F410814

General Info

Members Datasets Scaffolds Average Seq Length
332 192 664 66

Family's Representative Sequence

Representative Sequence 3300005353|Ga0070669_101863868|Ga0070669_1018638682
Length 80
Sequence LSRRATPFAKGREMIDRSKLSNSFEFVVTAGARARQLMAGSVPRVTVGEHKKTTVAQQEVVTRAVEKIETVNEKEKPASE

Samples

Sample ID Description Type Environment
1 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
132 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
133 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
136 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
150 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
151 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
157 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
158 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
169 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
170 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
181 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
182 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
190 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
191 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
192 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.81
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 16.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070669_101863868 3300005353 Unclassified 525
2 Ga0058859_11550709 3300004798 Unclassified 730
3 Ga0065715_10536273 3300005293 Unclassified 752
4 Ga0070683_100305662 3300005329 Bacteria 1513
5 Ga0070690_100342329 3300005330 Bacteria 1083
6 Ga0070670_100148496 3300005331 Bacteria 2028
7 Ga0070670_100402009 3300005331 Unclassified 1209
8 Ga0070670_100719892 3300005331 Unclassified 898
9 Ga0070670_101040119 3300005331 Bacteria 745
10 Ga0070670_101187398 3300005331 Bacteria 697
11 Ga0070677_10073549 3300005333 Bacteria 1444
12 Ga0070666_11177374 3300005335 Bacteria 571
13 Ga0068868_100228352 3300005338 Bacteria 1561
14 Ga0070660_100606005 3300005339 Bacteria 916
15 Ga0070689_100175040 3300005340 Bacteria 1740
16 Ga0070687_100950186 3300005343 Bacteria 620
17 Ga0070668_101843459 3300005347 Bacteria 557
18 Ga0070669_100300202 3300005353 Bacteria 1291
19 Ga0070669_100475607 3300005353 Bacteria 1033
20 Ga0070669_100516018 3300005353 Bacteria 993
21 Ga0070669_100573742 3300005353 Bacteria 943
22 Ga0070675_100239591 3300005354 Bacteria 1585
23 Ga0070675_101383025 3300005354 Bacteria 649
24 Ga0070675_101806613 3300005354 Unclassified 564
25 Ga0070671_101123509 3300005355 Bacteria 690
26 Ga0070674_100001878 3300005356 Bacteria 11409
27 Ga0070674_100111600 3300005356 Bacteria 2008
28 Ga0070673_100058883 3300005364 Bacteria 3039
29 Ga0070673_100673922 3300005364 Bacteria 948
30 Ga0070673_101533943 3300005364 Bacteria 629
31 Ga0070713_101560418 3300005436 Bacteria 641
32 Ga0070700_102025474 3300005441 Unclassified 500
33 Ga0070708_101007435 3300005445 Bacteria 781
34 Ga0070678_100013841 3300005456 Bacteria 5071
35 Ga0070662_101862146 3300005457 Bacteria 520
36 Ga0070681_10112445 3300005458 Bacteria 2663
37 Ga0068867_100118928 3300005459 Bacteria 2039
38 Ga0068867_100165449 3300005459 Bacteria 1747
