F410859

General Info

Members Datasets Scaffolds Average Seq Length
332 216 664 82

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_101101894|Ga0070699_1011018942
Length 87
Sequence VNAIVADEYVIPEPEPKEIDERLAIELRHLAENAVLKAQPQQGGEHCASCRYYFEDTADISYCWHPKLRILVGAQWWCQWWEAIPSA

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
106 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
107 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
108 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
109 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
110 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
111 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
119 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
120 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
132 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
133 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
134 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
135 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
149 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
157 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
158 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
162 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
166 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
170 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
171 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
176 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
183 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
184 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
185 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 2506783011 Frankia datiscae Dg1 Isolate Nodule
189 2508501039 Frankia saprophytica CN3 Isolate Nodule
190 2517572101 Frankia sp. DC12 Isolate Nodule
191 2527291627 Frankia casuarinae Thr Isolate Nodule
192 2527291629 Frankia sp. BMG5.23 Isolate Nodule
193 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
194 2576861822 Frankia sp. CeD Isolate Nodule
195 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
196 2619618881 Frankia sp. ACN1ag Isolate Unclassified
197 2619619003 Frankia sp. CpI1-P Isolate Nodule
198 2626541554 Frankia sp. AvcI.1 Isolate Nodule
199 2671180195 Frankia sp. CcI49 Isolate Nodule
200 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
201 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
202 2684623036 Frankia sp. CgIM4 Isolate Nodule
203 2687453737 Frankia sp. BMG5.36 Isolate Nodule
204 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
205 2710264753 Frankia sp. KB5 Isolate Nodule
206 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
207 2773857922 Frankia sp. CcI49 Isolate Nodule
208 2773857924 Frankia sp. CgIS1 Isolate Nodule
209 2773857933 Frankia sp. BMG5.30 Isolate Nodule
210 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
211 637000116 Frankia casuarinae CcI3 Isolate Nodule
212 8002775197 Frankia nepalensis CN7 Isolate Nodule
213 8002784119 Frankia sp. AgB1.9 Isolate Nodule
214 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
215 8054920844 Frankia tisae Agncl-8 Isolate Nodule
216 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.76
Metatranscriptomes 1.51
Isolates 8.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 7.23
Rhizoplane 5.42
Rhizosphere 81.02
Stem 0
Stem Tuber 0
