F410669

General Info

Members Datasets Scaffolds Average Seq Length
331 135 321 173

Family's Representative Sequence

Representative Sequence 3300048915|Ga0496112_0236399|Ga0496112_0236399_743_1369
Length 208
Sequence LASNQPIDGILYFQILFANPFRVHYKKIKKQGSGDMETSRRTFLKAGLLGAVLLAAGGSIYRTTHSPPPAPFVLGGEARAALAAIIPAILEGALPGDSNERNAAIAVTTEGVHQAILGLPLATQKEIQDLFGLLALGPARRLLTGIGGGWEQAAPAQVSAFLQDWRVHRLGLLRSAYGAMHDLVLGAWYANPSSWAAIGYPGPLKELS

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2738541297 Duganella sp. GV083 Isolate Unclassified
4 2738541357 Duganella sp. GV053 Isolate Unclassified
5 2738543003 Duganella sp. GV066 Isolate Unclassified
6 2738543026 Duganella sp. GV089 Isolate Unclassified
7 2738543029 Duganella sp. GV039 Isolate Unclassified
8 2821131069 Duganella sp. 1224 Isolate Unclassified
9 2857564685 Duganella sp. R-74599 Isolate Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
17 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
18 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
19 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
21 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
27 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
28 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
29 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
30 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
31 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
32 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
33 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
34 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
35 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
36 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
37 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
38 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
39 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
40 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
41 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
42 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
43 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
44 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
45 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
46 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
47 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
48 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
49 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
50 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
51 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
52 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
53 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
54 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
55 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
56 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
57 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
58 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
59 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
60 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
61 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
62 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
63 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
64 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
65 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
66 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
67 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
68 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
69 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
70 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
71 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
72 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
73 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
74 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
75 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
76 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
77 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
78 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
79 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
80 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
81 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
82 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
83 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
84 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
85 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
86 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
87 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
88 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
89 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
90 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
91 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
98 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
99 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
100 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
101 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
102 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
103 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
104 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
105 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
106 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
107 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
108 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
109 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
110 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
