0496101_0138542 3300048904 Bacteria 1853
222 Ga0496101_0323529 3300048904 Bacteria 1210
223 Ga0496102_0042390 3300048905 Bacteria 4124
224 Ga0496102_0492399 3300048905 Bacteria 1148
225 Ga0496104_0216866 3300048907 Bacteria 1825
226 Ga0496104_0314806 3300048907 Bacteria 1478
227 Ga0496105_0052101 3300048908 Bacteria 3379
228 Ga0496106_0215423 3300048909 Bacteria 1530
229 Ga0496107_0021515 3300048910 Bacteria 4558
230 Ga0496109_0008970 3300048912 Bacteria 8518
231 Ga0496109_0029955 3300048912 Bacteria 4877
232 Ga0496109_0092812 3300048912 Bacteria 2792
233 Ga0496109_0177292 3300048912 Bacteria 2001
234 Ga0496109_0316149 3300048912 Bacteria 1473
235 Ga0496109_0391999 3300048912 Bacteria 1312
236 Ga0496110_0031381 3300048913 Bacteria 4584
237 Ga0496110_0179345 3300048913 Bacteria 1923
238 Ga0496110_0260109 3300048913 Bacteria 1580
239 Ga0496110_0367866 3300048913 Bacteria 1310
240 Ga0496111_0005538 3300048914 Bacteria 8111
241 Ga0496111_0073367 3300048914 Bacteria 2492
242 Ga0496112_0247778 3300048915 Bacteria 1733
243 Ga0496114_0033711 3300048917 Bacteria 4221
244 Ga0496114_0084750 3300048917 Bacteria 2684
245 Ga0496114_0368483 3300048917 Unclassified 1271
246 Ga0496115_0184612 3300048918 Bacteria 1723
247 Ga0501031_0011549 3300049568 Bacteria 5759
248 Ga0501031_0019954 3300049568 Bacteria 4370
249 Ga0501031_0097021 3300049568 Bacteria 1924
250 Ga0501033_0015673 3300049570 Bacteria 5747
251 Ga0501034_0286337 3300049571 Bacteria 1587
252 Ga0501036_0020440 3300049572 Bacteria 5562
253 Ga0501036_0079730 3300049572 Bacteria 2768
254 Ga0501036_0170239 3300049572 Bacteria 1835
255 Ga0501037_0078627 3300049573 Bacteria 2393
256 Ga0501038_0114798 3300049574 Bacteria 2227
257 Ga0501039_0009464 3300049575 Bacteria 7427
258 Ga0501039_0033684 3300049575 Bacteria 3951
259 Ga0501039_0033928 3300049575 Bacteria 3938
260 Ga0501040_0004832 3300049576 Bacteria 8732
261 Ga0501040_0031668 3300049576 Bacteria 3575
262 Ga0501040_0088933 3300049576 Bacteria 2145
263 Ga0501041_0098922 3300049577 Bacteria 1804
264 Ga0501042_0017933 3300049578 Bacteria 4894
265 Ga0501043_0031242 3300049579 Bacteria 4187
266 Ga0501043_0158709 3300049579 Bacteria 1768
267 Ga0501046_0009551 3300049580 Bacteria 8373
268 Ga0501046_0087762 3300049580 Bacteria 2396
269 Ga0501048_0059763 3300049582 Bacteria 2701
270 Ga0501069_0036704 3300049585 Bacteria 2703
271 Ga0501069_0040251 3300049585 Bacteria 2583
272 Ga0501070_0009417 3300049586 Bacteria 8256
273 Ga0501071_0012702 3300049587 Bacteria 5724
274 Ga0501071_0056141 3300049587 Bacteria 2843
275 Ga0501072_0006027 3300049588 Bacteria 9244
276 Ga0501072_0009512 3300049588 Bacteria 7392
277 Ga0501072_0040425 3300049588 Bacteria 3661
278 Ga0501073_0054190 3300049589 Bacteria 2808
279 Ga0501073_0064863 3300049589 Bacteria 2547
280 Ga0501074_0023025 3300049590 Bacteria 4531
281 Ga0501074_0063536 3300049590 Bacteria 2659
282 Ga0501074_0068327 3300049590 Bacteria 2554
283 Ga0501075_0006907 3300049591 Bacteria 7842
284 Ga0501075_0048614 3300049591 Bacteria 3187
285 Ga0501075_0053320 3300049591 Bacteria 3041
286 Ga0501076_0004525 3300049592 Bacteria 9902
287 Ga0501076_0023776 3300049592 Bacteria 4727
288 Ga0501076_0074442 3300049592 Bacteria 2720
289 Ga0501077_0011387 3300049593 Bacteria 5554