Unclassified 13.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_101101894 3300005518 Bacteria 728
2 JGI25405J52794_10011868 3300003911 Bacteria 1670
3 Ga0065715_10540223 3300005293 Bacteria 749
4 Ga0070658_10246980 3300005327 Bacteria 1514
5 Ga0070683_100810088 3300005329 Bacteria 898
6 Ga0070690_100417825 3300005330 Bacteria 988
7 Ga0068869_101480747 3300005334 Bacteria 602
8 Ga0068868_102144337 3300005338 Bacteria 532
9 Ga0070687_100330299 3300005343 Bacteria 977
10 Ga0070687_100842537 3300005343 Bacteria 653
11 Ga0070692_10370816 3300005345 Bacteria 895
12 Ga0070668_100205734 3300005347 Bacteria 1617
13 Ga0070669_101980965 3300005353 Unclassified 509
14 Ga0070675_100256994 3300005354 Bacteria 1530
15 Ga0070675_100441242 3300005354 Bacteria 1166
16 Ga0070671_100295705 3300005355 Bacteria 1378
17 Ga0070671_101735236 3300005355 Bacteria 554
18 Ga0070674_100179347 3300005356 Bacteria 1621
19 Ga0070673_101162702 3300005364 Bacteria 722
20 Ga0070673_102046956 3300005364 Bacteria 544
21 Ga0070688_101295164 3300005365 Bacteria 588
22 Ga0070713_101193916 3300005436 Unclassified 736
23 Ga0070711_100692037 3300005439 Bacteria 858
24 Ga0070711_101303196 3300005439 Unclassified 630
25 Ga0070705_100101225 3300005440 Bacteria 1820
26 Ga0070705_100506919 3300005440 Bacteria 917
27 Ga0070700_100692753 3300005441 Bacteria 809
28 Ga0070700_101192551 3300005441 Bacteria 635
29 Ga0070694_100005876 3300005444 Bacteria 7444
30 Ga0070694_100660270 3300005444 Bacteria 847
31 Ga0070708_101047283 3300005445 Unclassified 764
32 Ga0070663_101744568 3300005455 Bacteria 557
33 Ga0070678_101197688 3300005456 Unclassified 704
34 Ga0070681_11166334 3300005458 Bacteria 692
35 Ga0068867_100729690 3300005459 Bacteria 877
36 Ga0068867_101704617 3300005459 Unclassified 591
37 Ga0070685_10364649 3300005466 Bacteria 991
38 Ga0070685_10487239 3300005466 Bacteria 870
39 Ga0070707_100076399 3300005468 Bacteria 3231
40 Ga0070707_100378029 3300005468 Unclassified 1376
41 Ga0070707_101584809 3300005468 Bacteria 622
42 Ga0070698_100026823 3300005471 Bacteria 5992
43 Ga0070698_100231700 3300005471 Bacteria 1780
44 Ga0070672_100066475 3300005543 Bacteria 2855
45 Ga0070686_100096490 3300005544 Bacteria 1988
46 Ga0070686_100563083 3300005544 Bacteria 893
47 Ga0070695_100373688 3300005545 Bacteria 1074
48 Ga0070693_100625269 3300005547 Unclassified 780
49 Ga0070704_100027634 3300005549 Bacteria 3766
50 Ga0070704_100651359 3300005549 Bacteria 930
51 Ga0070704_101835811 3300005549 Unclassified 561
52 Ga0070704_101852013 3300005549 Unclassified 559
53 Ga0068854_100676011 3300005578 Bacteria 889
54 Ga0068854_101895280 3300005578 Unclassified 548
55 Ga0068856_100630600 3300005614 Bacteria 1092
56 Ga0070702_100641042 3300005615 Bacteria 802
57 Ga0068859_100000103 3300005617 Bacteria 79192
58 Ga0068859_100025493 3300005617 Bacteria 5932
59 Ga0068859_101431859 3300005617 Bacteria 762
60 Ga0068859_102117533 3300005617 Bacteria 621
61 Ga0068864_100699185 3300005618 Bacteria 990
62 Ga0068863_100068581 3300005841 Bacteria 3354
63 Ga0068858_100000002 3300005842 Bacteria 351633
64 Ga0068858_100000767 3300005842 Bacteria 33512
65 Ga0068858_100004361 3300005842 Bacteria 13882
66 Ga0068858_100871318 3300005842 Bacteria 880
67 Ga0068862_100000232 3300005844 Bacteria 62130
68 Ga0081455_10000023 3300005937 Bacteria 159570
69 Ga0081455_10413148 3300005937 Bacteria 933