39 Ga0068867_100383855 3300005459 Bacteria 1181
40 Ga0068867_100478980 3300005459 Bacteria 1066
41 Ga0070685_10150536 3300005466 Bacteria 1474
42 Ga0070706_100518335 3300005467 Bacteria 1109
43 Ga0070679_100236124 3300005530 Bacteria 1787
44 Ga0070684_100931717 3300005535 Bacteria 814
45 Ga0070684_101734190 3300005535 Unclassified 589
46 Ga0070697_101303950 3300005536 Bacteria 648
47 Ga0070697_101314457 3300005536 Bacteria 645
48 Ga0070672_100188025 3300005543 Bacteria 1723
49 Ga0070672_100447144 3300005543 Bacteria 1113
50 Ga0070686_100741937 3300005544 Bacteria 787
51 Ga0070686_100966438 3300005544 Bacteria 697
52 Ga0070695_101680581 3300005545 Bacteria 531
53 Ga0070696_100030999 3300005546 Bacteria 3663
54 Ga0070696_100831397 3300005546 Bacteria 762
55 Ga0070665_100022925 3300005548 Bacteria 6286
56 Ga0070665_100814127 3300005548 Bacteria 947
57 Ga0070665_101725651 3300005548 Unclassified 633
58 Ga0070704_100221461 3300005549 Bacteria 1539
59 Ga0068855_101006873 3300005563 Bacteria 875
60 Ga0070664_100903050 3300005564 Bacteria 828
61 Ga0068857_101717069 3300005577 Bacteria 614
62 Ga0068854_101610861 3300005578 Unclassified 592
63 Ga0068856_102720415 3300005614 Unclassified 500
64 Ga0070702_101607949 3300005615 Bacteria 538
65 Ga0068852_101025424 3300005616 Bacteria 844
66 Ga0068852_101377982 3300005616 Unclassified 727
67 Ga0068859_100032324 3300005617 Bacteria 5256
68 Ga0068859_100056019 3300005617 Bacteria 3967
69 Ga0068859_100231994 3300005617 Bacteria 1934
70 Ga0068859_100388649 3300005617 Bacteria 1491
71 Ga0068859_102091628 3300005617 Bacteria 625
72 Ga0068859_102378669 3300005617 Bacteria 584
73 Ga0068859_102613674 3300005617 Unclassified 555
74 Ga0068864_100030949 3300005618 Bacteria 4538
75 Ga0068864_101737928 3300005618 Bacteria 629
76 Ga0068866_10015394 3300005718 Bacteria 3397
77 Ga0068866_10220161 3300005718 Bacteria 1145
78 Ga0068866_10659997 3300005718 Bacteria 713
79 Ga0068866_10781146 3300005718 Bacteria 662
80 Ga0068866_11401719 3300005718 Unclassified 511
81 Ga0068861_100021144 3300005719 Bacteria 4676
82 Ga0068861_101617984 3300005719 Bacteria 638
83 Ga0068863_100416006 3300005841 Bacteria 1316
84 Ga0068858_100207075 3300005842 Bacteria 1856
85 Ga0068858_100508034 3300005842 Bacteria 1165
86 Ga0068858_100841467 3300005842 Bacteria 896
87 Ga0068858_102520148 3300005842 Bacteria 508
88 Ga0068860_100239686 3300005843 Bacteria 1764
89 Ga0068860_100356780 3300005843 Bacteria 1440
90 Ga0068860_101403272 3300005843 Bacteria 720
91 Ga0068860_101650093 3300005843 Bacteria 663
92 Ga0068862_101269623 3300005844 Bacteria 737
93 Ga0075432_10529978 3300006058 Bacteria 529
94 Ga0070715_10737262 3300006163 Bacteria 592
95 Ga0070716_100603864 3300006173 Bacteria 826
96 Ga0097621_100070147 3300006237 Bacteria 2894
97 Ga0097621_100134028 3300006237 Bacteria 2111
98 Ga0068871_100118937 3300006358 Bacteria 2230
99 Ga0068871_100723769 3300006358 Bacteria 913
100 Ga0068871_101405530 3300006358 Unclassified 658
101 Ga0068871_101548635 3300006358 Bacteria 627
102 Ga0068871_102113709 3300006358 Viruses 536
103 Ga0075430_100986260 3300006846 Bacteria 694
104 Ga0075431_100072027 3300006847 Bacteria 3566
