F410706

General Info

Members Datasets Scaffolds Average Seq Length
331 260 662 141

Family's Representative Sequence

Representative Sequence 3300049822|Ga0501035_1267447|Ga0501035_1267447_16_513
Length 165
Sequence MIRYALRCERGHAFESWFQSSAAYESQHKRKLVTCPVCDSAKVEKAIMAPQITRKGGNKTTEPDAAAPAQTPEPAQLVMAPQERELLTKLRELRDHVTKNADNVGTKFPEEARKMHYGDIEHRAIYGEASPDEARSLIEEGVEVLPLPALPEDRNRASSSPRACR

Samples

Sample ID Description Type Environment
1 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
29 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
32 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
33 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
34 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
35 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
40 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
48 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
49 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
50 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
52 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
53 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
82 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
83 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
84 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
89 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
90 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
91 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
92 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
93 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
94 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
95 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
96 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
97 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
98 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
99 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
100 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
101 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
102 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
103 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
104 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
105 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
106 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
107 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
108 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
113 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
117 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
118 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
121 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
122 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
123 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
124 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
129 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
130 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
131 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
132 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
133 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
134 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
135 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
143 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
144 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
149 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
150 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
167 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
168 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
169 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
170 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
173 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
176 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
177 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
198 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
201 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
202 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
203 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
204 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
205 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
206 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
207 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
208 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
209 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
210 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
211 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
212 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
213 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
214 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
215 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
216 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
217 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
218 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
219 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
220 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
221 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
222 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
225 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
226 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
227 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
228 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
229 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
230 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
231 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
232 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
233 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
234 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
235 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
236 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
237 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
238 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
241 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
242 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
246 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 2643221651 Afipia sp. Root123D2 Isolate Unclassified
251 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
252 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
253 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
254 2791355199
255 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
256 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
257 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
258 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
259 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
260 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 96.97
Metatranscriptomes 0
Isolates 3.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.45
Nodule 2.42
Rhizoplane 3.02
Rhizosphere 61.93
Stem 0
Stem Tuber 0
Unclassified 0.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501035_1267447 3300049822 Bacteria 569
2 JGI25406J46586_10150247 3300003203 Bacteria 680
3 JGI25153J46596_10006145 3300003215 Bacteria 6155
4 JGI25153J46596_10032039 3300003215 Bacteria 1759
5 rootH1_10338271 3300003323 Bacteria 1293
6 Ga0070676_10111905 3300005328 Bacteria 1701
7 Ga0070670_100044960 3300005331 Bacteria 3795
8 Ga0068869_100615684 3300005334 Bacteria 918
9 Ga0070680_101257008 3300005336 Bacteria 641
10 Ga0070689_100185441 3300005340 Bacteria 1692