70 Ga0070712_100420942 3300006175 Bacteria 1107
71 Ga0070712_101059052 3300006175 Bacteria 703
72 Ga0075367_10285426 3300006178 Bacteria 1038
73 Ga0075431_101648558 3300006847 Bacteria 599
74 Ga0075434_100192498 3300006871 Bacteria 2060
75 Ga0075434_100411845 3300006871 Bacteria 1373
76 Ga0075434_100930392 3300006871 Bacteria 884
77 Ga0075429_100940307 3300006880 Bacteria 756
78 Ga0097620_100000103 3300006931 Bacteria 79192
79 Ga0097620_100025493 3300006931 Bacteria 5932
80 Ga0097620_101431984 3300006931 Bacteria 762
81 Ga0097620_102117746 3300006931 Bacteria 621
82 Ga0075435_100353789 3300007076 Unclassified 1259
83 Ga0075435_101882333 3300007076 Unclassified 525
84 Ga0105251_10623747 3300009011 Bacteria 513
85 Ga0105240_11947274 3300009093 Bacteria 611
86 Ga0111539_10015954 3300009094 Bacteria 9332
87 Ga0111539_10247890 3300009094 Unclassified 2074
88 Ga0111539_10305366 3300009094 Bacteria 1852
89 Ga0111539_10521125 3300009094 Bacteria 1385
90 Ga0111539_10977032 3300009094 Bacteria 984
91 Ga0111539_11002691 3300009094 Bacteria 971
92 Ga0111539_11171556 3300009094 Bacteria 893
93 Ga0105245_10175689 3300009098 Bacteria 2042
94 Ga0105245_10461235 3300009098 Bacteria 1281
95 Ga0105245_10789990 3300009098 Bacteria 987
96 Ga0105245_11269702 3300009098 Bacteria 785
97 Ga0105247_10000014 3300009101 Bacteria 285043
98 Ga0105247_10001869 3300009101 Bacteria 14741
99 Ga0105247_11357786 3300009101 Bacteria 573
100 Ga0114129_11191726 3300009147 Bacteria 949
101 Ga0114129_11327233 3300009147 Bacteria 890
102 Ga0105243_10180431 3300009148 Bacteria 1835
103 Ga0105243_11125089 3300009148 Unclassified 795
104 Ga0105242_10312252 3300009176 Unclassified 1439
105 Ga0105242_10490009 3300009176 Bacteria 1167
106 Ga0105248_10000038 3300009177 Bacteria 179916
107 Ga0105248_10000950 3300009177 Bacteria 32303
108 Ga0105248_10002916 3300009177 Bacteria 18984
109 Ga0105248_10770590 3300009177 Bacteria 1086
110 Ga0105248_12709084 3300009177 Unclassified 565
111 Ga0105238_12308387 3300009551 Bacteria 573
112 Ga0105249_10155317 3300009553 Bacteria 2206
113 Ga0105249_10808374 3300009553 Bacteria 1002
114 Ga0105249_11775426 3300009553 Bacteria 689
115 Ga0105249_11777398 3300009553 Unclassified 689
116 Ga0105239_10015471 3300010375 Bacteria 8451
117 Ga0105239_12240060 3300010375 Bacteria 635
118 Ga0105246_12227068 3300011119 Unclassified 534
119 Ga0163162_10271792 3300013306 Bacteria 1827
120 Ga0163162_10353000 3300013306 Bacteria 1603
121 Ga0163162_13279043 3300013306 Bacteria 519
122 Ga0157372_12283517 3300013307 Bacteria 621
123 Ga0163163_10009501 3300014325 Bacteria 8686
124 Ga0163163_10024407 3300014325 Bacteria 5754
125 Ga0163163_10305428 3300014325 Bacteria 1643
126 Ga0163163_11283346 3300014325 Unclassified 794
127 Ga0163163_13007110 3300014325 Bacteria 526
128 Ga0157380_10510829 3300014326 Bacteria 1170
129 Ga0157380_12087553 3300014326 Bacteria 629
130 Ga0157380_12544761 3300014326 Bacteria 578
131 Ga0157379_10000007 3300014968 Bacteria 142402
132 Ga0157379_10007125 3300014968 Bacteria 9669
133 Ga0157379_11095471 3300014968 Bacteria 763
134 Ga0157379_11727278 3300014968 Bacteria 613
135 Ga0163161_11513971 3300017792 Unclassified 589
136 Ga0206356_10523478 3300020070 Bacteria 656
137 Ga0206356_10739479 3300020070 Bacteria 585
138 Ga0206354_10772984 3300020081 Bacteria 710