105 Ga0075433_10502350 3300006852 Bacteria 1067
106 Ga0075433_10861794 3300006852 Bacteria 790
107 Ga0075434_100988125 3300006871 Bacteria 856
108 Ga0075434_102038428 3300006871 Bacteria 579
109 Ga0075429_100135997 3300006880 Bacteria 2151
110 Ga0075429_100678940 3300006880 Bacteria 902
111 Ga0068865_100135847 3300006881 Bacteria 1848
112 Ga0068865_100416525 3300006881 Bacteria 1103
113 Ga0075436_100003762 3300006914 Bacteria 10403
114 Ga0075436_100035875 3300006914 Bacteria 3420
115 Ga0097620_100032326 3300006931 Bacteria 5256
116 Ga0097620_100056017 3300006931 Bacteria 3967
117 Ga0097620_100231987 3300006931 Bacteria 1934
118 Ga0097620_100388646 3300006931 Bacteria 1491
119 Ga0097620_101975592 3300006931 Bacteria 644
120 Ga0097620_102091686 3300006931 Bacteria 625
121 Ga0097620_102378248 3300006931 Bacteria 584
122 Ga0097620_102613812 3300006931 Unclassified 555
123 Ga0075435_100000011 3300007076 Bacteria 110108
124 Ga0075435_100067422 3300007076 Unclassified 2914
125 Ga0075435_100084977 3300007076 Bacteria 2605
126 Ga0105240_10345179 3300009093 Bacteria 1690
127 Ga0111539_10640194 3300009094 Bacteria 1238
128 Ga0111539_11024994 3300009094 Bacteria 959
129 Ga0105245_10037847 3300009098 Bacteria 4289
130 Ga0105245_11342445 3300009098 Bacteria 764
131 Ga0105247_10544602 3300009101 Bacteria 852
132 Ga0105247_10871268 3300009101 Unclassified 693
133 Ga0114129_10039445 3300009147 Bacteria 6658
134 Ga0114129_10153706 3300009147 Bacteria 3148
135 Ga0105243_10793859 3300009148 Bacteria 932
136 Ga0105243_11400355 3300009148 Bacteria 720
137 Ga0105242_10055425 3300009176 Bacteria 3243
138 Ga0105242_10150119 3300009176 Bacteria 2031
139 Ga0105242_10863203 3300009176 Bacteria 902
140 Ga0105242_11562640 3300009176 Bacteria 692
141 Ga0105248_10028280 3300009177 Bacteria 6245
142 Ga0105248_10085202 3300009177 Bacteria 3556
143 Ga0105248_10156206 3300009177 Bacteria 2574
144 Ga0105248_10236427 3300009177 Bacteria 2057
145 Ga0105248_10529915 3300009177 Bacteria 1328
146 Ga0105248_10631367 3300009177 Bacteria 1209
147 Ga0105238_10904766 3300009551 Unclassified 901
148 Ga0105238_12025196 3300009551 Bacteria 609
149 Ga0105249_10898432 3300009553 Bacteria 953
150 Ga0105249_11997617 3300009553 Bacteria 653
151 Ga0105249_13443594 3300009553 Bacteria 509
152 Ga0105246_10453714 3300011119 Bacteria 1078
153 Ga0157374_10680836 3300013296 Bacteria 1041
154 Ga0157374_12176999 3300013296 Unclassified 581
155 Ga0157378_10461604 3300013297 Bacteria 1262
156 Ga0157378_11119802 3300013297 Unclassified 825
157 Ga0157378_11233534 3300013297 Bacteria 788
158 Ga0157378_12261092 3300013297 Unclassified 595
159 Ga0157378_12889802 3300013297 Bacteria 533
160 Ga0163162_11074276 3300013306 Bacteria 911
161 Ga0157375_10640932 3300013308 Bacteria 1219
162 Ga0157375_11395123 3300013308 Unclassified 825
163 Ga0157375_11655879 3300013308 Bacteria 757
164 Ga0157375_12296769 3300013308 Bacteria 643
165 Ga0163163_10036868 3300014325 Bacteria 4752
166 Ga0163163_10783659 3300014325 Bacteria 1017
167 Ga0163163_11708413 3300014325 Unclassified 690
168 Ga0163163_11851581 3300014325 Bacteria 664
169 Ga0157380_10021474 3300014326 Bacteria 4842