111 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
112 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
113 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
114 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
115 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
116 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
117 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
118 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
119 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
120 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
121 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
122 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
123 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
124 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
125 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
126 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
127 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
128 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
129 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
130 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
131 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
134 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
135 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.98
Metatranscriptomes 0
Isolates 3.02

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.81
Nodule 0
Rhizoplane 4.23
Rhizosphere 88.22
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH2_10092706 3300003320 Bacteria 1539
2 Ga0055529_1000051 3300003763 Bacteria 205006
3 Ga0070660_100048019 3300005339 Bacteria 3277
4 Ga0070661_100146667 3300005344 Bacteria 1782
5 Ga0070659_100342659 3300005366 Bacteria 1252
6 Ga0070662_100384433 3300005457 Bacteria 1156
7 Ga0070664_100021365 3300005564 Bacteria 5334
8 Ga0068865_100420249 3300006881 Bacteria 1099
9 Ga0213872_10000088 3300021361 Bacteria 83921
10 Ga0213872_10001273 3300021361 Bacteria 16910
11 Ga0213872_10007040 3300021361 Bacteria 5571
12 Ga0213872_10008486 3300021361 Bacteria 4972
13 Ga0209455_1000044 3300025272 Bacteria 410787
14 Ga0209564_1000072 3300025295 Bacteria 289331
15 Ga0207657_10017606 3300025919 Bacteria 6845
16 Ga0207690_10168189 3300025932 Bacteria 1640
17 Ga0207706_10109521 3300025933 Bacteria 2430
18 Ga0207706_10984093 3300025933 Bacteria 709
19 Ga0207704_10155786 3300025938 Bacteria 1619
20 Ga0207679_10236180 3300025945 Bacteria 1546
21 Ga0207667_11356462 3300025949 Bacteria 686
22 Ga0307411_10806207 3300032005 Bacteria 827
23 Ga0395899_0074597 3300037312 Bacteria 2477
24 Ga0395899_0136096 3300037312 Bacteria 1751
25 Ga0395899_0708921 3300037312 Bacteria 630
26 Ga0395900_0000229 3300037418 Bacteria 88118
27 Ga0395900_0301135 3300037418 Bacteria 1589
28 Ga0395900_0421525 3300037418 Bacteria 1295
29 Ga0395900_0489020 3300037418 Bacteria 1182
30 Ga0395898_0301879 3300037466 Bacteria 1527
31 Ga0395898_0341715 3300037466 Bacteria 1427
32 Ga0395898_0950182 3300037466 Bacteria 796
33 Ga0395905_0238795 3300037471 Bacteria 1698
34 Ga0395905_0298023 3300037471 Bacteria 1499
35 Ga0395905_0392930 3300037471 Bacteria 1281
36 Ga0395905_0512004 3300037471 Bacteria 1100
37 Ga0395901_0000362 3300038443 Bacteria 54976
38 Ga0395901_0076211 3300038443 Bacteria 3498
39 Ga0436361_0267308 3300039447 Bacteria 654
40 Ga0436361_0795799 3300039447 Bacteria 83096
41 Ga0436361_0797777 3300039447 Bacteria 10788
42 Ga0439455_0009774 3300042012 Bacteria 2091
43 Ga0439446_0065135 3300042156 Bacteria 1107
44 Ga0439458_0075757 3300042157 Bacteria 854
45 Ga0466969_0035218 3300044656 Bacteria 2532
46 Ga0466972_0000685 3300044658 Bacteria 16208
47 Ga0466965_0004913 3300044683 Bacteria 5976
48 Ga0466966_0022379 3300044684 Bacteria 4148
49 Ga0466966_0055526 3300044684 Bacteria 2506
50 Ga0466961_0243966 3300044693 Bacteria 1104
51 Ga0466963_0636738 3300044694 Bacteria 753
52 Ga0466964_0035746 3300044706 Bacteria 1988
53 Ga0466964_0076692 3300044706 Bacteria 1426
54 Ga0466970_0123437 3300044765 Bacteria 1419
55 Ga0466957_0177018 3300044842 Bacteria 1391
56 Ga0466960_0023404 3300044901 Bacteria 2774
57 Ga0466959_0058572 3300045049 Bacteria 2805
58 Ga0495627_000919 3300046453 Bacteria 20380
59 Ga0495627_061484 3300046453 Bacteria 1110
60 Ga0495627_077063 3300046453 Bacteria 969
61 Ga0495603_0183545 3300046455 Bacteria 1210
62 Ga0495590_0016986 3300046457 Bacteria 2625
63 Ga0495638_0049315 3300046460 Bacteria 2632
64 Ga0495638_0122205 3300046460 Bacteria 1537
65 Ga0495638_0123210 3300046460 Bacteria 1530
66 Ga0495653_0012206 3300046463 Bacteria 7008
67 Ga0495650_0000086 3300046471 Bacteria 235224
68 Ga0495650_0002991 3300046471 Bacteria 12800
69 Ga0495580_0199014 3300046472 Bacteria 1381
70 Ga0495605_0000029 3300046474 Bacteria 215329
71 Ga0495605_0001608 3300046474 Bacteria 14637
72 Ga0495605_0059448 3300046474 Bacteria 1835
73 Ga0495584_0000003 3300046491 Bacteria 323768
74 Ga0495584_0022237 3300046491 Bacteria 3219
75 Ga0495584_0022741 3300046491 Bacteria 3180
76 Ga0495584_0175389 3300046491 Bacteria 1089
77 Ga0495584_0196456 3300046491 Bacteria 1025
78 Ga0495584_0225898 3300046491 Bacteria 951
79 Ga0495584_0327906 3300046491 Bacteria 777
80 Ga0495584_0367222 3300046491 Bacteria 731
81 Ga0495585_0000010 3300046492 Bacteria 229958
82 Ga0495585_0000611 3300046492 Bacteria 33357
83 Ga0495585_0001025 3300046492 Bacteria 23255
84 Ga0495585_0001850 3300046492 Bacteria 16006
85 Ga0495585_0001997 3300046492 Bacteria 15134
86 Ga0495585_0002770 3300046492 Bacteria 12223
87 Ga0495585_0007536 3300046492 Bacteria 6656
88 Ga0495585_0008178 3300046492 Bacteria 6352