139 Ga0207710_10000020 3300025900 Bacteria 338425
140 Ga0207710_10000031 3300025900 Bacteria 285157
141 Ga0207710_10257717 3300025900 Bacteria 873
142 Ga0207688_10326179 3300025901 Bacteria 943
143 Ga0207693_10319502 3300025915 Bacteria 1215
144 Ga0207663_11530593 3300025916 Unclassified 537
145 Ga0207646_10434958 3300025922 Unclassified 1184
146 Ga0207646_11506882 3300025922 Bacteria 582
147 Ga0207646_11682516 3300025922 Unclassified 545
148 Ga0207694_11286753 3300025924 Bacteria 618
149 Ga0207659_10403078 3300025926 Bacteria 1144
150 Ga0207687_10008864 3300025927 Bacteria 6576
151 Ga0207687_10839700 3300025927 Bacteria 784
152 Ga0207687_11087088 3300025927 Bacteria 687
153 Ga0207687_11421634 3300025927 Bacteria 596
154 Ga0207686_11252638 3300025934 Unclassified 608
155 Ga0207709_11570703 3300025935 Unclassified 546
156 Ga0207669_10435891 3300025937 Bacteria 1035
157 Ga0207691_10069552 3300025940 Bacteria 3180
158 Ga0207711_10000680 3300025941 Bacteria 33744
159 Ga0207711_10002761 3300025941 Bacteria 15466
160 Ga0207711_10026297 3300025941 Bacteria 4883
161 Ga0207711_11150328 3300025941 Bacteria 717
162 Ga0207689_11185698 3300025942 Bacteria 643
163 Ga0207661_11984575 3300025944 Unclassified 528
164 Ga0207667_11559241 3300025949 Bacteria 630
165 Ga0207651_11429729 3300025960 Unclassified 623
166 Ga0207712_10095004 3300025961 Bacteria 2203
167 Ga0207668_10083474 3300025972 Bacteria 2325
168 Ga0207677_11934392 3300026023 Bacteria 548
169 Ga0207703_10000001 3300026035 Bacteria 822925
170 Ga0207703_10000006 3300026035 Bacteria 502351
171 Ga0207703_10054587 3300026035 Bacteria 3250
172 Ga0207703_10441960 3300026035 Bacteria 1213
173 Ga0207703_10747325 3300026035 Bacteria 932
174 Ga0207678_11551691 3300026067 Bacteria 584
175 Ga0207708_10473799 3300026075 Bacteria 1046
176 Ga0207708_10578564 3300026075 Bacteria 949
177 Ga0207708_10854029 3300026075 Bacteria 786
178 Ga0207702_11046448 3300026078 Bacteria 810
179 Ga0207641_10000587 3300026088 Bacteria 39995
180 Ga0207648_10904160 3300026089 Bacteria 825
181 Ga0207648_11658125 3300026089 Unclassified 601
182 Ga0207676_10899373 3300026095 Bacteria 868
183 Ga0207674_11904437 3300026116 Bacteria 561
184 Ga0207683_11081540 3300026121 Bacteria 744
185 Ga0207698_10981983 3300026142 Bacteria 855
186 Ga0207428_10125156 3300027907 Bacteria 1969
187 Ga0207428_10133590 3300027907 Unclassified 1898
188 Ga0268265_10000161 3300028380 Bacteria 81761
189 Ga0265334_10193129 3300028573 Bacteria 709
190 Ga0265332_10000093 3300031238 Bacteria 78229
191 Ga0265328_10001656 3300031239 Bacteria 10219
192 Ga0265320_10114676 3300031240 Bacteria 1232
193 Ga0265331_10000177 3300031250 Bacteria 78211
194 Ga0265327_10048779 3300031251 Bacteria 2224
195 Ga0265327_10240661 3300031251 Bacteria 809
196 Ga0265327_10350927 3300031251 Bacteria 644
197 Ga0265316_10000142 3300031344 Bacteria 78246
198 Ga0307513_10412830 3300031456 Bacteria 1082
199 Ga0265313_10229037 3300031595 Bacteria 764
200 Ga0307508_10075875 3300031616 Unclassified 2939
201 Ga0307508_10299847 3300031616 Unclassified 1200
202 Ga0265314_10000628 3300031711 Bacteria 43413
203 Ga0265342_10007234 3300031712 Bacteria 8159
204 Ga0307510_10297085 3300033180 Bacteria 1079
205 Ga0373959_0202258 3300034820 Bacteria 525
206 Ga0373944_0223050 3300035089 Bacteria 689
207 Ga0373923_0244626 3300035111 Bacteria 839