11 Ga0070669_100170443 3300005353 Bacteria 1697
12 Ga0070673_100023023 3300005364 Bacteria 4545
13 Ga0070688_100193210 3300005365 Bacteria 1419
14 Ga0070667_100280080 3300005367 Bacteria 1497
15 Ga0070709_10488107 3300005434 Bacteria 934
16 Ga0070714_100191605 3300005435 Bacteria 1866
17 Ga0070713_100616587 3300005436 Bacteria 1032
18 Ga0070711_100013435 3300005439 Bacteria 5143
19 Ga0070711_100373034 3300005439 Bacteria 1152
20 Ga0070711_100569219 3300005439 Bacteria 942
21 Ga0070663_100131895 3300005455 Bacteria 1898
22 Ga0070678_100186467 3300005456 Bacteria 1702
23 Ga0070681_10158120 3300005458 Bacteria 2190
24 Ga0070681_11196661 3300005458 Bacteria 682
25 Ga0070699_101411403 3300005518 Bacteria 639
26 Ga0070679_100016662 3300005530 Bacteria 7098
27 Ga0070679_100472354 3300005530 Bacteria 1198
28 Ga0070679_100511704 3300005530 Bacteria 1144
29 Ga0068853_100238024 3300005539 Bacteria 1668
30 Ga0070665_100093430 3300005548 Bacteria 3013
31 Ga0070665_100317944 3300005548 Bacteria 1561
32 Ga0068855_100328229 3300005563 Bacteria 1689
33 Ga0068856_100564131 3300005614 Bacteria 1160
34 Ga0068856_100662719 3300005614 Bacteria 1064
35 Ga0068856_102001637 3300005614 Bacteria 590
36 Ga0068859_100586502 3300005617 Bacteria 1208
37 Ga0068862_101418181 3300005844 Bacteria 698
38 Ga0081455_10000329 3300005937 Bacteria 62107
39 Ga0081455_10509257 3300005937 Unclassified 806
40 Ga0081539_10066584 3300005985 Bacteria 1952
41 Ga0081539_10156852 3300005985 Bacteria 1089
42 Ga0075365_10039630 3300006038 Bacteria 3069
43 Ga0075365_10104419 3300006038 Bacteria 1943
44 Ga0075368_10032439 3300006042 Bacteria 2029
45 Ga0075368_10056045 3300006042 Bacteria 1572
46 Ga0075363_100050372 3300006048 Bacteria 2219
47 Ga0075363_100160724 3300006048 Bacteria 1272
48 Ga0075364_10008522 3300006051 Bacteria 6134
49 Ga0075362_10009691 3300006177 Bacteria 3735
50 Ga0075367_10014590 3300006178 Bacteria 4254
51 Ga0075367_10024318 3300006178 Bacteria 3416
52 Ga0075367_10093192 3300006178 Bacteria 1834
53 Ga0097621_100293114 3300006237 Bacteria 1435
54 Ga0097620_100586546 3300006931 Bacteria 1208
55 Ga0099823_1046916 3300006944 Bacteria 2813
56 Ga0099794_10091430 3300007265 Bacteria 1510
57 Ga0105247_10380529 3300009101 Bacteria 1001
58 Ga0105243_10763429 3300009148 Bacteria 949
59 Ga0105241_10148459 3300009174 Bacteria 1915
60 Ga0105241_10530727 3300009174 Bacteria 1054
61 Ga0105238_10168070 3300009551 Bacteria 2169
62 Ga0157373_10362172 3300013100 Bacteria 1035
63 Ga0157370_10508459 3300013104 Bacteria 1106
64 Ga0157374_10350173 3300013296 Bacteria 1467
65 Ga0163163_10069810 3300014325 Bacteria 3498
66 Ga0213874_10001300 3300021377 Bacteria 5163
67 Ga0209563_103246 3300025230 Bacteria 3415
68 Ga0209233_1036342 3300025261 Bacteria 1104
69 Ga0209758_1006161 3300025297 Bacteria 8784
70 Ga0209758_1011559 3300025297 Bacteria 5089
71 Ga0207692_10174940 3300025898 Bacteria 1247
72 Ga0207688_10635223 3300025901 Bacteria 674
73 Ga0207699_10388929 3300025906 Bacteria 991
74 Ga0207643_10353819 3300025908 Bacteria 922
75 Ga0207705_10973512 3300025909 Bacteria 656
76 Ga0207654_10133216 3300025911 Bacteria 1575
77 Ga0207707_10001598 3300025912 Bacteria 20886
78 Ga0207695_10150812 3300025913 Bacteria 2264
79 Ga0207663_10235570 3300025916 Bacteria 1340
80 Ga0207660_10153026 3300025917 Bacteria 1774
81 Ga0207660_10779079 3300025917 Bacteria 780
82 Ga0207649_10043961 3300025920 Bacteria 2734
83 Ga0207652_10122006 3300025921 Bacteria 2319
84 Ga0207652_10751200 3300025921 Bacteria 868
85 Ga0207650_10007124 3300025925 Bacteria 7619
86 Ga0207700_10524321 3300025928 Bacteria 1050
87 Ga0207664_10244734 3300025929 Bacteria 1563
88 Ga0207644_10114787 3300025931 Bacteria 2041
89 Ga0207706_10067656 3300025933 Bacteria 3143
90 Ga0207670_10008331 3300025936 Bacteria 5845