170 Ga0157380_10232701 3300014326 Bacteria 1656
171 Ga0157379_11498479 3300014968 Bacteria 656
172 Ga0157379_11522657 3300014968 Unclassified 651
173 Ga0157379_12040143 3300014968 Unclassified 567
174 Ga0157376_10183635 3300014969 Bacteria 1914
175 Ga0157376_10343475 3300014969 Bacteria 1426
176 Ga0157376_12653705 3300014969 Unclassified 541
177 Ga0163161_10262797 3300017792 Bacteria 1348
178 Ga0207682_10027219 3300025893 Bacteria 2276
179 Ga0207642_10037148 3300025899 Bacteria 2096
180 Ga0207710_10381166 3300025900 Bacteria 722
181 Ga0207688_10491550 3300025901 Unclassified 768
182 Ga0207688_10599940 3300025901 Bacteria 694
183 Ga0207685_10488273 3300025905 Bacteria 646
184 Ga0207699_10285786 3300025906 Bacteria 1147
185 Ga0207645_10833783 3300025907 Bacteria 627
186 Ga0207707_10253971 3300025912 Bacteria 1527
187 Ga0207695_10082025 3300025913 Bacteria 3262
188 Ga0207657_10933462 3300025919 Bacteria 668
189 Ga0207649_10496090 3300025920 Unclassified 928
190 Ga0207681_10230899 3300025923 Bacteria 1436
191 Ga0207681_10518695 3300025923 Bacteria 978
192 Ga0207694_11010462 3300025924 Unclassified 704
193 Ga0207650_10133741 3300025925 Bacteria 1943
194 Ga0207650_10274355 3300025925 Bacteria 1371
195 Ga0207650_10284706 3300025925 Bacteria 1347
196 Ga0207650_10507944 3300025925 Bacteria 1008
197 Ga0207650_11538036 3300025925 Unclassified 565
198 Ga0207659_10060926 3300025926 Bacteria 2718
199 Ga0207659_10331078 3300025926 Bacteria 1259
200 Ga0207687_11232588 3300025927 Bacteria 643
201 Ga0207687_11239251 3300025927 Bacteria 641
202 Ga0207687_11759743 3300025927 Bacteria 531
203 Ga0207644_10150630 3300025931 Bacteria 1800
204 Ga0207644_11641980 3300025931 Unclassified 539
205 Ga0207706_10647474 3300025933 Bacteria 905
206 Ga0207686_10581406 3300025934 Bacteria 879
207 Ga0207686_10788444 3300025934 Bacteria 761
208 Ga0207686_10796810 3300025934 Bacteria 757
209 Ga0207709_10060460 3300025935 Bacteria 2362
210 Ga0207670_10210118 3300025936 Bacteria 1484
211 Ga0207669_10271277 3300025937 Bacteria 1274
212 Ga0207669_10452374 3300025937 Bacteria 1018
213 Ga0207669_11063305 3300025937 Unclassified 682
214 Ga0207704_10548774 3300025938 Bacteria 939
215 Ga0207665_10194875 3300025939 Bacteria 1474
216 Ga0207691_10198920 3300025940 Bacteria 1745
217 Ga0207711_10364043 3300025941 Bacteria 1340
218 Ga0207711_10413751 3300025941 Bacteria 1254
219 Ga0207711_10445880 3300025941 Bacteria 1205
220 Ga0207711_10569178 3300025941 Bacteria 1057
221 Ga0207711_10775813 3300025941 Bacteria 893
222 Ga0207711_11016761 3300025941 Bacteria 769
223 Ga0207689_11664266 3300025942 Bacteria 530
224 Ga0207661_10920876 3300025944 Unclassified 805
225 Ga0207679_10268940 3300025945 Bacteria 1457
226 Ga0207667_10242157 3300025949 Bacteria 1846
227 Ga0207651_10051771 3300025960 Bacteria 2796
228 Ga0207651_10469197 3300025960 Bacteria 1083
229 Ga0207651_11036062 3300025960 Bacteria 734
230 Ga0207712_10813684 3300025961 Unclassified 822
231 Ga0207712_10822816 3300025961 Bacteria 817
232 Ga0207712_11587184 3300025961 Bacteria 586
233 Ga0207640_10910906 3300025981 Unclassified 768
234 Ga0207658_11354110 3300025986 Bacteria 651