290 Ga0501077_0042745 3300049593 Bacteria 2880
291 Ga0501077_0052358 3300049593 Bacteria 2593
292 Ga0501079_0004065 3300049741 Bacteria 10833
293 Ga0501079_0005606 3300049741 Bacteria 9369
294 Ga0501079_0065439 3300049741 Bacteria 2804
295 Ga0501080_0026528 3300049742 Bacteria 5383
296 Ga0501080_0042757 3300049742 Bacteria 4218
297 Ga0501081_0000700 3300049743 Bacteria 19380
298 Ga0501081_0004464 3300049743 Bacteria 8975
299 Ga0501081_0005935 3300049743 Bacteria 7905
300 Ga0501083_0052241 3300049744 Bacteria 2746
301 Ga0501035_0070457 3300049822 Bacteria 3097
302 Ga0501044_0091582 3300049823 Bacteria 3067
303 Ga0501045_0001899 3300049824 Bacteria 14149
304 Ga0501045_0006265 3300049824 Bacteria 8229
305 Ga0501045_0006631 3300049824 Bacteria 8024
306 nmdc:mga05p37_296174_c1 3300050507 Bacteria 1924
307 nmdc:mga05p37_32988_c1 3300050507 Bacteria 6340
308 nmdc:mga05p37_363805_c1 3300050507 Bacteria 1700
309 nmdc:mga05p37_562465_c1 3300050507 Bacteria 1295
310 nmdc:mga08y16_19116_c1 3300050511 Bacteria 7218
311 nmdc:mga08y16_31872_c1 3300050511 Bacteria 5542
312 nmdc:mga08y16_38679_c1 3300050511 Bacteria 5007
313 nmdc:mga0n895_19422_c1 3300050512 Bacteria 6317
314 nmdc:mga0n895_36833_c1 3300050512 Bacteria 4727
315 nmdc:mga0n895_53444_c1 3300050512 Bacteria 3969
316 nmdc:mga0n895_72394_c1 3300050512 Bacteria 3419
317 nmdc:mga0a205_7872_c1 3300050515 Bacteria 9679
318 Ga0495601_0084470 3300053077 Unclassified 2039
319 Ga0495601_0093066 3300053077 Bacteria 1941
320 Ga0495601_0143129 3300053077 Unclassified 1560
321 Ga0495595_0083954 3300053084 Bacteria 1521
322 Ga0495619_0017868 3300053085 Bacteria 4495
323 Ga0495619_0026248 3300053085 Bacteria 3746
324 Ga0495619_0102791 3300053085 Bacteria 1946
325 Ga0495619_0198171 3300053085 Bacteria 1390
326 Ga0501084_0034282 3300054114 Bacteria 4244
327 Ga0501084_0037269 3300054114 Bacteria 4062
328 Ga0501084_0066074 3300054114 Bacteria 3026
329 Ga0501082_0041390 3300060353 Bacteria 3972
330 Ga0501082_0050863 3300060353 Bacteria 3573
331 Ga0530510_0035200 3300061734 Bacteria 3608
332 Ga0530510_0039966 3300061734 Bacteria 3385
333 Ga0081538_10006760
334 JGI25407J50210_10003551
335 Ga0070683_100006626
336 Ga0070683_100017060
337 Ga0070683_100085748
338 Ga0070683_100190037
339 Ga0070670_100061744
340 Ga0070670_100141220
341 Ga0070682_100049125
342 Ga0070689_100034120
343 Ga0070691_10005283
344 Ga0070675_100044450
345 Ga0070675_100250206
346 Ga0070671_100001017
347 Ga0070674_100110344
348 Ga0070673_100041669
349 Ga0070673_100072807
350 Ga0070659_100509190
351 Ga0070713_100075313
352 Ga0070713_100154746
353 Ga0070711_100085667
354 Ga0070700_100045413
355 Ga0068867_100056713
356 Ga0070685_10007555
357 Ga0070685_10080052
358 Ga0070685_10177386
359 Ga0070684_100025837
360 Ga0070684_100030389
361 Ga0070684_100275712
362 Ga0068853_100098983
363 Ga0070672_100052824
364 Ga0070686_100025479
365 Ga0070695_100006079
366 Ga0070695_100041665
367 Ga0070693_100024024
368 Ga0070665_100091506
369 Ga0070704_100266223
370 Ga0070664_100027524
371 Ga0068857_100005813
372 Ga0068854_100088828
373 Ga0068856_100052022
374 Ga0068859_100530475
375 Ga0068861_100145568
376 Ga0068863_100373863
377 Ga0068858_100203673
378 Ga0068860_100243975
379 Ga0081455_10018504