91 Ga0207665_10071623 3300025939 Bacteria 2366
92 Ga0207691_10099962 3300025940 Bacteria 2589
93 Ga0207691_10393751 3300025940 Bacteria 1182
94 Ga0207679_10609335 3300025945 Bacteria 985
95 Ga0207667_10237256 3300025949 Bacteria 1866
96 Ga0207667_10687789 3300025949 Bacteria 1026
97 Ga0207667_10705172 3300025949 Bacteria 1011
98 Ga0207651_10037402 3300025960 Bacteria 3179
99 Ga0207640_10026809 3300025981 Bacteria 3504
100 Ga0207658_10642539 3300025986 Bacteria 956
101 Ga0207639_10492939 3300026041 Bacteria 1118
102 Ga0207678_10031151 3300026067 Bacteria 4653
103 Ga0207678_10164546 3300026067 Bacteria 1894
104 Ga0207683_10083382 3300026121 Bacteria 2841
105 Ga0209389_1000110 3300027296 Bacteria 72586
106 Ga0209489_100524 3300027361 Bacteria 72457
107 Ga0209700_100334 3300027363 Bacteria 84979
108 Ga0209179_1003415 3300027512 Bacteria 2286
109 Ga0209813_10073182 3300027866 Bacteria 1118
110 Ga0268266_10351044 3300028379 Bacteria 1386
111 Ga0268266_10497376 3300028379 Bacteria 1164
112 Ga0307515_10012007 3300028794 Bacteria 16357
113 Ga0307515_10160485 3300028794 Bacteria 2296
114 Ga0265325_10000567 3300031241 Bacteria 26847
115 Ga0307516_10174905 3300031730 Bacteria 1884
116 Ga0307412_10262915 3300031911 Bacteria 1346
117 Ga0307412_10664513 3300031911 Bacteria 890
118 Ga0307409_100710036 3300031995 Bacteria 1006
119 Ga0307411_10911132 3300032005 Bacteria 782
120 Ga0316583_10027102 3300032133 Bacteria 2045
121 Ga0373953_0018774 3300035117 Bacteria 2563
122 Ga0373954_0028345 3300035118 Bacteria 2574
123 Ga0373924_0026742 3300035410 Bacteria 2290
124 Ga0373927_0173852 3300035695 Bacteria 1412
125 Ga0373927_0209859 3300035695 Bacteria 1279
126 Ga0373933_0015865 3300035724 Bacteria 4205
127 Ga0373937_0016495 3300036401 Bacteria 6561
128 Ga0373925_0256248 3300037068 Bacteria 1404
129 Ga0436364_1195976 3300037853 Bacteria 3551
130 Ga0436360_0275241 3300039438 Bacteria 1465
131 Ga0436363_0430058 3300039450 Bacteria 3261
132 Ga0451847_0804273 3300041503 Bacteria 709
133 Ga0466972_0009610 3300044658 Bacteria 4852
134 Ga0466965_0211055 3300044683 Bacteria 1032
135 Ga0466963_0001672 3300044694 Bacteria 12090
136 Ga0466963_0126935 3300044694 Bacteria 1759
137 Ga0466964_0141518 3300044706 Bacteria 1106
138 Ga0466964_0279160 3300044706 Bacteria 834
139 Ga0466957_0542948 3300044842 Bacteria 809
140 Ga0466960_0003156 3300044901 Bacteria 6319
141 Ga0466959_0346504 3300045049 Bacteria 1013
142 Ga0466967_0638151 3300045976 Bacteria 1053
143 Ga0495603_0138458 3300046455 Bacteria 1416
144 Ga0495638_0070631 3300046460 Bacteria 2137
145 Ga0495651_0084363 3300046462 Bacteria 2393
146 Ga0495653_0464061 3300046463 Bacteria 794
147 Ga0495662_0166533 3300046476 Bacteria 1086
148 Ga0495596_0115777 3300046500 Bacteria 1041
149 Ga0495607_0017797 3300046501 Bacteria 4550
150 Ga0495606_0065138 3300046507 Bacteria 2316
151 Ga0495608_0073498 3300046511 Bacteria 2229
152 Ga0495610_0048622 3300046512 Bacteria 2081
153 Ga0495616_0053651 3300046513 Bacteria 2002
154 Ga0495620_0119010 3300046515 Bacteria 1042
155 Ga0495630_0831514 3300046517 Bacteria 704
156 Ga0495631_0077924 3300046518 Bacteria 1430
157 Ga0495632_0044368 3300046519 Bacteria 2219
158 Ga0495643_0036759 3300046522 Bacteria 2689
159 Ga0495648_0101944 3300046524 Bacteria 1582
160 Ga0495654_0022762 3300046530 Bacteria 3249
161 Ga0495640_0034732 3300046533 Bacteria 3571
162 Ga0495586_0178888 3300046535 Bacteria 1199
163 Ga0495587_0252403 3300046536 Bacteria 991
164 Ga0495609_0082768 3300046538 Bacteria 1402
165 Ga0495621_0158044 3300046539 Bacteria 895
166 Ga0495597_0027998 3300046542 Bacteria 2581
167 Ga0495645_0017294 3300046543 Bacteria 5164
168 Ga0495633_0298528 3300046558 Bacteria 732
169 Ga0495668_0281362 3300046616 Bacteria 911
170 Ga0495611_0054486 3300046648 Bacteria 1808