235 Ga0207677_11168166 3300026023 Unclassified 704
236 Ga0207708_11907568 3300026075 Bacteria 521
237 Ga0207641_10418345 3300026088 Bacteria 1290
238 Ga0207648_10096490 3300026089 Bacteria 2587
239 Ga0207648_10150480 3300026089 Bacteria 2053
240 Ga0207648_10283896 3300026089 Bacteria 1481
241 Ga0207648_10323962 3300026089 Unclassified 1385
242 Ga0207648_10994564 3300026089 Bacteria 785
243 Ga0207676_10071824 3300026095 Bacteria 2780
244 Ga0207676_10640192 3300026095 Bacteria 1025
245 Ga0207674_10102707 3300026116 Bacteria 2838
246 Ga0207674_11304028 3300026116 Bacteria 696
247 Ga0207675_100041127 3300026118 Bacteria 4317
248 Ga0207675_100879002 3300026118 Bacteria 912
249 Ga0207675_101348317 3300026118 Unclassified 734
250 Ga0207683_10002712 3300026121 Bacteria 15458
251 Ga0207683_10249989 3300026121 Bacteria 1618
252 Ga0207683_11460135 3300026121 Unclassified 632
253 Ga0207698_10398019 3300026142 Bacteria 1315
254 Ga0268266_10314538 3300028379 Bacteria 1464
255 Ga0268265_10469898 3300028380 Bacteria 1179
256 Ga0268265_10992452 3300028380 Bacteria 829
257 Ga0268265_11178073 3300028380 Bacteria 763
258 Ga0268264_10180859 3300028381 Bacteria 1915
259 Ga0268264_11276632 3300028381 Bacteria 744
260 Ga0373958_0000724 3300034819 Bacteria 4191
261 Ga0373938_0060716 3300034957 Bacteria 883
262 Ga0373929_0028392 3300035085 Bacteria 1181
263 Ga0373940_0003441 3300035088 Bacteria 3233
264 Ga0373949_0000731 3300035090 Bacteria 10636
265 Ga0373952_0008743 3300035092 Bacteria 1925
266 Ga0373932_0001650 3300035112 Bacteria 6113
267 Ga0373939_0000435 3300035114 Bacteria 10508
268 Ga0373960_0000124 3300035121 Bacteria 12499
269 Ga0373946_0359459 3300035171 Bacteria 729
270 Ga0373955_0363162 3300035172 Bacteria 878
271 Ga0373955_0541832 3300035172 Bacteria 712
272 Ga0373942_0000088 3300035207 Bacteria 19936
273 Ga0373961_0001050 3300035241 Bacteria 8912
274 Ga0373962_0002687 3300035242 Bacteria 4231
275 Ga0373924_0133693 3300035410 Unclassified 1080
276 Ga0373935_0278314 3300035692 Bacteria 1178
277 Ga0373937_1473871 3300036401 Bacteria 628
278 Ga0373925_0500323 3300037068 Bacteria 998
279 Ga0373925_0538531 3300037068 Bacteria 960
280 Ga0439435_0258557 3300042436 Bacteria 588
281 Ga0451576_0176485 3300045051 Bacteria 2231
282 Ga0451576_0371917 3300045051 Bacteria 1497
283 Ga0495592_0158286 3300046454 Bacteria 1561
284 Ga0495592_0508229 3300046454 Unclassified 747
285 Ga0495651_0557191 3300046462 Unclassified 727
286 Ga0495664_0256755 3300046477 Bacteria 1057
287 Ga0495628_0303278 3300046516 Unclassified 1182
288 Ga0495628_0933840 3300046516 Unclassified 600
289 Ga0495630_0378225 3300046517 Bacteria 1085
290 Ga0495640_0086198 3300046533 Unclassified 2080
291 Ga0495586_0093279 3300046535 Bacteria 1665
292 Ga0495586_0720913 3300046535 Unclassified 576
293 Ga0495587_0027048 3300046536 Bacteria 3494
294 Ga0495634_0624987 3300046642 Bacteria 624
295 Ga0495599_0129131 3300046678 Bacteria 1570
296 Ga0495599_0868791 3300046678 Unclassified 512
297 Ga0495623_0182765 3300046679 Bacteria 1217
298 Ga0495613_0124435 3300046689 Bacteria 1850
299 Ga0495600_0537531 3300046809 Unclassified 715
300 Ga0495674_0900362 3300047319 Bacteria 683