89 Ga0495585_0022469 3300046492 Bacteria 3620
90 Ga0495585_0033362 3300046492 Bacteria 2914
91 Ga0495585_0045351 3300046492 Bacteria 2454
92 Ga0495585_0050463 3300046492 Bacteria 2308
93 Ga0495585_0058558 3300046492 Bacteria 2125
94 Ga0495585_0198621 3300046492 Bacteria 1022
95 Ga0495594_0020047 3300046499 Bacteria 3560
96 Ga0495594_0045686 3300046499 Bacteria 2404
97 Ga0495594_0206179 3300046499 Bacteria 1120
98 Ga0495596_0005860 3300046500 Bacteria 5743
99 Ga0495596_0005908 3300046500 Bacteria 5711
100 Ga0495596_0010342 3300046500 Bacteria 4065
101 Ga0495596_0053817 3300046500 Bacteria 1574
102 Ga0495596_0147884 3300046500 Bacteria 912
103 Ga0495596_0208297 3300046500 Bacteria 759
104 Ga0495607_0018924 3300046501 Bacteria 4381
105 Ga0495607_0026182 3300046501 Bacteria 3620
106 Ga0495607_0047637 3300046501 Bacteria 2510
107 Ga0495607_0398474 3300046501 Bacteria 627
108 Ga0495583_0000308 3300046506 Bacteria 77290
109 Ga0495583_0001816 3300046506 Bacteria 20059
110 Ga0495583_0005367 3300046506 Bacteria 8734
111 Ga0495583_0011952 3300046506 Bacteria 4952
112 Ga0495583_0033741 3300046506 Bacteria 2459
113 Ga0495583_0058146 3300046506 Bacteria 1736
114 Ga0495606_0000376 3300046507 Bacteria 75612
115 Ga0495606_0005004 3300046507 Bacteria 12925
116 Ga0495606_0007238 3300046507 Bacteria 9999
117 Ga0495606_0012359 3300046507 Bacteria 6855
118 Ga0495606_0013729 3300046507 Bacteria 6376
119 Ga0495606_0039396 3300046507 Bacteria 3185
120 Ga0495606_0097905 3300046507 Bacteria 1791
121 Ga0495606_0112074 3300046507 Bacteria 1644
122 Ga0495606_0224941 3300046507 Bacteria 1055
123 Ga0495610_0000010 3300046512 Bacteria 538821
124 Ga0495610_0008100 3300046512 Bacteria 6875
125 Ga0495610_0212877 3300046512 Bacteria 785
126 Ga0495616_0001486 3300046513 Bacteria 16254
127 Ga0495616_0007231 3300046513 Bacteria 6654
128 Ga0495616_0011181 3300046513 Bacteria 5153
129 Ga0495616_0240292 3300046513 Bacteria 781
130 Ga0495616_0265333 3300046513 Bacteria 733
131 Ga0495631_0003818 3300046518 Bacteria 8179
132 Ga0495631_0032246 3300046518 Bacteria 2363
133 Ga0495631_0032821 3300046518 Bacteria 2338
134 Ga0495631_0035678 3300046518 Bacteria 2223
135 Ga0495631_0042684 3300046518 Bacteria 2003
136 Ga0495631_0053705 3300046518 Bacteria 1758
137 Ga0495632_0006889 3300046519 Bacteria 7230
138 Ga0495632_0014356 3300046519 Bacteria 4483
139 Ga0495637_0000056 3300046520 Bacteria 98978
140 Ga0495637_0053017 3300046520 Bacteria 1690
141 Ga0495643_0021536 3300046522 Bacteria 3696
142 Ga0495643_0037394 3300046522 Bacteria 2662
143 Ga0495643_0151833 3300046522 Bacteria 1146
144 Ga0495644_0005403 3300046523 Bacteria 4991
145 Ga0495644_0006152 3300046523 Bacteria 4666
146 Ga0495644_0015012 3300046523 Bacteria 2966
147 Ga0495644_0025667 3300046523 Bacteria 2236
148 Ga0495644_0139305 3300046523 Bacteria 926
149 Ga0495648_0000003 3300046524 Bacteria 386817
150 Ga0495648_0007303 3300046524 Bacteria 8859
151 Ga0495648_0012108 3300046524 Bacteria 6456
152 Ga0495648_0015392 3300046524 Bacteria 5555
153 Ga0495648_0022297 3300046524 Bacteria 4363
154 Ga0495648_0038326 3300046524 Bacteria 3067
155 Ga0495648_0074514 3300046524 Bacteria 1955
156 Ga0495663_0054784 3300046525 Bacteria 1242
157 Ga0495666_0003212 3300046526 Bacteria 8230
158 Ga0495666_0079835 3300046526 Bacteria 1549
159 Ga0495642_0003582 3300046528 Bacteria 6107
160 Ga0495642_0005758 3300046528 Bacteria 4754
161 Ga0495642_0016459 3300046528 Bacteria 2881
162 Ga0495642_0020277 3300046528 Bacteria 2610
163 Ga0495642_0049768 3300046528 Bacteria 1722
164 Ga0495642_0175193 3300046528 Bacteria 932
165 Ga0495642_0180172 3300046528 Bacteria 919
166 Ga0495654_0000002 3300046530 Bacteria 1021205
167 Ga0495654_0013158 3300046530 Bacteria 4431
168 Ga0495665_0009214 3300046531 Bacteria 5347
169 Ga0495665_0022430 3300046531 Bacteria 3394
170 Ga0495586_0005159 3300046535 Bacteria 6992
171 Ga0495609_0005719 3300046538 Bacteria 6474
172 Ga0495609_0010984 3300046538 Bacteria 4325
173 Ga0495609_0011591 3300046538 Bacteria 4196
174 Ga0495597_0001240 3300046542 Bacteria 18946
175 Ga0495597_0002299 3300046542 Bacteria 12404
176 Ga0495597_0006376 3300046542 Bacteria 6105
177 Ga0495597_0080400 3300046542 Bacteria 1394
178 Ga0495597_0140773 3300046542 Bacteria 995
179 Ga0495645_0063108 3300046543 Bacteria 2683
180 Ga0495622_0003771 3300046557 Bacteria 7087
181 Ga0495633_0000031 3300046558 Bacteria 196727
182 Ga0495633_0013671 3300046558 Bacteria 4268
183 Ga0495633_0034190 3300046558 Bacteria 2446
184 Ga0495633_0043830 3300046558 Bacteria 2121
185 Ga0495633_0065262 3300046558 Bacteria 1701
186 Ga0495633_0081111 3300046558 Bacteria 1509
187 Ga0495656_0014276 3300046615 Bacteria 2975
188 Ga0495656_0133337 3300046615 Bacteria 1184
189 Ga0495656_0182298 3300046615 Bacteria 1033
190 Ga0495668_0000779 3300046616 Bacteria 37172
191 Ga0495668_0000811 3300046616 Bacteria 35800
192 Ga0495668_0009658 3300046616 Bacteria 5901
193 Ga0495668_0082578 3300046616 Bacteria 1762
194 Ga0495668_0159972 3300046616 Bacteria 1233
195 Ga0495668_0238110 3300046616 Bacteria 996
196 Ga0495611_0003659 3300046648 Bacteria 6742
197 Ga0495611_0014118 3300046648 Bacteria 3408
198 Ga0495611_0014126 3300046648 Bacteria 3407
199 Ga0495611_0145420 3300046648 Bacteria 1107
200 Ga0495625_0000491 3300046660 Bacteria 59427
201 Ga0495625_0052406 3300046660 Bacteria 2922
202 Ga0495625_0154615 3300046660 Bacteria 1540
203 Ga0495625_0260629 3300046660 Bacteria 1122
204 Ga0495661_0034698 3300046665 Bacteria 3172
205 Ga0495661_0046170 3300046665 Bacteria 2660
206 Ga0495661_0061255 3300046665 Bacteria 2234
207 Ga0495661_0095718 3300046665 Bacteria 1680
208 Ga0495661_0110790 3300046665 Bacteria 1530