380 Ga0081455_10026646
381 Ga0081455_10029568
382 Ga0081455_10067709
383 Ga0081455_10283748
384 Ga0081538_10000183
385 Ga0081538_10003854
386 Ga0081538_10004716
387 Ga0081538_10007846
388 Ga0081540_1000017
389 Ga0070717_10030420
390 Ga0070717_10143701
391 Ga0070712_100197101
392 Ga0075428_100103920
393 Ga0075433_10009488
394 Ga0075434_100003225
395 Ga0075434_100027676
396 Ga0075434_100031708
397 Ga0075434_100072408
398 Ga0075434_100190351
399 Ga0075436_100035625
400 Ga0075436_100300093
401 Ga0097620_100530456
402 Ga0075435_100158846
403 Ga0075435_100404969
404 Ga0111539_10030492
405 Ga0111539_10046007
406 Ga0111539_10118249
407 Ga0111539_10141176
408 Ga0111539_10177375
409 Ga0105245_10118426
410 Ga0105245_10134146
411 Ga0105245_10211594
412 Ga0105245_10379314
413 Ga0105245_10555438
414 Ga0114129_10016756
415 Ga0114129_10043074
416 Ga0114129_10084468
417 Ga0114129_10378615
418 Ga0105243_10026742
419 Ga0105242_10074612
420 Ga0105248_10178631
421 Ga0105248_10215946
422 Ga0105238_10088101
423 Ga0105239_10057296
424 Ga0105239_10142583
425 Ga0105239_10716755
426 Ga0105246_10018370
427 Ga0105246_10033121
428 Ga0157374_10128104
429 Ga0157372_10350074
430 Ga0163163_10241872
431 Ga0157380_10030181
432 Ga0157380_10088748
433 Ga0157380_10089098
434 Ga0157377_10030447
435 Ga0157376_10356546
436 Ga0163161_10135348
437 Ga0213872_10067458
438 Ga0213874_10033187
439 Ga0207692_10003522
440 Ga0207642_10070019
441 Ga0207688_10046974
442 Ga0207654_10157972
443 Ga0207693_10017134
444 Ga0207693_10121957
445 Ga0207693_10268946
446 Ga0207663_10033594
447 Ga0207649_10284954
448 Ga0207659_10028887
449 Ga0207687_10087654
450 Ga0207700_10047675
451 Ga0207700_10090795
452 Ga0207664_10038677
453 Ga0207690_10227079
454 Ga0207706_10148712
455 Ga0207669_10085896
456 Ga0207669_10095961
457 Ga0207704_10033277
458 Ga0207665_10024712
459 Ga0207691_10026508
460 Ga0207661_10025157
461 Ga0207661_10065447
462 Ga0207661_10402407
463 Ga0207651_10251203
464 Ga0207677_10159007
465 Ga0207703_10116510
466 Ga0207639_10637365
467 Ga0207708_10012187
468 Ga0207648_10184074
469 Ga0207676_10044854
470 Ga0207674_10003494
471 Ga0207675_100421565
472 Ga0207698_10111907
473 Ga0207428_10001005
474 Ga0207428_10058617
475 Ga0268264_10438760
476 Ga0307413_10051868
477 Ga0307410_10041323
478 Ga0307409_100085390
479 Ga0307415_100051732
480 Ga0373958_0038304
481 Ga0373926_0014256
482 Ga0373944_0005186
483 Ga0373949_0005159
484 Ga0373932_0006754
485 Ga0373936_0025583
486 Ga0373939_0066142
487 Ga0373960_0001683
488 Ga0373955_0053981
489 Ga0373942_0009127
490 Ga0373961_0003787
491 Ga0373962_0001210
492 Ga0373931_0001503
493 Ga0373933_0026308
494 Ga0373947_0097156
495 Ga0373937_0202628
496 Ga0373925_0191824
497 Ga0436361_0496773
498 Ga0436361_0499681
499 Ga0436363_1078823
500 Ga0436363_1110896
501 Ga0436362_0546615
502 Ga0495617_057367
503 Ga0495592_0041523
504 Ga0495641_0051064
505 Ga0495651_0083984
506 Ga0495653_0134578
507 Ga0495580_0024906
508 Ga0495582_0011625
509 Ga0495639_0071542
510 Ga0495662_0062389
511 Ga0495664_0064883
512 Ga0495664_0318084
513 Ga0495584_0169354
514 Ga0495585_0012949
515 Ga0495594_0098985
516 Ga0495594_0189492
517 Ga0495618_0116796
518 Ga0495628_0220533
519 Ga0495630_0103114
520 Ga0495644_0037609