301 Ga0495680_0946288 3300047322 Bacteria 554
302 Ga0495684_0501974 3300047471 Unclassified 834
303 Ga0495614_0632358 3300048089 Unclassified 515
304 Ga0496100_1109717 3300048903 Bacteria 623
305 Ga0496101_1473671 3300048904 Unclassified 530
306 Ga0496102_0763325 3300048905 Bacteria 890
307 Ga0496106_0689663 3300048909 Bacteria 814
308 Ga0496106_0970208 3300048909 Bacteria 669
309 Ga0496109_0859721 3300048912 Bacteria 845
310 Ga0501034_1199674 3300049571 Bacteria 638
311 Ga0501043_0299507 3300049579 Bacteria 1229
312 Ga0501047_0123896 3300049581 Bacteria 2465
313 Ga0501048_0838732 3300049582 Bacteria 661
314 Ga0501073_0300788 3300049589 Bacteria 1107
315 Ga0501249_147855 3300049679 Unclassified 589
316 Ga0501083_0375461 3300049744 Bacteria 925
317 Ga0501044_0016644 3300049823 Bacteria 7895
318 nmdc:mga05p37_125588_c1 3300050507 Bacteria 3151
319 nmdc:mga09592_130578_c1 3300050508 Bacteria 2161
320 nmdc:mga09592_378433_c1 3300050508 Bacteria 1224
321 nmdc:mga06r32_138509_c1 3300050510 Bacteria 2408
322 nmdc:mga08y16_159097_c1 3300050511 Bacteria 2347
323 nmdc:mga0n895_579983_c1 3300050512 Bacteria 1125
324 nmdc:mga0rr50_204997_c1 3300050513 Unclassified 1622
325 nmdc:mga08x19_41801_c1 3300050514 Bacteria 2920
326 nmdc:mga0a205_146929_c1 3300050515 Bacteria 2258
327 Ga0495601_0107634 3300053077 Bacteria 1804
328 Ga0495612_0333918 3300053078 Bacteria 683
329 Ga0495595_0164609 3300053084 Bacteria 1096
330 Ga0495619_0107419 3300053085 Unclassified 1904
331 Ga0495619_0205176 3300053085 Bacteria 1364
332 Ga0495619_0715816 3300053085 Bacteria 680
333 Ga0070669_101863868
334 Ga0058859_11550709
335 Ga0065715_10536273
336 Ga0070683_100305662
337 Ga0070690_100342329
338 Ga0070670_100148496
339 Ga0070670_100402009
340 Ga0070670_100719892
341 Ga0070670_101040119
342 Ga0070670_101187398
343 Ga0070677_10073549
344 Ga0070666_11177374
345 Ga0068868_100228352
346 Ga0070660_100606005
347 Ga0070689_100175040
348 Ga0070687_100950186
349 Ga0070668_101843459
350 Ga0070669_100300202
351 Ga0070669_100475607
352 Ga0070669_100516018
353 Ga0070669_100573742
354 Ga0070675_100239591
355 Ga0070675_101383025
356 Ga0070675_101806613
357 Ga0070671_101123509
358 Ga0070674_100001878
359 Ga0070674_100111600
360 Ga0070673_100058883
361 Ga0070673_100673922
362 Ga0070673_101533943
363 Ga0070713_101560418
364 Ga0070700_102025474
365 Ga0070708_101007435
366 Ga0070678_100013841
367 Ga0070662_101862146
368 Ga0070681_10112445
369 Ga0068867_100118928
370 Ga0068867_100165449
371 Ga0068867_100383855
372 Ga0068867_100478980
373 Ga0070685_10150536
374 Ga0070706_100518335
375 Ga0070679_100236124
376 Ga0070684_100931717
377 Ga0070684_101734190
378 Ga0070697_101303950
379 Ga0070697_101314457
380 Ga0070672_100188025
381 Ga0070672_100447144
382 Ga0070686_100741937
383 Ga0070686_100966438
384 Ga0070695_101680581
385 Ga0070696_100030999
386 Ga0070696_100831397
387 Ga0070665_100022925
388 Ga0070665_100814127
389 Ga0070665_101725651
390 Ga0070704_100221461
391 Ga0068855_101006873
392 Ga0070664_100903050
393 Ga0068857_101717069
394 Ga0068854_101610861
395 Ga0068856_102720415
396 Ga0070702_101607949
397 Ga0068852_101025424