209 Ga0495661_0146905 3300046665 Bacteria 1277
210 Ga0495661_0154004 3300046665 Bacteria 1239
211 Ga0495661_0340597 3300046665 Bacteria 740
212 Ga0495661_0380494 3300046665 Bacteria 689
213 Ga0495588_0000078 3300046674 Bacteria 214254
214 Ga0495588_0017161 3300046674 Bacteria 3510
215 Ga0495588_0030048 3300046674 Bacteria 2729
216 Ga0495588_0187278 3300046674 Bacteria 1093
217 Ga0495588_0194816 3300046674 Bacteria 1070
218 Ga0495588_0271528 3300046674 Bacteria 893
219 Ga0495588_0274970 3300046674 Bacteria 887
220 Ga0495623_0071864 3300046679 Bacteria 2152
221 Ga0495669_0009602 3300046684 Bacteria 4082
222 Ga0495669_0014729 3300046684 Bacteria 3344
223 Ga0495669_0076347 3300046684 Bacteria 1533
224 Ga0495613_0101568 3300046689 Bacteria 2077
225 Ga0495624_0005484 3300046690 Bacteria 9139
226 Ga0495670_0008873 3300046691 Bacteria 4947
227 Ga0495670_0009232 3300046691 Bacteria 4851
228 Ga0495670_0060404 3300046691 Bacteria 1904
229 Ga0495670_0470462 3300046691 Bacteria 681
230 Ga0495671_0000002 3300046692 Bacteria 1136189
231 Ga0495671_0010852 3300046692 Bacteria 5036
232 Ga0495671_0011111 3300046692 Bacteria 4969
233 Ga0495671_0041448 3300046692 Bacteria 2318
234 Ga0495671_0354664 3300046692 Bacteria 703
235 Ga0495649_0032809 3300046694 Bacteria 2859
236 Ga0495649_0148343 3300046694 Bacteria 1232
237 Ga0495589_0000472 3300046794 Bacteria 29346
238 Ga0495589_0024968 3300046794 Bacteria 3034
239 Ga0495589_0083977 3300046794 Bacteria 1548
240 Ga0495660_0000252 3300046810 Bacteria 51417
241 Ga0495660_0003229 3300046810 Bacteria 10127
242 Ga0495660_0014384 3300046810 Bacteria 4580
243 Ga0495660_0024632 3300046810 Bacteria 3427
244 Ga0495660_0061492 3300046810 Bacteria 2015
245 Ga0495660_0074672 3300046810 Bacteria 1790
246 Ga0495660_0098459 3300046810 Bacteria 1508
247 Ga0495581_0009200 3300047315 Bacteria 5715
248 Ga0495604_0016058 3300047317 Bacteria 5979
249 Ga0495604_0285817 3300047317 Bacteria 1112
250 Ga0495672_0015491 3300047320 Bacteria 5174
251 Ga0495680_0030571 3300047322 Bacteria 4396
252 Ga0495680_0078000 3300047322 Bacteria 2508
253 Ga0495683_0000046 3300047323 Bacteria 129843
254 Ga0495683_0007464 3300047323 Bacteria 5909
255 Ga0495683_0033162 3300047323 Bacteria 2629
256 Ga0495683_0123444 3300047323 Bacteria 1227
257 Ga0495683_0153672 3300047323 Bacteria 1069
258 Ga0495687_000102 3300047443 Bacteria 129228
259 Ga0495687_001288 3300047443 Bacteria 23563
260 Ga0495687_007011 3300047443 Bacteria 6759
261 Ga0495687_071951 3300047443 Bacteria 1383
262 Ga0495687_084364 3300047443 Bacteria 1235
263 Ga0495675_0006057 3300047444 Bacteria 7403
264 Ga0495675_0074034 3300047444 Bacteria 2147
265 Ga0495675_0250424 3300047444 Bacteria 1064
266 Ga0495677_0030561 3300047445 Bacteria 1960
267 Ga0495677_0033629 3300047445 Bacteria 1868
268 Ga0495677_0052515 3300047445 Bacteria 1502
269 Ga0495677_0207420 3300047445 Bacteria 762
270 Ga0495679_014459 3300047446 Bacteria 2923
271 Ga0495679_018350 3300047446 Bacteria 2485
272 Ga0495685_001126 3300047447 Bacteria 8174
273 Ga0495673_0000005 3300047469 Bacteria 943364
274 Ga0495673_0000026 3300047469 Bacteria 476378
275 Ga0495673_0000028 3300047469 Bacteria 473418
276 Ga0495673_0186295 3300047469 Bacteria 783
277 Ga0495673_0194461 3300047469 Bacteria 762
278 Ga0495681_0008596 3300047470 Bacteria 6377
279 Ga0495681_0017145 3300047470 Bacteria 4034
280 Ga0495681_0026817 3300047470 Bacteria 2990
281 Ga0495681_0031754 3300047470 Bacteria 2667
282 Ga0495686_0000429 3300047472 Bacteria 65535
283 Ga0495593_0006034 3300047673 Bacteria 7128
284 Ga0495593_0030901 3300047673 Bacteria 2928
285 Ga0495614_0005436 3300048089 Bacteria 5743
286 Ga0495614_0434038 3300048089 Unclassified 620
287 Ga0495626_0000028 3300048091 Bacteria 204580
288 Ga0495626_0004690 3300048091 Bacteria 8289
289 Ga0495626_0021045 3300048091 Bacteria 3243
290 Ga0495626_0058791 3300048091 Bacteria 1755
291 Ga0495626_0162805 3300048091 Bacteria 934
292 Ga0496102_0003665 3300048905 Bacteria 12985
293 Ga0496102_0074170 3300048905 Bacteria 3127
294 Ga0496103_0164825 3300048906 Bacteria 1422
295 Ga0496103_0296523 3300048906 Bacteria 1040
296 Ga0496106_0617758 3300048909 Bacteria 867
297 Ga0496107_0063959 3300048910 Bacteria 2667
298 Ga0496108_0965476 3300048911 Bacteria 729
299 Ga0496109_1571160 3300048912 Bacteria 592
300 Ga0496110_0000253 3300048913 Bacteria 34767
301 Ga0496111_0580144 3300048914 Bacteria 822
302 Ga0496112_0236399 3300048915 Bacteria 1781
303 Ga0496114_0440254 3300048917 Bacteria 1154
304 Ga0496115_0028424 3300048918 Bacteria 4383
305 Ga0496115_0039959 3300048918 Bacteria 3727
306 Ga0496121_0424820 3300048924 Bacteria 864
307 Ga0496122_0006035 3300048925 Bacteria 14130
308 Ga0496122_0124571 3300048925 Bacteria 1653
309 Ga0496123_0005928 3300048926 Bacteria 12039
310 Ga0496124_0007689 3300048927 Bacteria 11400
311 Ga0496124_0082971 3300048927 Bacteria 2630
312 Ga0496124_0155199 3300048927 Bacteria 1791
313 Ga0496124_0326546 3300048927 Bacteria 1096
314 Ga0496126_0005073 3300048929 Bacteria 15275
315 Ga0495678_000107 3300049459 Bacteria 100130
316 Ga0495682_0017304 3300049460 Bacteria 2722
317 Ga0501035_0009934 3300049822 Bacteria 8836
318 Ga0501044_0435776 3300049823 Bacteria 1219
319 Ga0500618_000167 3300053125 Bacteria 54849
320 Ga0500618_011200 3300053125 Bacteria 2385
321 Ga0500586_002639 3300053145 Bacteria 4101

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046453 Ga0495627_077063 Ga0495627_077063_136_672 158
2 3300046524 Ga0495648_0074514 Ga0495648_0074514_534_1037 161
3 3300047443 Ga0495687_071951 Ga0495687_071951_401_904 161
4 iso_pu_bacteria 2857564685 2857567490 162