171 Ga0495625_0084559 3300046660 Bacteria 2203
172 Ga0495661_0431618 3300046665 Bacteria 636
173 Ga0495588_0049702 3300046674 Bacteria 2157
174 Ga0495657_0012376 3300046675 Bacteria 6338
175 Ga0495599_0054292 3300046678 Bacteria 2510
176 Ga0495623_0201881 3300046679 Bacteria 1142
177 Ga0495646_0008794 3300046680 Bacteria 6413
178 Ga0495613_0091508 3300046689 Bacteria 2203
179 Ga0495613_0138731 3300046689 Bacteria 1738
180 Ga0495671_0037770 3300046692 Bacteria 2441
181 Ga0495649_0570791 3300046694 Bacteria 559
182 Ga0495660_0102044 3300046810 Bacteria 1475
183 Ga0495604_0056869 3300047317 Bacteria 3008
184 Ga0495672_0083743 3300047320 Bacteria 1770
185 Ga0495680_0080146 3300047322 Bacteria 2467
186 Ga0495675_0027704 3300047444 Bacteria 3612
187 Ga0495673_0218287 3300047469 Bacteria 707
188 Ga0495681_0069258 3300047470 Bacteria 1603
189 Ga0495686_0042115 3300047472 Bacteria 2905
190 Ga0495686_0098839 3300047472 Bacteria 1762
191 Ga0495686_0328042 3300047472 Bacteria 837
192 Ga0495686_0484076 3300047472 Bacteria 654
193 Ga0495593_0151261 3300047673 Bacteria 1174
194 Ga0495602_0026012 3300048088 Bacteria 5653
195 Ga0496102_0343717 3300048905 Bacteria 1405
196 Ga0496102_0363136 3300048905 Bacteria 1363
197 Ga0496104_0780542 3300048907 Bacteria 862
198 Ga0496104_1074835 3300048907 Bacteria 708
199 Ga0496108_0565209 3300048911 Bacteria 992
200 Ga0496108_0568069 3300048911 Bacteria 989
201 Ga0496108_0738144 3300048911 Bacteria 852
202 Ga0496111_0206011 3300048914 Bacteria 1462
203 Ga0496111_0298961 3300048914 Bacteria 1193
204 Ga0496113_0194057 3300048916 Bacteria 1613
205 Ga0496117_0023589 3300048920 Bacteria 4897
206 Ga0496117_0105375 3300048920 Bacteria 1772
207 Ga0496118_0201024 3300048921 Bacteria 1180
208 Ga0496118_0221301 3300048921 Bacteria 1101
209 Ga0496118_0397181 3300048921 Bacteria 717
210 Ga0496119_0188451 3300048922 Bacteria 1076
211 Ga0496120_0062183 3300048923 Bacteria 2081
212 Ga0496120_0183529 3300048923 Bacteria 1025
213 Ga0496120_0432322 3300048923 Bacteria 576
214 Ga0496121_0061029 3300048924 Bacteria 3096
215 Ga0496121_0107483 3300048924 Bacteria 2137
216 Ga0496121_0119912 3300048924 Bacteria 1988
217 Ga0496122_0027559 3300048925 Bacteria 4853
218 Ga0496122_0036966 3300048925 Bacteria 3939
219 Ga0496123_0024079 3300048926 Bacteria 4638
220 Ga0496123_0314202 3300048926 Bacteria 742
221 Ga0496125_0000243 3300048928 Bacteria 111891
222 Ga0496125_0000904 3300048928 Bacteria 46904
223 Ga0496126_0083799 3300048929 Bacteria 2813
224 Ga0496126_0099409 3300048929 Bacteria 2548
225 Ga0496126_0286158 3300048929 Bacteria 1364
226 Ga0496126_0332025 3300048929 Bacteria 1248
227 Ga0495678_110910 3300049459 Bacteria 935
228 Ga0495682_0059786 3300049460 Bacteria 1377
229 Ga0501031_0077796 3300049568 Bacteria 2161
230 Ga0501032_0234964 3300049569 Bacteria 1191
231 Ga0501033_0103741 3300049570 Bacteria 2073
232 Ga0501033_0224646 3300049570 Bacteria 1335
233 Ga0501034_0186857 3300049571 Bacteria 2035
234 Ga0501034_0510211 3300049571 Bacteria 1115
235 Ga0501036_0189165 3300049572 Bacteria 1732
236 Ga0501036_0367294 3300049572 Bacteria 1201
237 Ga0501039_0008884 3300049575 Bacteria 7656
238 Ga0501039_0147705 3300049575 Bacteria 1847
239 Ga0501043_0225204 3300049579 Bacteria 1449
240 Ga0501046_0097842 3300049580 Bacteria 2254
241 Ga0501046_0098138 3300049580 Bacteria 2250
242 Ga0501046_0519445 3300049580 Bacteria 851
243 Ga0501047_0411026 3300049581 Bacteria 1185
244 Ga0501071_0156741 3300049587 Bacteria 1700
245 Ga0501072_0309322 3300049588 Bacteria 1256
246 Ga0501073_0999076 3300049589 Bacteria 576
247 Ga0501074_0247458 3300049590 Bacteria 1268
248 Ga0501074_0590929 3300049590 Bacteria 785
249 Ga0501075_0171808 3300049591 Bacteria 1654
250 Ga0501076_0023781 3300049592 Bacteria 4727