398 Ga0068852_101377982
399 Ga0068859_100032324
400 Ga0068859_100056019
401 Ga0068859_100231994
402 Ga0068859_100388649
403 Ga0068859_102091628
404 Ga0068859_102378669
405 Ga0068859_102613674
406 Ga0068864_100030949
407 Ga0068864_101737928
408 Ga0068866_10015394
409 Ga0068866_10220161
410 Ga0068866_10659997
411 Ga0068866_10781146
412 Ga0068866_11401719
413 Ga0068861_100021144
414 Ga0068861_101617984
415 Ga0068863_100416006
416 Ga0068858_100207075
417 Ga0068858_100508034
418 Ga0068858_100841467
419 Ga0068858_102520148
420 Ga0068860_100239686
421 Ga0068860_100356780
422 Ga0068860_101403272
423 Ga0068860_101650093
424 Ga0068862_101269623
425 Ga0075432_10529978
426 Ga0070715_10737262
427 Ga0070716_100603864
428 Ga0097621_100070147
429 Ga0097621_100134028
430 Ga0068871_100118937
431 Ga0068871_100723769
432 Ga0068871_101405530
433 Ga0068871_101548635
434 Ga0068871_102113709
435 Ga0075430_100986260
436 Ga0075431_100072027
437 Ga0075433_10502350
438 Ga0075433_10861794
439 Ga0075434_100988125
440 Ga0075434_102038428
441 Ga0075429_100135997
442 Ga0075429_100678940
443 Ga0068865_100135847
444 Ga0068865_100416525
445 Ga0075436_100003762
446 Ga0075436_100035875
447 Ga0097620_100032326
448 Ga0097620_100056017
449 Ga0097620_100231987
450 Ga0097620_100388646
451 Ga0097620_101975592
452 Ga0097620_102091686
453 Ga0097620_102378248
454 Ga0097620_102613812
455 Ga0075435_100000011
456 Ga0075435_100067422
457 Ga0075435_100084977
458 Ga0105240_10345179
459 Ga0111539_10640194
460 Ga0111539_11024994
461 Ga0105245_10037847
462 Ga0105245_11342445
463 Ga0105247_10544602
464 Ga0105247_10871268
465 Ga0114129_10039445
466 Ga0114129_10153706
467 Ga0105243_10793859
468 Ga0105243_11400355
469 Ga0105242_10055425
470 Ga0105242_10150119
471 Ga0105242_10863203
472 Ga0105242_11562640
473 Ga0105248_10028280
474 Ga0105248_10085202
475 Ga0105248_10156206
476 Ga0105248_10236427
477 Ga0105248_10529915
478 Ga0105248_10631367
479 Ga0105238_10904766
480 Ga0105238_12025196
481 Ga0105249_10898432
482 Ga0105249_11997617
483 Ga0105249_13443594
484 Ga0105246_10453714
485 Ga0157374_10680836
486 Ga0157374_12176999
487 Ga0157378_10461604
488 Ga0157378_11119802
489 Ga0157378_11233534
490 Ga0157378_12261092
491 Ga0157378_12889802
492 Ga0163162_11074276
493 Ga0157375_10640932
494 Ga0157375_11395123
495 Ga0157375_11655879
496 Ga0157375_12296769
497 Ga0163163_10036868
498 Ga0163163_10783659
499 Ga0163163_11708413
500 Ga0163163_11851581
501 Ga0157380_10021474
502 Ga0157380_10232701
503 Ga0157379_11498479
504 Ga0157379_11522657
505 Ga0157379_12040143
506 Ga0157376_10183635
507 Ga0157376_10343475
508 Ga0157376_12653705
509 Ga0163161_10262797
510 Ga0207682_10027219
511 Ga0207642_10037148
512 Ga0207710_10381166
513 Ga0207688_10491550
514 Ga0207688_10599940
515 Ga0207685_10488273
516 Ga0207699_10285786
517 Ga0207645_10833783
518 Ga0207707_10253971
519 Ga0207695_10082025
520 Ga0207657_10933462
521 Ga0207649_10496090
522 Ga0207681_10230899
523 Ga0207681_10518695
524 Ga0207694_11010462
525 Ga0207650_10133741
526 Ga0207650_10274355
527 Ga0207650_10284706
528 Ga0207650_10507944
529 Ga0207650_11538036
530 Ga0207659_10060926
531 Ga0207659_10331078