5 3300046492 Ga0495585_0002770 Ga0495585_0002770_11583_12092 163
6 3300046665 Ga0495661_0061255 Ga0495661_0061255_1621_2130 163
7 3300046691 Ga0495670_0009232 Ga0495670_0009232_4264_4773 163
8 iso_pu_bacteria 2643221556 2643802624 163
9 iso_pu_bacteria 2643221684 2644472129 163
10 iso_pu_bacteria 2738541297 2738829086 163
11 iso_pu_bacteria 2738541357 2739152882 163
12 iso_pu_bacteria 2738543003 2739194802 163
13 iso_pu_bacteria 2738543026 2739321278 163
14 iso_pu_bacteria 2738543029 2739339519 163
15 iso_pu_bacteria 2821131069 2821133296 163
16 iso_pu_bacteria 8047673197 8047675246 163
17 3300048918 Ga0496115_0039959 Ga0496115_0039959_527_1042 165
18 3300025295 Ga0209564_1000072 Ga0209564_1000072222 166
19 3300046460 Ga0495638_0122205 Ga0495638_0122205_881_1405 166
20 3300046460 Ga0495638_0123210 Ga0495638_0123210_112_636 166
21 3300046471 Ga0495650_0002991 Ga0495650_0002991_1480_2004 166
22 3300046474 Ga0495605_0001608 Ga0495605_0001608_9134_9658 166
23 3300046507 Ga0495606_0012359 Ga0495606_0012359_4691_5215 166
24 3300046512 Ga0495610_0008100 Ga0495610_0008100_349_873 166
25 3300046520 Ga0495637_0000056 Ga0495637_0000056_39099_39623 166
26 3300046530 Ga0495654_0000002 Ga0495654_0000002_189963_190487 166
27 3300046531 Ga0495665_0022430 Ga0495665_0022430_2613_3131 166
28 3300046660 Ga0495625_0000491 Ga0495625_0000491_4053_4577 166
29 3300046660 Ga0495625_0260629 Ga0495625_0260629_141_665 166
30 3300046810 Ga0495660_0061492 Ga0495660_0061492_1291_1815 166
31 3300047322 Ga0495680_0078000 Ga0495680_0078000_692_1210 166
32 3300047469 Ga0495673_0000028 Ga0495673_0000028_309892_310422 166
33 3300047469 Ga0495673_0186295 Ga0495673_0186295_215_745 166
34 3300047673 Ga0495593_0030901 Ga0495593_0030901_618_1136 166
35 3300048089 Ga0495614_0434038 Ga0495614_0434038_43_561 166
36 3300048918 Ga0496115_0028424 Ga0496115_0028424_711_1229 166
37 3300003320 rootH2_10092706 rootH2_100927061 167
38 3300003763 Ga0055529_1000051 Ga0055529_1000051141 167
39 3300005339 Ga0070660_100048019 Ga0070660_1000480192 167
40 3300005344 Ga0070661_100146667 Ga0070661_1001466671 167
41 3300005366 Ga0070659_100342659 Ga0070659_1003426592 167
42 3300005457 Ga0070662_100384433 Ga0070662_1003844332 167
43 3300005564 Ga0070664_100021365 Ga0070664_1000213654 167
44 3300006881 Ga0068865_100420249 Ga0068865_1004202492 167
45 3300021361 Ga0213872_10000088 Ga0213872_1000008836 167
46 3300021361 Ga0213872_10001273 Ga0213872_100012737 167
47 3300021361 Ga0213872_10007040 Ga0213872_100070402 167
48 3300021361 Ga0213872_10008486 Ga0213872_100084864 167
49 3300025272 Ga0209455_1000044 Ga0209455_100004466 167
50 3300025919 Ga0207657_10017606 Ga0207657_100176067 167
51 3300025932 Ga0207690_10168189 Ga0207690_101681892 167
52 3300025933 Ga0207706_10109521 Ga0207706_101095212 167
53 3300025933 Ga0207706_10984093 Ga0207706_109840932 167
54 3300025938 Ga0207704_10155786 Ga0207704_101557862 167
55 3300025945 Ga0207679_10236180 Ga0207679_102361802 167
56 3300025949 Ga0207667_11356462 Ga0207667_113564621 167
57 3300032005 Ga0307411_10806207 Ga0307411_108062072 167
58 3300037312 Ga0395899_0074597 Ga0395899_0074597_848_1369 167
59 3300037312 Ga0395899_0136096 Ga0395899_0136096_803_1324 167
60 3300037312 Ga0395899_0708921 Ga0395899_0708921_87_608 167
61 3300037418 Ga0395900_0000229 Ga0395900_0000229_84238_84759 167
62 3300037418 Ga0395900_0301135 Ga0395900_0301135_1054_1575 167
63 3300037418 Ga0395900_0421525 Ga0395900_0421525_731_1252 167
64 3300037418 Ga0395900_0489020 Ga0395900_0489020_265_786 167
65 3300037466 Ga0395898_0301879 Ga0395898_0301879_389_910 167
66 3300037466 Ga0395898_0341715 Ga0395898_0341715_863_1384 167
67 3300037466 Ga0395898_0950182 Ga0395898_0950182_15_536 167
68 3300037471 Ga0395905_0238795 Ga0395905_0238795_124_645 167
69 3300037471 Ga0395905_0298023 Ga0395905_0298023_203_724 167
70 3300037471 Ga0395905_0392930 Ga0395905_0392930_735_1256 167
71 3300037471 Ga0395905_0512004 Ga0395905_0512004_127_648 167
72 3300038443 Ga0395901_0000362 Ga0395901_0000362_1394_1915 167
73 3300038443 Ga0395901_0076211 Ga0395901_0076211_480_1001 167
74 3300039447 Ga0436361_0267308 Ga0436361_0267308_88_612 167
75 3300039447 Ga0436361_0795799 Ga0436361_0795799_47225_47749 167
76 3300039447 Ga0436361_0797777 Ga0436361_0797777_5957_6481 167
77 3300042012 Ga0439455_0009774 Ga0439455_0009774_84_605 167
78 3300042156 Ga0439446_0065135 Ga0439446_0065135_515_1039 167
79 3300042157 Ga0439458_0075757 Ga0439458_0075757_117_638 167
80 3300044656 Ga0466969_0035218 Ga0466969_0035218_1982_2503 167
81 3300044658 Ga0466972_0000685 Ga0466972_0000685_6150_6671 167
82 3300044683 Ga0466965_0004913 Ga0466965_0004913_2695_3216 167
83 3300044684 Ga0466966_0022379 Ga0466966_0022379_1782_2303 167
84 3300044684 Ga0466966_0055526 Ga0466966_0055526_1249_1770 167
85 3300044693 Ga0466961_0243966 Ga0466961_0243966_563_1084 167
86 3300044694 Ga0466963_0636738 Ga0466963_0636738_72_593 167
87 3300044706 Ga0466964_0035746 Ga0466964_0035746_986_1507 167
88 3300044706 Ga0466964_0076692 Ga0466964_0076692_101_622 167
89 3300044765 Ga0466970_0123437 Ga0466970_0123437_510_1031 167
90 3300044842 Ga0466957_0177018 Ga0466957_0177018_520_1041 167
91 3300044901 Ga0466960_0023404 Ga0466960_0023404_862_1383 167
92 3300045049 Ga0466959_0058572 Ga0466959_0058572_1379_1900 167
93 3300046453 Ga0495627_000919 Ga0495627_000919_18505_19026 167
94 3300046453 Ga0495627_061484 Ga0495627_061484_554_1075 167
95 3300046455 Ga0495603_0183545 Ga0495603_0183545_90_614 167
96 3300046457 Ga0495590_0016986 Ga0495590_0016986_541_1062 167
97 3300046460 Ga0495638_0049315 Ga0495638_0049315_2094_2615 167