521 Ga0495663_0013893
522 Ga0495666_0092056
523 Ga0495586_0057800
524 Ga0495622_0021929
525 Ga0495667_0098969
526 Ga0495656_0012131
527 Ga0495634_0070565
528 Ga0495635_0016464
529 Ga0495659_0016736
530 Ga0495661_0087956
531 Ga0495588_0053265
532 Ga0495588_0128285
533 Ga0495599_0052093
534 Ga0495646_0062153
535 Ga0495646_0071038
536 Ga0495646_0089692
537 Ga0495647_0042511
538 Ga0495658_0087667
539 Ga0495670_0090180
540 Ga0495589_0055895
541 Ga0495589_0121044
542 Ga0495600_0044242
543 Ga0495674_0038847
544 Ga0495676_0071248
545 Ga0495679_062343
546 Ga0495684_0017428
547 Ga0495602_0520336
548 Ga0495614_0112437
549 Ga0496100_0035679
550 Ga0496100_0037522
551 Ga0496101_0006168
552 Ga0496101_0106958
553 Ga0496101_0138542
554 Ga0496101_0323529
555 Ga0496102_0042390
556 Ga0496102_0492399
557 Ga0496104_0216866
558 Ga0496104_0314806
559 Ga0496105_0052101
560 Ga0496106_0215423
561 Ga0496107_0021515
562 Ga0496109_0008970
563 Ga0496109_0029955
564 Ga0496109_0092812
565 Ga0496109_0177292
566 Ga0496109_0316149
567 Ga0496109_0391999
568 Ga0496110_0031381
569 Ga0496110_0179345
570 Ga0496110_0260109
571 Ga0496110_0367866
572 Ga0496111_0005538
573 Ga0496111_0073367
574 Ga0496112_0247778
575 Ga0496114_0033711
576 Ga0496114_0084750
577 Ga0496114_0368483
578 Ga0496115_0184612
579 Ga0501031_0011549
580 Ga0501031_0019954
581 Ga0501031_0097021
582 Ga0501033_0015673
583 Ga0501034_0286337
584 Ga0501036_0020440
585 Ga0501036_0079730
586 Ga0501036_0170239
587 Ga0501037_0078627
588 Ga0501038_0114798
589 Ga0501039_0009464
590 Ga0501039_0033684
591 Ga0501039_0033928
592 Ga0501040_0004832
593 Ga0501040_0031668
594 Ga0501040_0088933
595 Ga0501041_0098922
596 Ga0501042_0017933
597 Ga0501043_0031242
598 Ga0501043_0158709
599 Ga0501046_0009551
600 Ga0501046_0087762
601 Ga0501048_0059763
602 Ga0501069_0036704
603 Ga0501069_0040251
604 Ga0501070_0009417
605 Ga0501071_0012702
606 Ga0501071_0056141
607 Ga0501072_0006027
608 Ga0501072_0009512
609 Ga0501072_0040425
610 Ga0501073_0054190
611 Ga0501073_0064863
612 Ga0501074_0023025
613 Ga0501074_0063536
614 Ga0501074_0068327
615 Ga0501075_0006907
616 Ga0501075_0048614
617 Ga0501075_0053320
618 Ga0501076_0004525
619 Ga0501076_0023776
620 Ga0501076_0074442
621 Ga0501077_0011387
622 Ga0501077_0042745
623 Ga0501077_0052358
624 Ga0501079_0004065
625 Ga0501079_0005606
626 Ga0501079_0065439
627 Ga0501080_0026528
628 Ga0501080_0042757
629 Ga0501081_0000700
630 Ga0501081_0004464
631 Ga0501081_0005935
632 Ga0501083_0052241
633 Ga0501035_0070457
634 Ga0501044_0091582
635 Ga0501045_0001899
636 Ga0501045_0006265
637 Ga0501045_0006631
638 nmdc:mga05p37_296174_c1
639 nmdc:mga05p37_32988_c1
640 nmdc:mga05p37_363805_c1
641 nmdc:mga05p37_562465_c1
642 nmdc:mga08y16_19116_c1
643 nmdc:mga08y16_31872_c1
644 nmdc:mga08y16_38679_c1
645 nmdc:mga0n895_19422_c1
646 nmdc:mga0n895_36833_c1
647 nmdc:mga0n895_53444_c1
648 nmdc:mga0n895_72394_c1
649 nmdc:mga0a205_7872_c1
650 Ga0495601_0084470
651 Ga0495601_0093066
652 Ga0495601_0143129
653 Ga0495595_0083954
654 Ga0495619_0017868
655 Ga0495619_0026248
656 Ga0495619_0102791
657 Ga0495619_0198171
658 Ga0501084_0034282
659 Ga0501084_0037269
660 Ga0501084_0066074
661 Ga0501082_0041390
662 Ga0501082_0050863
663 Ga0530510_0035200
664 Ga0530510_0039966