532 Ga0207687_11232588
533 Ga0207687_11239251
534 Ga0207687_11759743
535 Ga0207644_10150630
536 Ga0207644_11641980
537 Ga0207706_10647474
538 Ga0207686_10581406
539 Ga0207686_10788444
540 Ga0207686_10796810
541 Ga0207709_10060460
542 Ga0207670_10210118
543 Ga0207669_10271277
544 Ga0207669_10452374
545 Ga0207669_11063305
546 Ga0207704_10548774
547 Ga0207665_10194875
548 Ga0207691_10198920
549 Ga0207711_10364043
550 Ga0207711_10413751
551 Ga0207711_10445880
552 Ga0207711_10569178
553 Ga0207711_10775813
554 Ga0207711_11016761
555 Ga0207689_11664266
556 Ga0207661_10920876
557 Ga0207679_10268940
558 Ga0207667_10242157
559 Ga0207651_10051771
560 Ga0207651_10469197
561 Ga0207651_11036062
562 Ga0207712_10813684
563 Ga0207712_10822816
564 Ga0207712_11587184
565 Ga0207640_10910906
566 Ga0207658_11354110
567 Ga0207677_11168166
568 Ga0207708_11907568
569 Ga0207641_10418345
570 Ga0207648_10096490
571 Ga0207648_10150480
572 Ga0207648_10283896
573 Ga0207648_10323962
574 Ga0207648_10994564
575 Ga0207676_10071824
576 Ga0207676_10640192
577 Ga0207674_10102707
578 Ga0207674_11304028
579 Ga0207675_100041127
580 Ga0207675_100879002
581 Ga0207675_101348317
582 Ga0207683_10002712
583 Ga0207683_10249989
584 Ga0207683_11460135
585 Ga0207698_10398019
586 Ga0268266_10314538
587 Ga0268265_10469898
588 Ga0268265_10992452
589 Ga0268265_11178073
590 Ga0268264_10180859
591 Ga0268264_11276632
592 Ga0373958_0000724
593 Ga0373938_0060716
594 Ga0373929_0028392
595 Ga0373940_0003441
596 Ga0373949_0000731
597 Ga0373952_0008743
598 Ga0373932_0001650
599 Ga0373939_0000435
600 Ga0373960_0000124
601 Ga0373946_0359459
602 Ga0373955_0363162
603 Ga0373955_0541832
604 Ga0373942_0000088
605 Ga0373961_0001050
606 Ga0373962_0002687
607 Ga0373924_0133693
608 Ga0373935_0278314
609 Ga0373937_1473871
610 Ga0373925_0500323
611 Ga0373925_0538531
612 Ga0439435_0258557
613 Ga0451576_0176485
614 Ga0451576_0371917
615 Ga0495592_0158286
616 Ga0495592_0508229
617 Ga0495651_0557191
618 Ga0495664_0256755
619 Ga0495628_0303278
620 Ga0495628_0933840
621 Ga0495630_0378225
622 Ga0495640_0086198
623 Ga0495586_0093279
624 Ga0495586_0720913
625 Ga0495587_0027048
626 Ga0495634_0624987
627 Ga0495599_0129131
628 Ga0495599_0868791
629 Ga0495623_0182765
630 Ga0495613_0124435
631 Ga0495600_0537531
632 Ga0495674_0900362
633 Ga0495680_0946288
634 Ga0495684_0501974
635 Ga0495614_0632358
636 Ga0496100_1109717
637 Ga0496101_1473671
638 Ga0496102_0763325
639 Ga0496106_0689663
640 Ga0496106_0970208
641 Ga0496109_0859721
642 Ga0501034_1199674
643 Ga0501043_0299507
644 Ga0501047_0123896
645 Ga0501048_0838732
646 Ga0501073_0300788
647 Ga0501249_147855
648 Ga0501083_0375461
649 Ga0501044_0016644
650 nmdc:mga05p37_125588_c1
651 nmdc:mga09592_130578_c1
652 nmdc:mga09592_378433_c1
653 nmdc:mga06r32_138509_c1
654 nmdc:mga08y16_159097_c1
655 nmdc:mga0n895_579983_c1
656 nmdc:mga0rr50_204997_c1
657 nmdc:mga08x19_41801_c1
658 nmdc:mga0a205_146929_c1
659 Ga0495601_0107634
660 Ga0495612_0333918
661 Ga0495595_0164609
662 Ga0495619_0107419
663 Ga0495619_0205176
664 Ga0495619_0715816

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01192

RNA_pol_Rpb6

RNA polymerase Rpb6

18

79

0.9

Map