208 Ga0373936_0315423 3300035113 Bacteria 708
209 Ga0373945_0066155 3300035116 Bacteria 1359
210 Ga0373957_0287720 3300035120 Bacteria 696
211 Ga0373943_0719809 3300035170 Unclassified 592
212 Ga0373955_0274456 3300035172 Bacteria 1014
213 Ga0373931_1065993 3300035691 Bacteria 549
214 Ga0373935_0202762 3300035692 Bacteria 1371
215 Ga0373933_0189390 3300035724 Bacteria 1314
216 Ga0373925_0223892 3300037068 Bacteria 1502
217 Ga0395898_1136264 3300037466 Bacteria 714
218 Ga0436365_1216377 3300039437 Unclassified 1122
219 Ga0436365_1755403 3300039437 Bacteria 727
220 Ga0436360_0487439 3300039438 Bacteria 917
221 Ga0451787_601279 3300041441 Bacteria 523
222 Ga0451807_0617379 3300041486 Bacteria 1387
223 Ga0466963_0081084 3300044694 Bacteria 2197
224 Ga0466959_1138857 3300045049 Bacteria 519
225 Ga0466958_0165520 3300045836 Bacteria 1399
226 Ga0466967_0025062 3300045976 Bacteria 4913
227 Ga0495653_0181536 3300046463 Bacteria 1444
228 Ga0495582_0673541 3300046473 Bacteria 599
229 Ga0495662_0183315 3300046476 Bacteria 1032
230 Ga0495608_0594624 3300046511 Bacteria 664
231 Ga0495628_0200741 3300046516 Bacteria 1503
232 Ga0495628_0433905 3300046516 Bacteria 956
233 Ga0495630_0154899 3300046517 Bacteria 1744
234 Ga0495630_0604724 3300046517 Bacteria 840
235 Ga0495666_0070604 3300046526 Bacteria 1661
236 Ga0495665_0085799 3300046531 Bacteria 1655
237 Ga0495586_0061435 3300046535 Bacteria 2045
238 Ga0495657_0119324 3300046675 Bacteria 1663
239 Ga0495658_0372146 3300046683 Bacteria 909
240 Ga0495658_1099038 3300046683 Bacteria 507
241 Ga0495613_0368926 3300046689 Unclassified 983
242 Ga0495613_0413364 3300046689 Bacteria 919
243 Ga0495624_0147087 3300046690 Bacteria 1442
244 Ga0495604_0078947 3300047317 Bacteria 2469
245 Ga0495674_0994448 3300047319 Unclassified 643
246 Ga0495676_0327911 3300047321 Bacteria 1027
247 Ga0495676_0401845 3300047321 Bacteria 909
248 Ga0495676_0532766 3300047321 Bacteria 769
249 Ga0495680_1095449 3300047322 Bacteria 503
250 Ga0495684_0389018 3300047471 Bacteria 982
251 Ga0495684_0441716 3300047471 Bacteria 906
252 Ga0495614_0223326 3300048089 Bacteria 857
253 Ga0496101_0050091 3300048904 Bacteria 3005
254 Ga0496101_0267650 3300048904 Bacteria 1334
255 Ga0496101_0471540 3300048904 Bacteria 991
256 Ga0496102_0411750 3300048905 Bacteria 1270
257 Ga0496102_1214472 3300048905 Bacteria 673
258 Ga0496104_0389235 3300048907 Bacteria 1306
259 Ga0496104_0904824 3300048907 Bacteria 787
260 Ga0496105_0013125 3300048908 Bacteria 6571
261 Ga0496105_1148371 3300048908 Bacteria 574
262 Ga0496106_0884511 3300048909 Bacteria 706
263 Ga0496106_1307816 3300048909 Unclassified 563
264 Ga0496108_1701874 3300048911 Unclassified 519
265 Ga0496109_0723677 3300048912 Unclassified 933
266 Ga0496111_0174048 3300048914 Bacteria 1600
267 Ga0496111_0964693 3300048914 Unclassified 612
268 Ga0496116_0000491 3300048919 Bacteria 54460
269 Ga0496117_0011581 3300048920 Bacteria 7886
270 Ga0496117_0019864 3300048920 Bacteria 5499
271 Ga0496118_0009258 3300048921 Bacteria 9992
272 Ga0496118_0014331 3300048921 Bacteria 7429
273 Ga0496119_0002786 3300048922 Bacteria 18744
274 Ga0496119_0010117 3300048922 Bacteria 7964
275 Ga0496120_0000401 3300048923 Bacteria 69936
276 Ga0496121_0020515 3300048924 Bacteria 6534
277 Ga0501070_0409512 3300049586 Bacteria 1096
278 Ga0501253_173303 3300049683 Unclassified 557