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

114

271

0.94

PF01263

Aldose_epim

Aldose 1-epimerase

9

119

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.8872 9 304
3nre-assembly4.cif.gz_D crystal structure of a putative aldose 1-epimerase (b2544) from escherichia coli k12 at 1.59 a resolution 0.8729 9 304
1lur-assembly2.cif.gz_B crystal structure of the galm/aldose epimerase homologue from c. elegans, northeast structural genomics target wr66 0.8658 9 303
3mwx-assembly2.cif.gz_B crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution 0.8582 10 304
3os7-assembly4.cif.gz_D crystal structure of a galactose mutarotase-like protein (ca_c0697) from clostridium acetobutylicum at 1.80 a resolution 0.8466 10 304
ID Description Score Start End Superfamily
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9514 9 301 2.70.98.10
af_P32139_19_304_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9449 9 301 2.70.98.10
af_A0A0R0IJW6_1_215_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8926 119 273 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8812 4 304 2.70.98.10
af_Q33AZ5_28_362_2.70.98.10 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8703 4 304 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A1I1M1Y6-F1-model_v4 Aldose 1-epimerase 0.9776 7 304 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A6G8Q4U0-F1-model_v4 Aldose epimerase 0.977 6 304 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A7W0RKI8-F1-model_v4 Aldose 1-epimerase family protein 0.9762 6 302 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A852ZRF5-F1-model_v4 Aldose 1-epimerase (EC 5.1.3.3) 0.9758 7 303 GO:0004034
GO:0006006
GO:0030246
GO:0033499
AF-A0A540VX92-F1-model_v4 Aldose 1-epimerase family protein 0.9756 7 304 GO:0004034
GO:0006006
GO:0030246
GO:0033499

Map