98 3300046463 Ga0495653_0012206 Ga0495653_0012206_2821_3342 167
99 3300046471 Ga0495650_0000086 Ga0495650_0000086_61126_61653 167
100 3300046472 Ga0495580_0199014 Ga0495580_0199014_689_1213 167
101 3300046474 Ga0495605_0000029 Ga0495605_0000029_212683_213204 167
102 3300046474 Ga0495605_0059448 Ga0495605_0059448_628_1149 167
103 3300046491 Ga0495584_0000003 Ga0495584_0000003_96143_96664 167
104 3300046491 Ga0495584_0022237 Ga0495584_0022237_2358_2879 167
105 3300046491 Ga0495584_0022741 Ga0495584_0022741_1420_1941 167
106 3300046491 Ga0495584_0175389 Ga0495584_0175389_253_774 167
107 3300046491 Ga0495584_0196456 Ga0495584_0196456_271_792 167
108 3300046491 Ga0495584_0225898 Ga0495584_0225898_274_795 167
109 3300046491 Ga0495584_0327906 Ga0495584_0327906_194_715 167
110 3300046491 Ga0495584_0367222 Ga0495584_0367222_188_709 167
111 3300046492 Ga0495585_0000010 Ga0495585_0000010_134067_134660 167
112 3300046492 Ga0495585_0000611 Ga0495585_0000611_4523_5050 167
113 3300046492 Ga0495585_0001025 Ga0495585_0001025_19646_20167 167
114 3300046492 Ga0495585_0001850 Ga0495585_0001850_3082_3603 167
115 3300046492 Ga0495585_0001997 Ga0495585_0001997_2952_3476 167
116 3300046492 Ga0495585_0007536 Ga0495585_0007536_37_558 167
117 3300046492 Ga0495585_0008178 Ga0495585_0008178_3569_4090 167
118 3300046492 Ga0495585_0022469 Ga0495585_0022469_2189_2710 167
119 3300046492 Ga0495585_0033362 Ga0495585_0033362_1278_1799 167
120 3300046492 Ga0495585_0045351 Ga0495585_0045351_258_779 167
121 3300046492 Ga0495585_0050463 Ga0495585_0050463_594_1115 167
122 3300046492 Ga0495585_0058558 Ga0495585_0058558_1331_1852 167
123 3300046492 Ga0495585_0198621 Ga0495585_0198621_217_738 167
124 3300046499 Ga0495594_0020047 Ga0495594_0020047_2596_3120 167
125 3300046499 Ga0495594_0045686 Ga0495594_0045686_301_822 167
126 3300046499 Ga0495594_0206179 Ga0495594_0206179_565_1086 167
127 3300046500 Ga0495596_0005860 Ga0495596_0005860_3475_3996 167
128 3300046500 Ga0495596_0005908 Ga0495596_0005908_3468_3989 167
129 3300046500 Ga0495596_0010342 Ga0495596_0010342_2725_3246 167
130 3300046500 Ga0495596_0053817 Ga0495596_0053817_944_1465 167
131 3300046500 Ga0495596_0147884 Ga0495596_0147884_325_846 167
132 3300046500 Ga0495596_0208297 Ga0495596_0208297_40_561 167
133 3300046501 Ga0495607_0018924 Ga0495607_0018924_2878_3399 167
134 3300046501 Ga0495607_0026182 Ga0495607_0026182_2883_3404 167
135 3300046501 Ga0495607_0047637 Ga0495607_0047637_120_641 167
136 3300046501 Ga0495607_0398474 Ga0495607_0398474_29_550 167
137 3300046506 Ga0495583_0000308 Ga0495583_0000308_73620_74141 167
138 3300046506 Ga0495583_0001816 Ga0495583_0001816_16432_16953 167
139 3300046506 Ga0495583_0005367 Ga0495583_0005367_5594_6115 167
140 3300046506 Ga0495583_0011952 Ga0495583_0011952_3114_3635 167
141 3300046506 Ga0495583_0033741 Ga0495583_0033741_1718_2239 167
142 3300046506 Ga0495583_0058146 Ga0495583_0058146_282_803 167
143 3300046507 Ga0495606_0000376 Ga0495606_0000376_3995_4522 167
144 3300046507 Ga0495606_0005004 Ga0495606_0005004_10414_10935 167
145 3300046507 Ga0495606_0007238 Ga0495606_0007238_8810_9331 167
146 3300046507 Ga0495606_0013729 Ga0495606_0013729_1129_1650 167
147 3300046507 Ga0495606_0039396 Ga0495606_0039396_233_754 167
148 3300046507 Ga0495606_0097905 Ga0495606_0097905_1034_1555 167
149 3300046507 Ga0495606_0112074 Ga0495606_0112074_1089_1610 167
150 3300046507 Ga0495606_0224941 Ga0495606_0224941_100_621 167
151 3300046512 Ga0495610_0000010 Ga0495610_0000010_157512_158039 167
152 3300046512 Ga0495610_0212877 Ga0495610_0212877_200_721 167
153 3300046513 Ga0495616_0001486 Ga0495616_0001486_13347_13940 167
154 3300046513 Ga0495616_0007231 Ga0495616_0007231_1858_2379 167
155 3300046513 Ga0495616_0011181 Ga0495616_0011181_4036_4557 167
156 3300046513 Ga0495616_0240292 Ga0495616_0240292_247_768 167
157 3300046513 Ga0495616_0265333 Ga0495616_0265333_186_707 167
158 3300046518 Ga0495631_0003818 Ga0495631_0003818_7201_7722 167
159 3300046518 Ga0495631_0032246 Ga0495631_0032246_971_1492 167
160 3300046518 Ga0495631_0032821 Ga0495631_0032821_303_824 167
161 3300046518 Ga0495631_0035678 Ga0495631_0035678_1574_2095 167
162 3300046518 Ga0495631_0042684 Ga0495631_0042684_1005_1526 167
163 3300046518 Ga0495631_0053705 Ga0495631_0053705_49_570 167
164 3300046519 Ga0495632_0006889 Ga0495632_0006889_2336_2857 167
165 3300046519 Ga0495632_0014356 Ga0495632_0014356_1701_2222 167
166 3300046520 Ga0495637_0053017 Ga0495637_0053017_1109_1630 167
167 3300046522 Ga0495643_0021536 Ga0495643_0021536_298_819 167
168 3300046522 Ga0495643_0037394 Ga0495643_0037394_799_1320 167
169 3300046522 Ga0495643_0151833 Ga0495643_0151833_399_920 167
170 3300046523 Ga0495644_0005403 Ga0495644_0005403_1161_1682 167
171 3300046523 Ga0495644_0006152 Ga0495644_0006152_119_640 167
172 3300046523 Ga0495644_0015012 Ga0495644_0015012_2024_2545 167
173 3300046523 Ga0495644_0025667 Ga0495644_0025667_1533_2054 167
174 3300046523 Ga0495644_0139305 Ga0495644_0139305_226_747 167
175 3300046524 Ga0495648_0000003 Ga0495648_0000003_95299_95892 167
176 3300046524 Ga0495648_0007303 Ga0495648_0007303_3871_4398 167
177 3300046524 Ga0495648_0012108 Ga0495648_0012108_1352_1873 167
178 3300046524 Ga0495648_0015392 Ga0495648_0015392_1933_2460 167
179 3300046524 Ga0495648_0022297 Ga0495648_0022297_1817_2338 167
180 3300046524 Ga0495648_0038326 Ga0495648_0038326_2459_2980 167
181 3300046525 Ga0495663_0054784 Ga0495663_0054784_188_709 167
182 3300046526 Ga0495666_0003212 Ga0495666_0003212_3084_3608 167
183 3300046526 Ga0495666_0079835 Ga0495666_0079835_176_697 167
184 3300046528 Ga0495642_0003582 Ga0495642_0003582_1967_2488 167