279 Ga0501080_0381967 3300049742 Bacteria 1269
280 nmdc:mga03n38_229943_c1 3300050490 Bacteria 972
281 nmdc:mga06z11_512503_c1 3300050494 Bacteria 727
282 nmdc:mga05p37_1039945_c1 3300050507 Bacteria 865
283 nmdc:mga05p37_1396717_c1 3300050507 Bacteria 705
284 nmdc:mga0qj67_1451613_c1 3300050509 Bacteria 528
285 nmdc:mga0qj67_314247_c1 3300050509 Bacteria 1268
286 nmdc:mga08y16_126564_c1 3300050511 Bacteria 2657
287 nmdc:mga08y16_153016_c1 3300050511 Bacteria 2397
288 nmdc:mga08y16_226579_c1 3300050511 Unclassified 1934
289 nmdc:mga08y16_3518_c1 3300050511 Bacteria 16258
290 nmdc:mga08y16_829560_c1 3300050511 Bacteria 915
291 nmdc:mga0n895_209192_c1 3300050512 Bacteria 1981
292 nmdc:mga0n895_857022_c1 3300050512 Bacteria 896
293 nmdc:mga0rr50_243195_c1 3300050513 Bacteria 1492
294 Ga0495601_0014746 3300053077 Bacteria 4717
295 Ga0495601_0059628 3300053077 Bacteria 2421
296 Ga0495601_0641743 3300053077 Bacteria 680
297 Ga0495595_0058146 3300053084 Bacteria 1805
298 Ga0495595_0662966 3300053084 Unclassified 534
299 Ga0495619_0352838 3300053085 Bacteria 1017
300 Ga0495619_0530433 3300053085 Bacteria 808
301 Ga0587066_113223 3300059490 Unclassified 632
302 Ga0587073_0279166 3300059492 Bacteria 535
303 Ga0501082_1150100 3300060353 Unclassified 678
304 2506868299 2506783011 Bacteria 5323186
305 2508677410 2508501039 Bacteria 9978592
306 2517760429 2517572101 Bacteria 6884336
307 2528202923 2527291627 Bacteria 5309833
308 2528213400 2527291629 Bacteria 5267418
309 2546947839 2546825537 Bacteria 5389291
310 2579749546 2576861822 Bacteria 5004595
311 2579855730 2579778521 Bacteria 7624758
312 2619857506 2619618881 Bacteria 7521104
313 2620348192 2619619003 Bacteria 7619552
314 2626635245 2626541554 Bacteria 7741902
315 2671839958 2671180195 Bacteria 9757215
316 2676200142 2675902999 Bacteria 9438463
317 2686535374 2684623035 Bacteria 8032739
318 2686542606 2684623036 Bacteria 5199090
319 2689960288 2687453737 Bacteria 11203906
320 2689990754 2687453743 Bacteria 8361025
321 2710602389 2710264753 Bacteria 5455564
322 2774844720 2773857921 Bacteria 9435764
323 2774858114 2773857922 Bacteria 9757215
324 2774864592 2773857924 Bacteria 5256821
325 2774902694 2773857933 Bacteria 5818019
326 2895887056 2895880812 Bacteria 11255272
327 637880950 637000116 Bacteria 5433628
328 8002777986 8002775197 Bacteria 10728764
329 8002790693 8002784119 Bacteria 9788632
330 8054915300 8054913762 Bacteria 7713009
331 8054925912 8054920844 Bacteria 7068637
332 8055162969 8055157932 Bacteria 6429399
333 Ga0070699_101101894
334 JGI25405J52794_10011868
335 Ga0065715_10540223
336 Ga0070658_10246980
337 Ga0070683_100810088
338 Ga0070690_100417825
339 Ga0068869_101480747
340 Ga0068868_102144337
341 Ga0070687_100330299
342 Ga0070687_100842537
343 Ga0070692_10370816
344 Ga0070668_100205734
345 Ga0070669_101980965
346 Ga0070675_100256994
347 Ga0070675_100441242
348 Ga0070671_100295705
349 Ga0070671_101735236
350 Ga0070674_100179347
351 Ga0070673_101162702
352 Ga0070673_102046956
353 Ga0070688_101295164
354 Ga0070713_101193916
355 Ga0070711_100692037
356 Ga0070711_101303196
357 Ga0070705_100101225
358 Ga0070705_100506919
359 Ga0070700_100692753
360 Ga0070700_101192551
361 Ga0070694_100005876
362 Ga0070694_100660270
363 Ga0070708_101047283
364 Ga0070663_101744568
365 Ga0070678_101197688
366 Ga0070681_11166334
367 Ga0068867_100729690