251 Ga0501080_0997637 3300049742 Bacteria 726
252 Ga0501081_0045084 3300049743 Bacteria 3028
253 Ga0501083_0043388 3300049744 Bacteria 3047
254 Ga0501083_0188490 3300049744 Bacteria 1346
255 Ga0501035_0482219 3300049822 Bacteria 1023
256 Ga0501044_0146854 3300049823 Bacteria 2343
257 Ga0501044_0195926 3300049823 Bacteria 1980
258 Ga0501044_1033690 3300049823 Bacteria 692
259 Ga0501045_0285259 3300049824 Bacteria 1229
260 nmdc:mga03683_90560_c1 3300050489 Bacteria 1333
261 nmdc:mga03n38_43216_c1 3300050490 Bacteria 1974
262 nmdc:mga00v17_45293_c1 3300050491 Bacteria 2657
263 nmdc:mga0yw44_14970_c1 3300050492 Bacteria 4138
264 nmdc:mga0yw44_49920_c1 3300050492 Bacteria 2527
265 nmdc:mga0yw44_71136_c1 3300050492 Bacteria 2159
266 nmdc:mga06z11_4617_c1 3300050494 Bacteria 5432
267 nmdc:mga04h51_41727_c1 3300050495 Bacteria 1501
268 nmdc:mga04h51_88550_c1 3300050495 Bacteria 1110
269 nmdc:mga07m45_300622_c1 3300050496 Bacteria 933
270 Ga0495601_0477296 3300053077 Bacteria 805
271 Ga0495612_0011487 3300053078 Bacteria 3571
272 Ga0495595_0019945 3300053084 Bacteria 2913
273 Ga0495619_0049070 3300053085 Bacteria 2783
274 Ga0500578_0509057 3300053086 Bacteria 676
275 Ga0500643_013122 3300053087 Bacteria 2939
276 Ga0500644_0015153 3300053088 Bacteria 2190
277 Ga0500581_128911 3300053089 Bacteria 1212
278 Ga0500646_0016485 3300053090 Bacteria 1930
279 Ga0500651_0033912 3300053093 Bacteria 3218
280 Ga0500651_0477012 3300053093 Bacteria 690
281 Ga0500650_0041978 3300053098 Bacteria 2112
282 Ga0500555_035905 3300053103 Bacteria 1391
283 Ga0500556_0000019 3300053104 Bacteria 186017
284 Ga0500562_014581 3300053108 Bacteria 2012
285 Ga0500569_104863 3300053109 Bacteria 929
286 Ga0500572_000149 3300053111 Bacteria 24147
287 Ga0500592_000879 3300053116 Bacteria 4894
288 Ga0500593_069789 3300053117 Bacteria 1527
289 Ga0500594_0010686 3300053118 Bacteria 2134
290 Ga0500595_027101 3300053119 Bacteria 1966
291 Ga0500621_053949 3300053126 Bacteria 1626
292 Ga0500642_0000039 3300053130 Bacteria 98235
293 Ga0500642_0008571 3300053130 Bacteria 3510
294 Ga0500652_001066 3300053131 Bacteria 8907
295 Ga0500658_0077834 3300053134 Bacteria 1412
296 Ga0500559_0000749 3300053136 Bacteria 21314
297 Ga0500568_0001467 3300053139 Bacteria 15123
298 Ga0500588_0035483 3300053146 Bacteria 1468
299 Ga0500588_0342086 3300053146 Bacteria 568
300 Ga0500603_001045 3300053150 Bacteria 6502
301 Ga0500604_0141043 3300053151 Bacteria 814
302 Ga0500616_0000038 3300053153 Bacteria 386801
303 Ga0500616_0000059 3300053153 Bacteria 259741
304 Ga0500622_0053904 3300053156 Bacteria 2064
305 Ga0500627_0121586 3300053158 Bacteria 1178
306 Ga0500633_0070301 3300053160 Bacteria 1248
307 Ga0500638_260390 3300053162 Bacteria 692
308 Ga0500639_024117 3300053163 Bacteria 3215
309 Ga0500636_0024936 3300053177 Bacteria 3535
310 Ga0500637_0349234 3300053178 Bacteria 787
311 Ga0500570_037423 3300053724 Bacteria 2567
312 Ga0500576_058913 3300053725 Bacteria 1685
313 Ga0500611_151809 3300053727 Bacteria 636
314 Ga0500645_012315 3300053730 Bacteria 2765
315 Ga0500609_008867 3300053731 Bacteria 1358
316 Ga0500596_004236 3300053735 Bacteria 2653
317 Ga0501084_0235839 3300054114 Bacteria 1544
318 Ga0501082_0000447 3300060353 Bacteria 36502
319 Ga0501082_0181842 3300060353 Bacteria 1829
320 Ga0530510_0082958 3300061734 Bacteria 2334
321 2644290719 2643221651 Bacteria 4798932
322 2738746400 2738541281 Bacteria 5112672
323 2739355630 2738543032 Bacteria 5115625
324 2793067271 2791355197 Bacteria 8420563
325 2793077092
326 2857525803 2857524615 Bacteria 6615449
327 2893067906 2893066018 Bacteria 6158120
328 2919074335 2919073203 Bacteria 6531949
329 2922389042 2922386360 Bacteria 7017218
330 2941535689 2941531003 Bacteria 7653939
331 8019572065 8019565922 Bacteria 9639779