185 3300046528 Ga0495642_0005758 Ga0495642_0005758_1569_2090 167
186 3300046528 Ga0495642_0016459 Ga0495642_0016459_2149_2670 167
187 3300046528 Ga0495642_0020277 Ga0495642_0020277_708_1229 167
188 3300046528 Ga0495642_0049768 Ga0495642_0049768_318_839 167
189 3300046528 Ga0495642_0175193 Ga0495642_0175193_378_899 167
190 3300046528 Ga0495642_0180172 Ga0495642_0180172_365_886 167
191 3300046530 Ga0495654_0013158 Ga0495654_0013158_2059_2586 167
192 3300046531 Ga0495665_0009214 Ga0495665_0009214_2263_2787 167
193 3300046535 Ga0495586_0005159 Ga0495586_0005159_2762_3283 167
194 3300046538 Ga0495609_0005719 Ga0495609_0005719_2514_3035 167
195 3300046538 Ga0495609_0010984 Ga0495609_0010984_970_1491 167
196 3300046538 Ga0495609_0011591 Ga0495609_0011591_2247_2768 167
197 3300046542 Ga0495597_0001240 Ga0495597_0001240_17003_17524 167
198 3300046542 Ga0495597_0002299 Ga0495597_0002299_2003_2524 167
199 3300046542 Ga0495597_0006376 Ga0495597_0006376_2824_3345 167
200 3300046542 Ga0495597_0080400 Ga0495597_0080400_743_1264 167
201 3300046542 Ga0495597_0140773 Ga0495597_0140773_71_592 167
202 3300046543 Ga0495645_0063108 Ga0495645_0063108_1967_2488 167
203 3300046557 Ga0495622_0003771 Ga0495622_0003771_4109_4633 167
204 3300046558 Ga0495633_0000031 Ga0495633_0000031_105702_106238 167
205 3300046558 Ga0495633_0013671 Ga0495633_0013671_1351_1944 167
206 3300046558 Ga0495633_0034190 Ga0495633_0034190_1353_1880 167
207 3300046558 Ga0495633_0043830 Ga0495633_0043830_205_726 167
208 3300046558 Ga0495633_0065262 Ga0495633_0065262_176_697 167
209 3300046558 Ga0495633_0081111 Ga0495633_0081111_515_1036 167
210 3300046615 Ga0495656_0014276 Ga0495656_0014276_2250_2771 167
211 3300046615 Ga0495656_0133337 Ga0495656_0133337_111_632 167
212 3300046615 Ga0495656_0182298 Ga0495656_0182298_210_731 167
213 3300046616 Ga0495668_0000779 Ga0495668_0000779_1620_2147 167
214 3300046616 Ga0495668_0000811 Ga0495668_0000811_33046_33567 167
215 3300046616 Ga0495668_0009658 Ga0495668_0009658_4026_4547 167
216 3300046616 Ga0495668_0082578 Ga0495668_0082578_1135_1656 167
217 3300046616 Ga0495668_0159972 Ga0495668_0159972_671_1192 167
218 3300046616 Ga0495668_0238110 Ga0495668_0238110_14_535 167
219 3300046648 Ga0495611_0003659 Ga0495611_0003659_5040_5561 167
220 3300046648 Ga0495611_0014118 Ga0495611_0014118_2854_3375 167
221 3300046648 Ga0495611_0014126 Ga0495611_0014126_1869_2390 167
222 3300046648 Ga0495611_0145420 Ga0495611_0145420_125_646 167
223 3300046660 Ga0495625_0052406 Ga0495625_0052406_1253_1774 167
224 3300046660 Ga0495625_0154615 Ga0495625_0154615_949_1470 167
225 3300046665 Ga0495661_0034698 Ga0495661_0034698_185_706 167
226 3300046665 Ga0495661_0046170 Ga0495661_0046170_1475_1996 167
227 3300046665 Ga0495661_0095718 Ga0495661_0095718_1137_1658 167
228 3300046665 Ga0495661_0110790 Ga0495661_0110790_669_1196 167
229 3300046665 Ga0495661_0146905 Ga0495661_0146905_618_1139 167
230 3300046665 Ga0495661_0154004 Ga0495661_0154004_223_744 167
231 3300046665 Ga0495661_0340597 Ga0495661_0340597_194_715 167
232 3300046665 Ga0495661_0380494 Ga0495661_0380494_139_660 167
233 3300046674 Ga0495588_0000078 Ga0495588_0000078_195181_195702 167
234 3300046674 Ga0495588_0017161 Ga0495588_0017161_2800_3324 167
235 3300046674 Ga0495588_0030048 Ga0495588_0030048_2066_2587 167
236 3300046674 Ga0495588_0187278 Ga0495588_0187278_444_965 167
237 3300046674 Ga0495588_0194816 Ga0495588_0194816_279_800 167
238 3300046674 Ga0495588_0271528 Ga0495588_0271528_250_771 167
239 3300046674 Ga0495588_0274970 Ga0495588_0274970_343_864 167
240 3300046679 Ga0495623_0071864 Ga0495623_0071864_726_1247 167
241 3300046684 Ga0495669_0009602 Ga0495669_0009602_3006_3527 167
242 3300046684 Ga0495669_0014729 Ga0495669_0014729_1329_1850 167
243 3300046684 Ga0495669_0076347 Ga0495669_0076347_908_1429 167
244 3300046689 Ga0495613_0101568 Ga0495613_0101568_202_723 167
245 3300046690 Ga0495624_0005484 Ga0495624_0005484_6206_6730 167
246 3300046691 Ga0495670_0008873 Ga0495670_0008873_1949_2470 167
247 3300046691 Ga0495670_0060404 Ga0495670_0060404_385_906 167
248 3300046691 Ga0495670_0470462 Ga0495670_0470462_56_577 167
249 3300046692 Ga0495671_0000002 Ga0495671_0000002_208371_208898 167
250 3300046692 Ga0495671_0010852 Ga0495671_0010852_816_1343 167
251 3300046692 Ga0495671_0011111 Ga0495671_0011111_3477_3998 167
252 3300046692 Ga0495671_0041448 Ga0495671_0041448_245_766 167
253 3300046692 Ga0495671_0354664 Ga0495671_0354664_170_691 167
254 3300046694 Ga0495649_0032809 Ga0495649_0032809_788_1309 167
255 3300046694 Ga0495649_0148343 Ga0495649_0148343_460_981 167
256 3300046794 Ga0495589_0000472 Ga0495589_0000472_26043_26564 167
257 3300046794 Ga0495589_0024968 Ga0495589_0024968_1640_2161 167
258 3300046794 Ga0495589_0083977 Ga0495589_0083977_537_1058 167
259 3300046810 Ga0495660_0000252 Ga0495660_0000252_49609_50130 167
260 3300046810 Ga0495660_0003229 Ga0495660_0003229_4510_5037 167
261 3300046810 Ga0495660_0014384 Ga0495660_0014384_1469_1990 167
262 3300046810 Ga0495660_0024632 Ga0495660_0024632_237_758 167
263 3300046810 Ga0495660_0074672 Ga0495660_0074672_1175_1696 167
264 3300046810 Ga0495660_0098459 Ga0495660_0098459_441_962 167
265 3300047315 Ga0495581_0009200 Ga0495581_0009200_3086_3610 167
266 3300047317 Ga0495604_0016058 Ga0495604_0016058_2728_3249 167
267 3300047317 Ga0495604_0285817 Ga0495604_0285817_40_561 167
268 3300047320 Ga0495672_0015491 Ga0495672_0015491_1156_1677 167
269 3300047322 Ga0495680_0030571 Ga0495680_0030571_2968_3489 167
270 3300047323 Ga0495683_0000046 Ga0495683_0000046_125326_125847 167
271 3300047323 Ga0495683_0007464 Ga0495683_0007464_3112_3633 167