368 Ga0068867_101704617
369 Ga0070685_10364649
370 Ga0070685_10487239
371 Ga0070707_100076399
372 Ga0070707_100378029
373 Ga0070707_101584809
374 Ga0070698_100026823
375 Ga0070698_100231700
376 Ga0070672_100066475
377 Ga0070686_100096490
378 Ga0070686_100563083
379 Ga0070695_100373688
380 Ga0070693_100625269
381 Ga0070704_100027634
382 Ga0070704_100651359
383 Ga0070704_101835811
384 Ga0070704_101852013
385 Ga0068854_100676011
386 Ga0068854_101895280
387 Ga0068856_100630600
388 Ga0070702_100641042
389 Ga0068859_100000103
390 Ga0068859_100025493
391 Ga0068859_101431859
392 Ga0068859_102117533
393 Ga0068864_100699185
394 Ga0068863_100068581
395 Ga0068858_100000002
396 Ga0068858_100000767
397 Ga0068858_100004361
398 Ga0068858_100871318
399 Ga0068862_100000232
400 Ga0081455_10000023
401 Ga0081455_10413148
402 Ga0070712_100420942
403 Ga0070712_101059052
404 Ga0075367_10285426
405 Ga0075431_101648558
406 Ga0075434_100192498
407 Ga0075434_100411845
408 Ga0075434_100930392
409 Ga0075429_100940307
410 Ga0097620_100000103
411 Ga0097620_100025493
412 Ga0097620_101431984
413 Ga0097620_102117746
414 Ga0075435_100353789
415 Ga0075435_101882333
416 Ga0105251_10623747
417 Ga0105240_11947274
418 Ga0111539_10015954
419 Ga0111539_10247890
420 Ga0111539_10305366
421 Ga0111539_10521125
422 Ga0111539_10977032
423 Ga0111539_11002691
424 Ga0111539_11171556
425 Ga0105245_10175689
426 Ga0105245_10461235
427 Ga0105245_10789990
428 Ga0105245_11269702
429 Ga0105247_10000014
430 Ga0105247_10001869
431 Ga0105247_11357786
432 Ga0114129_11191726
433 Ga0114129_11327233
434 Ga0105243_10180431
435 Ga0105243_11125089
436 Ga0105242_10312252
437 Ga0105242_10490009
438 Ga0105248_10000038
439 Ga0105248_10000950
440 Ga0105248_10002916
441 Ga0105248_10770590
442 Ga0105248_12709084
443 Ga0105238_12308387
444 Ga0105249_10155317
445 Ga0105249_10808374
446 Ga0105249_11775426
447 Ga0105249_11777398
448 Ga0105239_10015471
449 Ga0105239_12240060
450 Ga0105246_12227068
451 Ga0163162_10271792
452 Ga0163162_10353000
453 Ga0163162_13279043
454 Ga0157372_12283517
455 Ga0163163_10009501
456 Ga0163163_10024407
457 Ga0163163_10305428
458 Ga0163163_11283346
459 Ga0163163_13007110
460 Ga0157380_10510829
461 Ga0157380_12087553
462 Ga0157380_12544761
463 Ga0157379_10000007
464 Ga0157379_10007125
465 Ga0157379_11095471
466 Ga0157379_11727278
467 Ga0163161_11513971
468 Ga0206356_10523478
469 Ga0206356_10739479
470 Ga0206354_10772984
471 Ga0207710_10000020
472 Ga0207710_10000031
473 Ga0207710_10257717
474 Ga0207688_10326179
475 Ga0207693_10319502
476 Ga0207663_11530593
477 Ga0207646_10434958
478 Ga0207646_11506882
479 Ga0207646_11682516
480 Ga0207694_11286753
481 Ga0207659_10403078
482 Ga0207687_10008864
483 Ga0207687_10839700
484 Ga0207687_11087088
485 Ga0207687_11421634
486 Ga0207686_11252638
487 Ga0207709_11570703
488 Ga0207669_10435891
489 Ga0207691_10069552
490 Ga0207711_10000680
491 Ga0207711_10002761
492 Ga0207711_10026297
493 Ga0207711_11150328
494 Ga0207689_11185698
495 Ga0207661_11984575
496 Ga0207667_11559241
497 Ga0207651_11429729
498 Ga0207712_10095004
499 Ga0207668_10083474
500 Ga0207677_11934392
501 Ga0207703_10000001
502 Ga0207703_10000006
503 Ga0207703_10054587
504 Ga0207703_10441960
505 Ga0207703_10747325
506 Ga0207678_11551691
507 Ga0207708_10473799
508 Ga0207708_10578564
509 Ga0207708_10854029
510 Ga0207702_11046448