332 Ga0501035_1267447
333 JGI25406J46586_10150247
334 JGI25153J46596_10006145
335 JGI25153J46596_10032039
336 rootH1_10338271
337 Ga0070676_10111905
338 Ga0070670_100044960
339 Ga0068869_100615684
340 Ga0070680_101257008
341 Ga0070689_100185441
342 Ga0070669_100170443
343 Ga0070673_100023023
344 Ga0070688_100193210
345 Ga0070667_100280080
346 Ga0070709_10488107
347 Ga0070714_100191605
348 Ga0070713_100616587
349 Ga0070711_100013435
350 Ga0070711_100373034
351 Ga0070711_100569219
352 Ga0070663_100131895
353 Ga0070678_100186467
354 Ga0070681_10158120
355 Ga0070681_11196661
356 Ga0070699_101411403
357 Ga0070679_100016662
358 Ga0070679_100472354
359 Ga0070679_100511704
360 Ga0068853_100238024
361 Ga0070665_100093430
362 Ga0070665_100317944
363 Ga0068855_100328229
364 Ga0068856_100564131
365 Ga0068856_100662719
366 Ga0068856_102001637
367 Ga0068859_100586502
368 Ga0068862_101418181
369 Ga0081455_10000329
370 Ga0081455_10509257
371 Ga0081539_10066584
372 Ga0081539_10156852
373 Ga0075365_10039630
374 Ga0075365_10104419
375 Ga0075368_10032439
376 Ga0075368_10056045
377 Ga0075363_100050372
378 Ga0075363_100160724
379 Ga0075364_10008522
380 Ga0075362_10009691
381 Ga0075367_10014590
382 Ga0075367_10024318
383 Ga0075367_10093192
384 Ga0097621_100293114
385 Ga0097620_100586546
386 Ga0099823_1046916
387 Ga0099794_10091430
388 Ga0105247_10380529
389 Ga0105243_10763429
390 Ga0105241_10148459
391 Ga0105241_10530727
392 Ga0105238_10168070
393 Ga0157373_10362172
394 Ga0157370_10508459
395 Ga0157374_10350173
396 Ga0163163_10069810
397 Ga0213874_10001300
398 Ga0209563_103246
399 Ga0209233_1036342
400 Ga0209758_1006161
401 Ga0209758_1011559
402 Ga0207692_10174940
403 Ga0207688_10635223
404 Ga0207699_10388929
405 Ga0207643_10353819
406 Ga0207705_10973512
407 Ga0207654_10133216
408 Ga0207707_10001598
409 Ga0207695_10150812
410 Ga0207663_10235570
411 Ga0207660_10153026
412 Ga0207660_10779079
413 Ga0207649_10043961
414 Ga0207652_10122006
415 Ga0207652_10751200
416 Ga0207650_10007124
417 Ga0207700_10524321
418 Ga0207664_10244734
419 Ga0207644_10114787
420 Ga0207706_10067656
421 Ga0207670_10008331
422 Ga0207665_10071623
423 Ga0207691_10099962
424 Ga0207691_10393751
425 Ga0207679_10609335
426 Ga0207667_10237256
427 Ga0207667_10687789
428 Ga0207667_10705172
429 Ga0207651_10037402
430 Ga0207640_10026809
431 Ga0207658_10642539
432 Ga0207639_10492939
433 Ga0207678_10031151
434 Ga0207678_10164546
435 Ga0207683_10083382
436 Ga0209389_1000110
437 Ga0209489_100524
438 Ga0209700_100334
439 Ga0209179_1003415
440 Ga0209813_10073182
441 Ga0268266_10351044
442 Ga0268266_10497376
443 Ga0307515_10012007
444 Ga0307515_10160485
445 Ga0265325_10000567
446 Ga0307516_10174905
447 Ga0307412_10262915
448 Ga0307412_10664513
449 Ga0307409_100710036
450 Ga0307411_10911132
451 Ga0316583_10027102
452 Ga0373953_0018774
453 Ga0373954_0028345
454 Ga0373924_0026742
455 Ga0373927_0173852
456 Ga0373927_0209859
457 Ga0373933_0015865
458 Ga0373937_0016495
459 Ga0373925_0256248
460 Ga0436364_1195976
461 Ga0436360_0275241
462 Ga0436363_0430058
463 Ga0451847_0804273
464 Ga0466972_0009610
465 Ga0466965_0211055
466 Ga0466963_0001672
467 Ga0466963_0126935
468 Ga0466964_0141518
469 Ga0466964_0279160
470 Ga0466957_0542948
471 Ga0466960_0003156
472 Ga0466959_0346504
473 Ga0466967_0638151
474 Ga0495603_0138458
475 Ga0495638_0070631
476 Ga0495651_0084363
477 Ga0495653_0464061
478 Ga0495662_0166533
479 Ga0495596_0115777
480 Ga0495607_0017797
481 Ga0495606_0065138
482 Ga0495608_0073498
483 Ga0495610_0048622
484 Ga0495616_0053651
485 Ga0495620_0119010
486 Ga0495630_0831514
487 Ga0495631_0077924
488 Ga0495632_0044368
489 Ga0495643_0036759
490 Ga0495648_0101944
491 Ga0495654_0022762
492 Ga0495640_0034732
493 Ga0495586_0178888
494 Ga0495587_0252403
495 Ga0495609_0082768