272 3300047323 Ga0495683_0033162 Ga0495683_0033162_591_1118 167
273 3300047323 Ga0495683_0123444 Ga0495683_0123444_473_1066 167
274 3300047323 Ga0495683_0153672 Ga0495683_0153672_338_859 167
275 3300047443 Ga0495687_000102 Ga0495687_000102_97886_98407 167
276 3300047443 Ga0495687_001288 Ga0495687_001288_1088_1609 167
277 3300047443 Ga0495687_007011 Ga0495687_007011_2684_3205 167
278 3300047443 Ga0495687_084364 Ga0495687_084364_562_1083 167
279 3300047444 Ga0495675_0006057 Ga0495675_0006057_690_1211 167
280 3300047444 Ga0495675_0074034 Ga0495675_0074034_1569_2090 167
281 3300047444 Ga0495675_0250424 Ga0495675_0250424_285_806 167
282 3300047445 Ga0495677_0030561 Ga0495677_0030561_895_1416 167
283 3300047445 Ga0495677_0033629 Ga0495677_0033629_717_1238 167
284 3300047445 Ga0495677_0052515 Ga0495677_0052515_835_1356 167
285 3300047445 Ga0495677_0207420 Ga0495677_0207420_166_687 167
286 3300047446 Ga0495679_014459 Ga0495679_014459_1079_1606 167
287 3300047446 Ga0495679_018350 Ga0495679_018350_1849_2370 167
288 3300047447 Ga0495685_001126 Ga0495685_001126_1799_2320 167
289 3300047469 Ga0495673_0000005 Ga0495673_0000005_74303_74827 167
290 3300047469 Ga0495673_0000026 Ga0495673_0000026_104111_104638 167
291 3300047469 Ga0495673_0194461 Ga0495673_0194461_118_639 167
292 3300047470 Ga0495681_0008596 Ga0495681_0008596_4507_5028 167
293 3300047470 Ga0495681_0017145 Ga0495681_0017145_44_565 167
294 3300047470 Ga0495681_0026817 Ga0495681_0026817_1792_2313 167
295 3300047470 Ga0495681_0031754 Ga0495681_0031754_1349_1870 167
296 3300047472 Ga0495686_0000429 Ga0495686_0000429_24853_25374 167
297 3300047673 Ga0495593_0006034 Ga0495593_0006034_4431_4952 167
298 3300048089 Ga0495614_0005436 Ga0495614_0005436_1915_2436 167
299 3300048091 Ga0495626_0000028 Ga0495626_0000028_33870_34391 167
300 3300048091 Ga0495626_0004690 Ga0495626_0004690_2304_2825 167
301 3300048091 Ga0495626_0021045 Ga0495626_0021045_163_684 167
302 3300048091 Ga0495626_0058791 Ga0495626_0058791_584_1105 167
303 3300048091 Ga0495626_0162805 Ga0495626_0162805_310_831 167
304 3300048905 Ga0496102_0003665 Ga0496102_0003665_1381_1902 167
305 3300048905 Ga0496102_0074170 Ga0496102_0074170_2340_2861 167
306 3300048906 Ga0496103_0164825 Ga0496103_0164825_646_1167 167
307 3300048906 Ga0496103_0296523 Ga0496103_0296523_323_844 167
308 3300048909 Ga0496106_0617758 Ga0496106_0617758_60_581 167
309 3300048910 Ga0496107_0063959 Ga0496107_0063959_532_1053 167
310 3300048911 Ga0496108_0965476 Ga0496108_0965476_177_698 167
311 3300048912 Ga0496109_1571160 Ga0496109_1571160_14_535 167
312 3300048913 Ga0496110_0000253 Ga0496110_0000253_3767_4288 167
313 3300048914 Ga0496111_0580144 Ga0496111_0580144_121_642 167
314 3300048915 Ga0496112_0236399 Ga0496112_0236399_743_1369 167
315 3300048917 Ga0496114_0440254 Ga0496114_0440254_571_1092 167
316 3300048924 Ga0496121_0424820 Ga0496121_0424820_41_562 167
317 3300048925 Ga0496122_0006035 Ga0496122_0006035_11303_11824 167
318 3300048925 Ga0496122_0124571 Ga0496122_0124571_952_1473 167
319 3300048926 Ga0496123_0005928 Ga0496123_0005928_1838_2359 167
320 3300048927 Ga0496124_0007689 Ga0496124_0007689_5899_6474 167
321 3300048927 Ga0496124_0082971 Ga0496124_0082971_529_1050 167
322 3300048927 Ga0496124_0155199 Ga0496124_0155199_662_1183 167
323 3300048927 Ga0496124_0326546 Ga0496124_0326546_366_887 167
324 3300048929 Ga0496126_0005073 Ga0496126_0005073_5409_5933 167
325 3300049459 Ga0495678_000107 Ga0495678_000107_73145_73666 167
326 3300049460 Ga0495682_0017304 Ga0495682_0017304_1810_2331 167
327 3300049822 Ga0501035_0009934 Ga0501035_0009934_5051_5572 167
328 3300049823 Ga0501044_0435776 Ga0501044_0435776_345_866 167
329 3300053125 Ga0500618_000167 Ga0500618_000167_19626_20153 167
330 3300053125 Ga0500618_011200 Ga0500618_011200_1624_2151 167
331 3300053145 Ga0500586_002639 Ga0500586_002639_1920_2447 167

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sq3-assembly1.cif.gz_A designed trefoil knot protein, variant 1 0.3055 13 149
7und-assembly1.cif.gz_O pol ii-dsif-spt6-paf1c-tfiis-nucleosome complex (stalled at +38) 0.2884 30 130
7wio-assembly1.cif.gz_A nmr structure of n-terminal domain of triconephila clavipes of major ampullate spidroin 1 0.2863 29 149
7sq3-assembly1.cif.gz_A designed trefoil knot protein, variant 1 0.2855 13 149
2k3o-assembly1.cif.gz_A solution structure of the type 2 repetitive domain (tusp1-rp2) of the egg case silk from nephila antipodiana 0.2832 36 162
ID Description Score Start End Superfamily
af_Q54XU3_542_652_1.10.472.30 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Transcription elongation factor S-II, central domain 0.393 36 117 1.10.472.30
af_C4J362_195_322_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.3779 37 167 1.10.472.10
af_Q4D532_1_122_1.25.40.270 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Vacuolar protein sorting-associated protein vta1 0.3699 40 164 1.25.40.270
af_I1KB67_1_98_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.3595 62 164 1.20.930.10
af_Q3E914_263_357_1.20.930.10 Mainly Alpha;Up-down Bundle;Transcription Elongation Factor S-II; Chain A;Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.3564 62 158 1.20.930.10
ID Description Score Start End GO Terms
AF-A0A6I1H363-F1-model_v4 Uncharacterized protein 0.9529 40 167
AF-A0A6I1H363-F1-model_v4 Uncharacterized protein 0.9457 40 167
AF-A0A845HM28-F1-model_v4 Uncharacterized protein 0.9349 66 167
AF-A0A0H3Z4V0-F1-model_v4 deleted 0.9336 32 163
AF-A0A7Y3KEJ8-F1-model_v4 deleted 0.9261 26 164

Feature Viewer

pLDDT pTM Quality
80.9 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map