511 Ga0207641_10000587
512 Ga0207648_10904160
513 Ga0207648_11658125
514 Ga0207676_10899373
515 Ga0207674_11904437
516 Ga0207683_11081540
517 Ga0207698_10981983
518 Ga0207428_10125156
519 Ga0207428_10133590
520 Ga0268265_10000161
521 Ga0265334_10193129
522 Ga0265332_10000093
523 Ga0265328_10001656
524 Ga0265320_10114676
525 Ga0265331_10000177
526 Ga0265327_10048779
527 Ga0265327_10240661
528 Ga0265327_10350927
529 Ga0265316_10000142
530 Ga0307513_10412830
531 Ga0265313_10229037
532 Ga0307508_10075875
533 Ga0307508_10299847
534 Ga0265314_10000628
535 Ga0265342_10007234
536 Ga0307510_10297085
537 Ga0373959_0202258
538 Ga0373944_0223050
539 Ga0373923_0244626
540 Ga0373936_0315423
541 Ga0373945_0066155
542 Ga0373957_0287720
543 Ga0373943_0719809
544 Ga0373955_0274456
545 Ga0373931_1065993
546 Ga0373935_0202762
547 Ga0373933_0189390
548 Ga0373925_0223892
549 Ga0395898_1136264
550 Ga0436365_1216377
551 Ga0436365_1755403
552 Ga0436360_0487439
553 Ga0451787_601279
554 Ga0451807_0617379
555 Ga0466963_0081084
556 Ga0466959_1138857
557 Ga0466958_0165520
558 Ga0466967_0025062
559 Ga0495653_0181536
560 Ga0495582_0673541
561 Ga0495662_0183315
562 Ga0495608_0594624
563 Ga0495628_0200741
564 Ga0495628_0433905
565 Ga0495630_0154899
566 Ga0495630_0604724
567 Ga0495666_0070604
568 Ga0495665_0085799
569 Ga0495586_0061435
570 Ga0495657_0119324
571 Ga0495658_0372146
572 Ga0495658_1099038
573 Ga0495613_0368926
574 Ga0495613_0413364
575 Ga0495624_0147087
576 Ga0495604_0078947
577 Ga0495674_0994448
578 Ga0495676_0327911
579 Ga0495676_0401845
580 Ga0495676_0532766
581 Ga0495680_1095449
582 Ga0495684_0389018
583 Ga0495684_0441716
584 Ga0495614_0223326
585 Ga0496101_0050091
586 Ga0496101_0267650
587 Ga0496101_0471540
588 Ga0496102_0411750
589 Ga0496102_1214472
590 Ga0496104_0389235
591 Ga0496104_0904824
592 Ga0496105_0013125
593 Ga0496105_1148371
594 Ga0496106_0884511
595 Ga0496106_1307816
596 Ga0496108_1701874
597 Ga0496109_0723677
598 Ga0496111_0174048
599 Ga0496111_0964693
600 Ga0496116_0000491
601 Ga0496117_0011581
602 Ga0496117_0019864
603 Ga0496118_0009258
604 Ga0496118_0014331
605 Ga0496119_0002786
606 Ga0496119_0010117
607 Ga0496120_0000401
608 Ga0496121_0020515
609 Ga0501070_0409512
610 Ga0501253_173303
611 Ga0501080_0381967
612 nmdc:mga03n38_229943_c1
613 nmdc:mga06z11_512503_c1
614 nmdc:mga05p37_1039945_c1
615 nmdc:mga05p37_1396717_c1
616 nmdc:mga0qj67_1451613_c1
617 nmdc:mga0qj67_314247_c1
618 nmdc:mga08y16_126564_c1
619 nmdc:mga08y16_153016_c1
620 nmdc:mga08y16_226579_c1
621 nmdc:mga08y16_3518_c1
622 nmdc:mga08y16_829560_c1
623 nmdc:mga0n895_209192_c1
624 nmdc:mga0n895_857022_c1
625 nmdc:mga0rr50_243195_c1
626 Ga0495601_0014746
627 Ga0495601_0059628
628 Ga0495601_0641743
629 Ga0495595_0058146
630 Ga0495595_0662966
631 Ga0495619_0352838
632 Ga0495619_0530433
633 Ga0587066_113223
634 Ga0587073_0279166
635 Ga0501082_1150100
636 2506868299
637 2508677410
638 2517760429
639 2528202923
640 2528213400
641 2546947839
642 2579749546
643 2579855730
644 2619857506
645 2620348192
646 2626635245
647 2671839958
648 2676200142
649 2686535374
650 2686542606
651 2689960288
652 2689990754
653 2710602389
654 2774844720
655 2774858114
656 2774864592
657 2774902694
658 2895887056
659 637880950
660 8002777986
661 8002790693
662 8054915300
663 8054925912
664 8055162969

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map