496 Ga0495621_0158044
497 Ga0495597_0027998
498 Ga0495645_0017294
499 Ga0495633_0298528
500 Ga0495668_0281362
501 Ga0495611_0054486
502 Ga0495625_0084559
503 Ga0495661_0431618
504 Ga0495588_0049702
505 Ga0495657_0012376
506 Ga0495599_0054292
507 Ga0495623_0201881
508 Ga0495646_0008794
509 Ga0495613_0091508
510 Ga0495613_0138731
511 Ga0495671_0037770
512 Ga0495649_0570791
513 Ga0495660_0102044
514 Ga0495604_0056869
515 Ga0495672_0083743
516 Ga0495680_0080146
517 Ga0495675_0027704
518 Ga0495673_0218287
519 Ga0495681_0069258
520 Ga0495686_0042115
521 Ga0495686_0098839
522 Ga0495686_0328042
523 Ga0495686_0484076
524 Ga0495593_0151261
525 Ga0495602_0026012
526 Ga0496102_0343717
527 Ga0496102_0363136
528 Ga0496104_0780542
529 Ga0496104_1074835
530 Ga0496108_0565209
531 Ga0496108_0568069
532 Ga0496108_0738144
533 Ga0496111_0206011
534 Ga0496111_0298961
535 Ga0496113_0194057
536 Ga0496117_0023589
537 Ga0496117_0105375
538 Ga0496118_0201024
539 Ga0496118_0221301
540 Ga0496118_0397181
541 Ga0496119_0188451
542 Ga0496120_0062183
543 Ga0496120_0183529
544 Ga0496120_0432322
545 Ga0496121_0061029
546 Ga0496121_0107483
547 Ga0496121_0119912
548 Ga0496122_0027559
549 Ga0496122_0036966
550 Ga0496123_0024079
551 Ga0496123_0314202
552 Ga0496125_0000243
553 Ga0496125_0000904
554 Ga0496126_0083799
555 Ga0496126_0099409
556 Ga0496126_0286158
557 Ga0496126_0332025
558 Ga0495678_110910
559 Ga0495682_0059786
560 Ga0501031_0077796
561 Ga0501032_0234964
562 Ga0501033_0103741
563 Ga0501033_0224646
564 Ga0501034_0186857
565 Ga0501034_0510211
566 Ga0501036_0189165
567 Ga0501036_0367294
568 Ga0501039_0008884
569 Ga0501039_0147705
570 Ga0501043_0225204
571 Ga0501046_0097842
572 Ga0501046_0098138
573 Ga0501046_0519445
574 Ga0501047_0411026
575 Ga0501071_0156741
576 Ga0501072_0309322
577 Ga0501073_0999076
578 Ga0501074_0247458
579 Ga0501074_0590929
580 Ga0501075_0171808
581 Ga0501076_0023781
582 Ga0501080_0997637
583 Ga0501081_0045084
584 Ga0501083_0043388
585 Ga0501083_0188490
586 Ga0501035_0482219
587 Ga0501044_0146854
588 Ga0501044_0195926
589 Ga0501044_1033690
590 Ga0501045_0285259
591 nmdc:mga03683_90560_c1
592 nmdc:mga03n38_43216_c1
593 nmdc:mga00v17_45293_c1
594 nmdc:mga0yw44_14970_c1
595 nmdc:mga0yw44_49920_c1
596 nmdc:mga0yw44_71136_c1
597 nmdc:mga06z11_4617_c1
598 nmdc:mga04h51_41727_c1
599 nmdc:mga04h51_88550_c1
600 nmdc:mga07m45_300622_c1
601 Ga0495601_0477296
602 Ga0495612_0011487
603 Ga0495595_0019945
604 Ga0495619_0049070
605 Ga0500578_0509057
606 Ga0500643_013122
607 Ga0500644_0015153
608 Ga0500581_128911
609 Ga0500646_0016485
610 Ga0500651_0033912
611 Ga0500651_0477012
612 Ga0500650_0041978
613 Ga0500555_035905
614 Ga0500556_0000019
615 Ga0500562_014581
616 Ga0500569_104863
617 Ga0500572_000149
618 Ga0500592_000879
619 Ga0500593_069789
620 Ga0500594_0010686
621 Ga0500595_027101
622 Ga0500621_053949
623 Ga0500642_0000039
624 Ga0500642_0008571
625 Ga0500652_001066
626 Ga0500658_0077834
627 Ga0500559_0000749
628 Ga0500568_0001467
629 Ga0500588_0035483
630 Ga0500588_0342086
631 Ga0500603_001045
632 Ga0500604_0141043
633 Ga0500616_0000038
634 Ga0500616_0000059
635 Ga0500622_0053904
636 Ga0500627_0121586
637 Ga0500633_0070301
638 Ga0500638_260390
639 Ga0500639_024117
640 Ga0500636_0024936
641 Ga0500637_0349234
642 Ga0500570_037423
643 Ga0500576_058913
644 Ga0500611_151809
645 Ga0500645_012315
646 Ga0500609_008867
647 Ga0500596_004236
648 Ga0501084_0235839
649 Ga0501082_0000447
650 Ga0501082_0181842
651 Ga0530510_0082958
652 2644290719
653 2738746400
654 2739355630
655 2793067271
656 2793077092
657 2857525803
658 2893067906
659 2919074335
660 2922389042
661 2941535689
662 8019572065

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06676

DUF1178

Protein of unknown function (DUF1178)

1

152

0.93

Map